F300037

General Info

Members Datasets Scaffolds Average Seq Length
195 149 390 126

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10328813|Ga0105241_103288132
Length 148
Sequence MRAILARKLVRDREPRQKAGGAMALIHTCYRITDIDRSVEFYEALGFKEVGRVPIRDEAVNVFMSQPGDGDSPRLELTYNFGVDHYELGTGYGHIAITAPDLDATLAKLAEQGIEPERPPYSIREGGSRLCFVRDPDGYRIEILEMAV

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.62
Rhizosphere 91.28
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10328813 3300009174 Bacteria 1320
2 Ga0070658_10494699 3300005327 Bacteria 1056
3 Ga0070683_100034448 3300005329 Bacteria 4626
4 Ga0070666_10580861 3300005335 Bacteria 817
5 Ga0070660_100007388 3300005339 Bacteria 7655
6 Ga0070660_100100594 3300005339 Bacteria 2290
7 Ga0070671_100302035 3300005355 Bacteria 1363
8 Ga0070714_100835275 3300005435 Bacteria 893
9 Ga0070714_100840692 3300005435 Bacteria 890
10 Ga0070714_101807583 3300005435 Bacteria 597
11 Ga0070713_100427903 3300005436 Bacteria 1240
12 Ga0070711_100000326 3300005439 Bacteria 24637
13 Ga0070679_100214196 3300005530 Bacteria 1889
14 Ga0068856_100107913 3300005614 Bacteria 2780
15 Ga0068856_101371560 3300005614 Bacteria 722
16 Ga0068870_10180456 3300005840 Bacteria 1267
17 Ga0081455_10666253 3300005937 Bacteria 668
18 Ga0070715_10463395 3300006163 Bacteria 718
19 Ga0070716_100369226 3300006173 Bacteria 1022
20 Ga0070712_100000005 3300006175 Bacteria 177449
21 Ga0070712_101491638 3300006175 Unclassified 591
22 Ga0070712_101559102 3300006175 Bacteria 578
23 Ga0075428_100064737 3300006844 Bacteria 4004
24 Ga0075430_100002607 3300006846 Bacteria 15053
25 Ga0075431_100735739 3300006847 Bacteria 962
26 Ga0075434_100732208 3300006871 Bacteria 1006
27 Ga0075436_100233980 3300006914 Bacteria 1305
28 Ga0075435_100115738 3300007076 Bacteria 2233
29 Ga0075435_100972913 3300007076 Bacteria 741
30 Ga0111539_10320235 3300009094 Bacteria 1805
31 Ga0105245_10769433 3300009098 Bacteria 999
32 Ga0105245_10962777 3300009098 Bacteria 897
33 Ga0105245_11538550 3300009098 Bacteria 716
34 Ga0114129_10276244 3300009147 Bacteria 2246
35 Ga0105242_12250064 3300009176 Unclassified 591
36 Ga0105237_10000431 3300009545 Bacteria 59607
37 Ga0105238_10302346 3300009551 Bacteria 1583
38 Ga0105239_10208918 3300010375 Bacteria 2188
39 Ga0105246_10014081 3300011119 Bacteria 5025
40 Ga0157374_10942759 3300013296 Bacteria 881
41 Ga0157378_12471052 3300013297 Unclassified 571
42 Ga0163162_10125381 3300013306 Bacteria 2674
43 Ga0157372_10220124 3300013307 Unclassified 2200
44 Ga0157380_10485305 3300014326 Bacteria 1196
45 Ga0163161_10295716 3300017792 Bacteria 1274
46 Ga0207699_10994140 3300025906 Bacteria 620
47 Ga0207705_10187632 3300025909 Bacteria 1562
48 Ga0207654_10284200 3300025911 Bacteria 1120
49 Ga0207671_10012708 3300025914 Bacteria 6753
50 Ga0207693_10000023 3300025915 Bacteria 127876
51 Ga0207663_10000379 3300025916 Bacteria 19428
52 Ga0207657_10026415 3300025919 Bacteria 5338
53 Ga0207657_10106853 3300025919 Bacteria 2315
54 Ga0207649_10662277 3300025920 Bacteria 807
55 Ga0207649_11239620 3300025920 Bacteria 590
56 Ga0207687_10180416 3300025927 Bacteria 1635
57 Ga0207664_10701789 3300025929 Bacteria 910
58 Ga0207665_10101858 3300025939 Unclassified 2006
59 Ga0207665_11521220 3300025939 Bacteria 532
60 Ga0207661_10490400 3300025944 Bacteria 1122
61 Ga0207712_10907567 3300025961 Bacteria 779
62 Ga0207678_10916845 3300026067 Bacteria 775
63 Ga0207702_10082708 3300026078 Bacteria 2792
64 Ga0207702_11037256 3300026078 Bacteria 814
65 Ga0207675_100258986 3300026118 Bacteria 1685
66 Ga0207428_10377989 3300027907 Bacteria 1040
67 Ga0265326_10001220 3300028558 Bacteria 9196
68 Ga0265319_1000065 3300028563 Bacteria 85273
69 Ga0265319_1032747 3300028563 Bacteria 1799
70 Ga0265318_10002902 3300028577 Bacteria 8913
71 Ga0265318_10002949 3300028577 Bacteria 8823
72 Ga0265322_10006887 3300028654 Unclassified 3330
73 Ga0265322_10043015 3300028654 Bacteria 1286
74 Ga0265336_10000001 3300028666 Bacteria 916179
75 Ga0265338_10000004 3300028800 Bacteria 644793
76 Ga0265338_10061189 3300028800 Bacteria 3301
77 Ga0265324_10006168 3300029957 Bacteria 5051
78 Ga0265320_10050996 3300031240 Bacteria 2009
79 Ga0265340_10000002 3300031247 Bacteria 711693
80 Ga0265339_10304363 3300031249 Bacteria 759
81 Ga0265316_10018029 3300031344 Bacteria 6081
82 Ga0265313_10075528 3300031595 Bacteria 1542
83 Ga0265342_10166040 3300031712 Bacteria 1217
84 Ga0307416_102792902 3300032002 Bacteria 584
85 Ga0373946_0276471 3300035171 Bacteria 825
86 Ga0373937_2027140 3300036401 Bacteria 521
87 Ga0395899_0009929 3300037312 Bacteria 7300
88 Ga0395900_0111794 3300037418 Bacteria 2805
89 Ga0395898_0008519 3300037466 Bacteria 10836
90 Ga0395905_0100329 3300037471 Bacteria 2718
91 Ga0436364_0009793 3300037853 Bacteria 739
92 Ga0436364_0814519 3300037853 Bacteria 568
93 Ga0436364_1424815 3300037853 Bacteria 2230
94 Ga0395901_0011570 3300038443 Bacteria 8941
95 Ga0436365_0016017 3300039437 Bacteria 1754
96 Ga0436365_1579076 3300039437 Bacteria 2666
97 Ga0436365_1605782 3300039437 Bacteria 1218
98 Ga0436363_0241122 3300039450 Bacteria 1032
99 Ga0436363_0570320 3300039450 Bacteria 627
100 Ga0466969_0224345 3300044656 Bacteria 854
101 Ga0466965_0193643 3300044683 Bacteria 1076
102 Ga0466965_0349343 3300044683 Unclassified 810
103 Ga0466966_0020060 3300044684 Bacteria 4398
104 Ga0466966_0341421 3300044684 Bacteria 900
105 Ga0466961_0008909 3300044693 Bacteria 6401
106 Ga0466961_0029495 3300044693 Bacteria 3526
107 Ga0466963_0085843 3300044694 Bacteria 2137
108 Ga0466963_1203213 3300044694 Bacteria 532
109 Ga0466964_0119629 3300044706 Bacteria 1186
110 Ga0466971_0000736 3300044719 Bacteria 13117
111 Ga0466971_0051346 3300044719 Bacteria 1856
112 Ga0466968_0024446 3300044735 Bacteria 2468
113 Ga0466968_0289387 3300044735 Bacteria 786
114 Ga0466970_0333638 3300044765 Bacteria 859
115 Ga0466957_0009098 3300044842 Bacteria 5662
116 Ga0466957_0206958 3300044842 Bacteria 1291
117 Ga0466957_0531561 3300044842 Bacteria 818
118 Ga0466960_0006931 3300044901 Bacteria 4571
119 Ga0466959_0002472 3300045049 Bacteria 11831
120 Ga0466959_0069114 3300045049 Bacteria 2559
121 Ga0466959_0166868 3300045049 Bacteria 1546
122 Ga0466959_0259008 3300045049 Bacteria 1198
123 Ga0466959_0298660 3300045049 Bacteria 1103
124 Ga0466959_0338388 3300045049 Bacteria 1027
125 Ga0466959_0644060 3300045049 Bacteria 712
126 Ga0466958_0001867 3300045836 Bacteria 10290
127 Ga0466958_0033770 3300045836 Bacteria 3049
128 Ga0466958_0320014 3300045836 Bacteria 997
129 Ga0466967_0170608 3300045976 Bacteria 2047
130 Ga0466967_0991914 3300045976 Bacteria 836
131 Ga0495629_0682581 3300046459 Bacteria 683
132 Ga0495653_0000907 3300046463 Bacteria 22917
133 Ga0495664_0000036 3300046477 Bacteria 71543
134 Ga0495635_0655208 3300046663 Bacteria 683
135 Ga0495588_0087584 3300046674 Bacteria 1629
136 Ga0495646_0143863 3300046680 Bacteria 1331
137 Ga0495647_0088584 3300046681 Bacteria 1265
138 Ga0495658_0050219 3300046683 Bacteria 2359
139 Ga0495624_0647003 3300046690 Bacteria 629
140 Ga0495581_0692629 3300047315 Bacteria 588
141 Ga0495604_0000996 3300047317 Bacteria 23554
142 Ga0495674_0231528 3300047319 Bacteria 1525
143 Ga0495674_1246989 3300047319 Bacteria 560
144 Ga0495676_0062386 3300047321 Bacteria 2910
145 Ga0495684_0001810 3300047471 Bacteria 17176
146 Ga0496100_0630782 3300048903 Unclassified 834
147 Ga0496102_0297988 3300048905 Bacteria 1520
148 Ga0496103_0515644 3300048906 Bacteria 764
149 Ga0496103_0743750 3300048906 Bacteria 620
150 Ga0496105_0589963 3300048908 Bacteria 863
151 Ga0496107_1023664 3300048910 Bacteria 599
152 Ga0496110_1261072 3300048913 Bacteria 648
153 Ga0496112_0009084 3300048915 Bacteria 8930
154 Ga0496115_1237540 3300048918 Bacteria 559
155 Ga0501031_0030211 3300049568 Bacteria 3534
156 Ga0501033_1129345 3300049570 Bacteria 520
157 Ga0501036_0170743 3300049572 Bacteria 1832
158 Ga0501038_0169072 3300049574 Bacteria 1771
159 Ga0501039_0021624 3300049575 Bacteria 4935
160 Ga0501039_0245142 3300049575 Bacteria 1409
161 Ga0501040_0033535 3300049576 Bacteria 3478
162 Ga0501041_0036935 3300049577 Bacteria 2959
163 Ga0501042_0054544 3300049578 Bacteria 2851
164 Ga0501048_0014232 3300049582 Bacteria 5892
165 Ga0501068_0129336 3300049584 Bacteria 1578
166 Ga0501070_0455335 3300049586 Bacteria 1031
167 Ga0501071_0013896 3300049587 Bacteria 5497
168 Ga0501072_0005900 3300049588 Bacteria 9331
169 Ga0501072_0078364 3300049588 Bacteria 2616
170 Ga0501074_0059778 3300049590 Bacteria 2745
171 Ga0501075_0048182 3300049591 Bacteria 3202
172 Ga0501076_0004159 3300049592 Bacteria 10239
173 Ga0501077_0028114 3300049593 Bacteria 3573
174 Ga0501079_0210782 3300049741 Bacteria 1517
175 Ga0501080_0773321 3300049742 Bacteria 843
176 Ga0501081_0027343 3300049743 Bacteria 3848
177 Ga0501083_0275404 3300049744 Bacteria 1095
178 Ga0501035_0047089 3300049822 Bacteria 3873
179 Ga0501045_0006706 3300049824 Bacteria 7977
180 nmdc:mga05p37_1021488_c1 3300050507 Bacteria 876
181 nmdc:mga0qj67_11303_c1 3300050509 Bacteria 6687
182 nmdc:mga06r32_498194_c1 3300050510 Bacteria 1195
183 nmdc:mga08y16_64177_c1 3300050511 Bacteria 3835
184 nmdc:mga0n895_346471_c1 3300050512 Bacteria 1505
185 nmdc:mga0n895_657609_c1 3300050512 Bacteria 1046
186 nmdc:mga0rr50_34321_c1 3300050513 Bacteria 3632
187 nmdc:mga0a205_109833_c1 3300050515 Bacteria 2656
188 nmdc:mga0a205_1389133_c1 3300050515 Bacteria 550
189 Ga0495601_0004765 3300053077 Bacteria 7868
190 Ga0495601_0066889 3300053077 Bacteria 2288
191 Ga0495619_0932075 3300053085 Bacteria 583
192 Ga0501084_0191721 3300054114 Bacteria 1724
193 Ga0501082_0036548 3300060353 Bacteria 4231
194 Ga0466962_0010582 3300061719 Bacteria 4436
195 Ga0530510_0001964 3300061734 Bacteria 14078
196 Ga0105241_10328813
197 Ga0070658_10494699
198 Ga0070683_100034448
199 Ga0070666_10580861
200 Ga0070660_100007388
201 Ga0070660_100100594
202 Ga0070671_100302035
203 Ga0070714_100835275
204 Ga0070714_100840692
205 Ga0070714_101807583
206 Ga0070713_100427903
207 Ga0070711_100000326
208 Ga0070679_100214196
209 Ga0068856_100107913
210 Ga0068856_101371560
211 Ga0068870_10180456
212 Ga0081455_10666253
213 Ga0070715_10463395
214 Ga0070716_100369226
215 Ga0070712_100000005
216 Ga0070712_101491638
217 Ga0070712_101559102
218 Ga0075428_100064737
219 Ga0075430_100002607
220 Ga0075431_100735739
221 Ga0075434_100732208
222 Ga0075436_100233980
223 Ga0075435_100115738
224 Ga0075435_100972913
225 Ga0111539_10320235
226 Ga0105245_10769433
227 Ga0105245_10962777
228 Ga0105245_11538550
229 Ga0114129_10276244
230 Ga0105242_12250064
231 Ga0105237_10000431
232 Ga0105238_10302346
233 Ga0105239_10208918
234 Ga0105246_10014081
235 Ga0157374_10942759
236 Ga0157378_12471052
237 Ga0163162_10125381
238 Ga0157372_10220124
239 Ga0157380_10485305
240 Ga0163161_10295716
241 Ga0207699_10994140
242 Ga0207705_10187632
243 Ga0207654_10284200
244 Ga0207671_10012708
245 Ga0207693_10000023
246 Ga0207663_10000379
247 Ga0207657_10026415
248 Ga0207657_10106853
249 Ga0207649_10662277
250 Ga0207649_11239620
251 Ga0207687_10180416
252 Ga0207664_10701789
253 Ga0207665_10101858
254 Ga0207665_11521220
255 Ga0207661_10490400
256 Ga0207712_10907567
257 Ga0207678_10916845
258 Ga0207702_10082708
259 Ga0207702_11037256
260 Ga0207675_100258986
261 Ga0207428_10377989
262 Ga0265326_10001220
263 Ga0265319_1000065
264 Ga0265319_1032747
265 Ga0265318_10002902
266 Ga0265318_10002949
267 Ga0265322_10006887
268 Ga0265322_10043015
269 Ga0265336_10000001
270 Ga0265338_10000004
271 Ga0265338_10061189
272 Ga0265324_10006168
273 Ga0265320_10050996
274 Ga0265340_10000002
275 Ga0265339_10304363
276 Ga0265316_10018029
277 Ga0265313_10075528
278 Ga0265342_10166040
279 Ga0307416_102792902
280 Ga0373946_0276471
281 Ga0373937_2027140
282 Ga0395899_0009929
283 Ga0395900_0111794
284 Ga0395898_0008519
285 Ga0395905_0100329
286 Ga0436364_0009793
287 Ga0436364_0814519
288 Ga0436364_1424815
289 Ga0395901_0011570
290 Ga0436365_0016017
291 Ga0436365_1579076
292 Ga0436365_1605782
293 Ga0436363_0241122
294 Ga0436363_0570320
295 Ga0466969_0224345
296 Ga0466965_0193643
297 Ga0466965_0349343
298 Ga0466966_0020060
299 Ga0466966_0341421
300 Ga0466961_0008909
301 Ga0466961_0029495
302 Ga0466963_0085843
303 Ga0466963_1203213
304 Ga0466964_0119629
305 Ga0466971_0000736
306 Ga0466971_0051346
307 Ga0466968_0024446
308 Ga0466968_0289387
309 Ga0466970_0333638
310 Ga0466957_0009098
311 Ga0466957_0206958
312 Ga0466957_0531561
313 Ga0466960_0006931
314 Ga0466959_0002472
315 Ga0466959_0069114
316 Ga0466959_0166868
317 Ga0466959_0259008
318 Ga0466959_0298660
319 Ga0466959_0338388
320 Ga0466959_0644060
321 Ga0466958_0001867
322 Ga0466958_0033770
323 Ga0466958_0320014
324 Ga0466967_0170608
325 Ga0466967_0991914
326 Ga0495629_0682581
327 Ga0495653_0000907
328 Ga0495664_0000036
329 Ga0495635_0655208
330 Ga0495588_0087584
331 Ga0495646_0143863
332 Ga0495647_0088584
333 Ga0495658_0050219
334 Ga0495624_0647003
335 Ga0495581_0692629
336 Ga0495604_0000996
337 Ga0495674_0231528
338 Ga0495674_1246989
339 Ga0495676_0062386
340 Ga0495684_0001810
341 Ga0496100_0630782
342 Ga0496102_0297988
343 Ga0496103_0515644
344 Ga0496103_0743750
345 Ga0496105_0589963
346 Ga0496107_1023664
347 Ga0496110_1261072
348 Ga0496112_0009084
349 Ga0496115_1237540
350 Ga0501031_0030211
351 Ga0501033_1129345
352 Ga0501036_0170743
353 Ga0501038_0169072
354 Ga0501039_0021624
355 Ga0501039_0245142
356 Ga0501040_0033535
357 Ga0501041_0036935
358 Ga0501042_0054544
359 Ga0501048_0014232
360 Ga0501068_0129336
361 Ga0501070_0455335
362 Ga0501071_0013896
363 Ga0501072_0005900
364 Ga0501072_0078364
365 Ga0501074_0059778
366 Ga0501075_0048182
367 Ga0501076_0004159
368 Ga0501077_0028114
369 Ga0501079_0210782
370 Ga0501080_0773321
371 Ga0501081_0027343
372 Ga0501083_0275404
373 Ga0501035_0047089
374 Ga0501045_0006706
375 nmdc:mga05p37_1021488_c1
376 nmdc:mga0qj67_11303_c1
377 nmdc:mga06r32_498194_c1
378 nmdc:mga08y16_64177_c1
379 nmdc:mga0n895_346471_c1
380 nmdc:mga0n895_657609_c1
381 nmdc:mga0rr50_34321_c1
382 nmdc:mga0a205_109833_c1
383 nmdc:mga0a205_1389133_c1
384 Ga0495601_0004765
385 Ga0495601_0066889
386 Ga0495619_0932075
387 Ga0501084_0191721
388 Ga0501082_0036548
389 Ga0466962_0010582
390 Ga0530510_0001964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

132

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

143

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8569 5 124
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8555 5 125
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.8416 3 127
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.8401 3 127
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.8385 3 127
ID Description Score Start End Superfamily
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.867 9 124 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8555 5 125 3.10.180.10
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8405 9 125 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8352 5 125 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8345 3 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9682 27 125 GO:0004462
GO:0005737
GO:0019243
AF-A0A538I926-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.96 64 125 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9495 27 125 GO:0004462
GO:0005737
GO:0019243
AF-A0A7W0X9N2-F1-model_v4 VOC family protein 0.936 4 68 GO:0004462
GO:0046872
AF-A0A7V9VLW1-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9312 62 127 GO:0004462
GO:0005737
GO:0019243

Map