F300082

General Info

Members Datasets Scaffolds Average Seq Length
195 104 390 252

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10001993|Ga0157370_1000199323
Length 298
Sequence VSDVSSRHPEHEIGDANGAAARQPHAVLDLPSRRFKGLKIERLLDLASRPQPIRILEVGTGSGGIAHYFGTHPQLRCEVDAVDVHDNRLVTEGYRYHQVRDTTLPFADDSFDVVLTNHVIEHVGDAGAQHRHLLEIHRVMKPDGVGYLAVPNRWMLVEPHYRLAFLSWWPHAWRTSYLRAMRKGEVYDCEPLTHRQAESMLHITGFRFENKAVEALRLTLALEYPRGSVLRRTLGCIPDTLLHAASPMIPTLIYSFERHQTHAALPDGSGEQENGVFDVDRKRPADEPPEARQEHSGG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
102 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
103 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
104 2919404418 Luteibacter sp. 3190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0
Rhizoplane 0
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10001993 3300013104 Bacteria 25110
2 MBSR1b_contig_2222880 2162886012 Unclassified 2249
3 JGI25162J39368_1000539 3300002737 Bacteria 28147
4 JGI25164J39214_1000339 3300002772 Bacteria 29674
5 JGI25165J46597_1000535 3300003214 Bacteria 35299
6 rootH1_10168033 3300003316 Bacteria 2464
7 Ga0055539_1002061 3300003752 Bacteria 3286
8 Ga0055533_1000293 3300003756 Bacteria 25431
9 Ga0055535_1005693 3300003761 Bacteria 2672
10 Ga0055529_1005891 3300003763 Bacteria 1743
11 Ga0065715_10105512 3300005293 Unclassified 2888
12 Ga0065707_10244050 3300005295 Unclassified 1146
13 Ga0070658_10006836 3300005327 Bacteria 9222
14 Ga0070658_10042243 3300005327 Bacteria 3681
15 Ga0070683_100480384 3300005329 Unclassified 1186
16 Ga0070680_100003417 3300005336 Bacteria 11847
17 Ga0070680_100011601 3300005336 Bacteria 6826
18 Ga0070680_100012916 3300005336 Bacteria 6496
19 Ga0070682_100050017 3300005337 Bacteria 2608
20 Ga0070660_100083097 3300005339 Unclassified 2515
21 Ga0070691_10002516 3300005341 Bacteria 8159
22 Ga0070692_10010729 3300005345 Unclassified 4183
23 Ga0070659_100000880 3300005366 Bacteria 21954
24 Ga0070659_100001310 3300005366 Bacteria 18022
25 Ga0070659_100035517 3300005366 Bacteria 3881
26 Ga0070659_100387959 3300005366 Bacteria 1177
27 Ga0070714_100000020 3300005435 Bacteria 169262
28 Ga0070663_100071122 3300005455 Bacteria 2531
29 Ga0070663_100090673 3300005455 Bacteria 2264
30 Ga0070663_100092194 3300005455 Unclassified 2246
31 Ga0070663_100190394 3300005455 Bacteria 1596
32 Ga0070681_10004912 3300005458 Bacteria 12835
33 Ga0070681_10006787 3300005458 Bacteria 11141
34 Ga0070681_10013369 3300005458 Bacteria 8156
35 Ga0070681_10018713 3300005458 Bacteria 6930
36 Ga0070679_100004495 3300005530 Bacteria 12887
37 Ga0070679_100004506 3300005530 Bacteria 12866
38 Ga0070679_100011465 3300005530 Bacteria 8448
39 Ga0070679_100018090 3300005530 Bacteria 6830
40 Ga0070679_100022654 3300005530 Bacteria 6142
41 Ga0070679_100064680 3300005530 Unclassified 3645
42 Ga0070679_100083589 3300005530 Bacteria 3181
43 Ga0070684_100185695 3300005535 Bacteria 1891
44 Ga0068855_100007813 3300005563 Bacteria 12919
45 Ga0068855_100032136 3300005563 Bacteria 6266
46 Ga0068855_100040449 3300005563 Bacteria 5533
47 Ga0068855_100077754 3300005563 Unclassified 3850
48 Ga0068855_100111114 3300005563 Bacteria 3146
49 Ga0068857_100014003 3300005577 Bacteria 6978
50 Ga0068857_100024447 3300005577 Bacteria 5318
51 Ga0068857_100321757 3300005577 Unclassified 1428
52 Ga0068857_100558203 3300005577 Bacteria 1079
53 Ga0068854_100009569 3300005578 Bacteria 6256
54 Ga0068854_100016707 3300005578 Bacteria 4896
55 Ga0068856_100000496 3300005614 Bacteria 43611
56 Ga0068856_100232115 3300005614 Bacteria 1860
57 Ga0068856_100429467 3300005614 Unclassified 1341
58 Ga0068852_100047278 3300005616 Bacteria 3671
59 Ga0068859_100738809 3300005617 Bacteria 1073
60 Ga0097620_100738807 3300006931 Bacteria 1073
61 Ga0105240_10036840 3300009093 Bacteria 6288
62 Ga0105240_10096586 3300009093 Bacteria 3601
63 Ga0105240_10245501 3300009093 Bacteria 2074
64 Ga0105237_10077220 3300009545 Bacteria 3321
65 Ga0105237_10248046 3300009545 Unclassified 1782
66 Ga0105238_10272419 3300009551 Unclassified 1673
67 Ga0105238_10483190 3300009551 Bacteria 1238
68 Ga0105239_10004043 3300010375 Bacteria 17736
69 Ga0105239_10080071 3300010375 Bacteria 3594
70 Ga0105239_10491609 3300010375 Bacteria 1394
71 Ga0157373_10011350 3300013100 Bacteria 6552
72 Ga0157373_10033682 3300013100 Bacteria 3683
73 Ga0157371_10019021 3300013102 Bacteria 5070
74 Ga0157371_10092321 3300013102 Bacteria 2144
75 Ga0157370_10001680 3300013104 Bacteria 27267
76 Ga0157370_10017369 3300013104 Bacteria 7262
77 Ga0157370_10077916 3300013104 Bacteria 3121
78 Ga0157370_10181842 3300013104 Bacteria 1954
79 Ga0157369_10000001 3300013105 Bacteria 554908
80 Ga0157369_10028666 3300013105 Bacteria 6159
81 Ga0157369_10032491 3300013105 Bacteria 5739
82 Ga0157369_10153915 3300013105 Bacteria 2430
83 Ga0157372_10211043 3300013307 Bacteria 2250
84 Ga0157372_10291694 3300013307 Unclassified 1897
85 Ga0157372_10330635 3300013307 Unclassified 1775
86 Ga0182008_10001304 3300014497 Bacteria 17033
87 Ga0182008_10001315 3300014497 Bacteria 16973
88 Ga0182008_10009220 3300014497 Bacteria 5335
89 Ga0182008_10022321 3300014497 Bacteria 3242
90 Ga0182006_1007680 3300015261 Bacteria 4925
91 Ga0182007_10000810 3300015262 Bacteria 17445
92 Ga0182007_10001122 3300015262 Bacteria 14519
93 Ga0182007_10019098 3300015262 Bacteria 2470
94 Ga0182005_1000035 3300015265 Bacteria 172168
95 Ga0182005_1002690 3300015265 Bacteria 6239
96 Ga0209674_100354 3300025226 Bacteria 26166
97 Ga0207427_100157 3300025231 Bacteria 77115
98 Ga0209437_100254 3300025233 Bacteria 83422
99 Ga0209437_105956 3300025233 Bacteria 2050
100 Ga0209646_1000473 3300025246 Bacteria 20173
101 Ga0209026_1000628 3300025250 Bacteria 22181
102 Ga0209677_100379 3300025253 Bacteria 27214
103 Ga0209759_1000211 3300025256 Bacteria 90002
104 Ga0209233_1000252 3300025261 Bacteria 83708
105 Ga0209455_1000095 3300025272 Bacteria 217487
106 Ga0209051_1008398 3300025303 Bacteria 5470
107 Ga0207705_10006039 3300025909 Bacteria 9006
108 Ga0207705_10010513 3300025909 Bacteria 6730
109 Ga0207705_10032221 3300025909 Bacteria 3745
110 Ga0207705_10061418 3300025909 Bacteria 2715
111 Ga0207707_10007608 3300025912 Bacteria 9442
112 Ga0207707_10007673 3300025912 Bacteria 9398
113 Ga0207707_10012885 3300025912 Bacteria 7277
114 Ga0207707_10031787 3300025912 Bacteria 4620
115 Ga0207695_10007150 3300025913 Bacteria 14285
116 Ga0207695_10020170 3300025913 Bacteria 7643
117 Ga0207695_10023462 3300025913 Bacteria 6969
118 Ga0207695_10274934 3300025913 Bacteria 1579
119 Ga0207671_10004550 3300025914 Bacteria 13180
120 Ga0207671_10173030 3300025914 Unclassified 1677
121 Ga0207660_10002675 3300025917 Bacteria 11691
122 Ga0207660_10002728 3300025917 Bacteria 11565
123 Ga0207660_10007105 3300025917 Bacteria 7252
124 Ga0207657_10033934 3300025919 Bacteria 4595
125 Ga0207657_10080347 3300025919 Bacteria 2741
126 Ga0207649_10325268 3300025920 Unclassified 1131
127 Ga0207652_10003171 3300025921 Bacteria 13693
128 Ga0207652_10003941 3300025921 Bacteria 12138
129 Ga0207652_10006266 3300025921 Bacteria 9600
130 Ga0207652_10006522 3300025921 Bacteria 9408
131 Ga0207652_10011425 3300025921 Bacteria 7158
132 Ga0207652_10043822 3300025921 Unclassified 3811
133 Ga0207694_10365182 3300025924 Bacteria 1197
134 Ga0207694_10448047 3300025924 Unclassified 1077
135 Ga0207664_10000023 3300025929 Bacteria 204730
136 Ga0207690_10001854 3300025932 Bacteria 12992
137 Ga0207690_10002881 3300025932 Bacteria 10358
138 Ga0207690_10007687 3300025932 Bacteria 6397
139 Ga0207667_10009736 3300025949 Bacteria 11301
140 Ga0207667_10016524 3300025949 Bacteria 8336
141 Ga0207667_10028786 3300025949 Bacteria 6032
142 Ga0207667_10043021 3300025949 Bacteria 4795
143 Ga0207667_10111999 3300025949 Bacteria 2814
144 Ga0207667_10218133 3300025949 Bacteria 1955
145 Ga0207640_10003049 3300025981 Bacteria 9022
146 Ga0207640_10004218 3300025981 Bacteria 7775
147 Ga0207640_10010892 3300025981 Bacteria 5130
148 Ga0207678_10133952 3300026067 Bacteria 2114
149 Ga0207678_10222510 3300026067 Bacteria 1616
150 Ga0207702_10000138 3300026078 Bacteria 87882
151 Ga0207702_10009554 3300026078 Bacteria 8141
152 Ga0207702_10371636 3300026078 Unclassified 1373
153 Ga0207674_10022347 3300026116 Bacteria 6792
154 Ga0207674_10052983 3300026116 Bacteria 4136
155 Ga0207674_10348036 3300026116 Unclassified 1433
156 Ga0316579_10022524 3300031691 Bacteria 2818
157 Ga0307414_10452475 3300032004 Bacteria 1126
158 Ga0395899_0105191 3300037312 Unclassified 2033
159 Ga0395900_0000024 3300037418 Bacteria 323480
160 Ga0316581_0026994 3300037588 Bacteria 1716
161 Ga0395901_0001108 3300038443 Bacteria 28639
162 Ga0395901_0391490 3300038443 Bacteria 1429
163 Ga0466982_0000066 3300044672 Bacteria 28894
164 Ga0466966_0000369 3300044684 Bacteria 29348
165 Ga0466966_0019898 3300044684 Bacteria 4414
166 Ga0466961_0057407 3300044693 Unclassified 2478
167 Ga0466961_0251249 3300044693 Bacteria 1086
168 Ga0466971_0009066 3300044719 Bacteria 4348
169 Ga0466957_0235865 3300044842 Bacteria 1212
170 Ga0466959_0000375 3300045049 Bacteria 26445
171 Ga0466959_0017392 3300045049 Bacteria 5270
172 Ga0466959_0184029 3300045049 Bacteria 1460
173 Ga0495638_0000497 3300046460 Bacteria 46775
174 Ga0495606_0004291 3300046507 Bacteria 14367
175 Ga0495610_0001365 3300046512 Bacteria 21684
176 Ga0495620_0020914 3300046515 Bacteria 3186
177 Ga0495632_0000787 3300046519 Bacteria 28245
178 Ga0495609_0014548 3300046538 Bacteria 3696
179 Ga0495670_0003563 3300046691 Bacteria 7651
180 Ga0495671_0003900 3300046692 Bacteria 9057
181 Ga0495660_0000282 3300046810 Bacteria 47267
182 Ga0495636_0162939 3300047318 Bacteria 1005
183 Ga0496116_0099357 3300048919 Unclassified 1743
184 Ga0496121_0002657 3300048924 Bacteria 26807
185 Ga0495682_0000692 3300049460 Bacteria 22114
186 Ga0501033_0000774 3300049570 Bacteria 29408
187 Ga0501047_0044733 3300049581 Bacteria 4279
188 Ga0501080_0004974 3300049742 Bacteria 11836
189 Ga0501035_0006424 3300049822 Bacteria 11044
190 Ga0501044_0022452 3300049823 Bacteria 6724
191 Ga0501044_0053467 3300049823 Bacteria 4155
192 Ga0500641_0027895 3300053096 Unclassified 2201
193 Ga0466962_0224065 3300061719 Unclassified 921
194 2894417884 2894414249 Bacteria 4405451
195 2919404582 2919404418 Bacteria 4232372
196 Ga0157370_10001993
197 MBSR1b_contig_2222880
198 JGI25162J39368_1000539
199 JGI25164J39214_1000339
200 JGI25165J46597_1000535
201 rootH1_10168033
202 Ga0055539_1002061
203 Ga0055533_1000293
204 Ga0055535_1005693
205 Ga0055529_1005891
206 Ga0065715_10105512
207 Ga0065707_10244050
208 Ga0070658_10006836
209 Ga0070658_10042243
210 Ga0070683_100480384
211 Ga0070680_100003417
212 Ga0070680_100011601
213 Ga0070680_100012916
214 Ga0070682_100050017
215 Ga0070660_100083097
216 Ga0070691_10002516
217 Ga0070692_10010729
218 Ga0070659_100000880
219 Ga0070659_100001310
220 Ga0070659_100035517
221 Ga0070659_100387959
222 Ga0070714_100000020
223 Ga0070663_100071122
224 Ga0070663_100090673
225 Ga0070663_100092194
226 Ga0070663_100190394
227 Ga0070681_10004912
228 Ga0070681_10006787
229 Ga0070681_10013369
230 Ga0070681_10018713
231 Ga0070679_100004495
232 Ga0070679_100004506
233 Ga0070679_100011465
234 Ga0070679_100018090
235 Ga0070679_100022654
236 Ga0070679_100064680
237 Ga0070679_100083589
238 Ga0070684_100185695
239 Ga0068855_100007813
240 Ga0068855_100032136
241 Ga0068855_100040449
242 Ga0068855_100077754
243 Ga0068855_100111114
244 Ga0068857_100014003
245 Ga0068857_100024447
246 Ga0068857_100321757
247 Ga0068857_100558203
248 Ga0068854_100009569
249 Ga0068854_100016707
250 Ga0068856_100000496
251 Ga0068856_100232115
252 Ga0068856_100429467
253 Ga0068852_100047278
254 Ga0068859_100738809
255 Ga0097620_100738807
256 Ga0105240_10036840
257 Ga0105240_10096586
258 Ga0105240_10245501
259 Ga0105237_10077220
260 Ga0105237_10248046
261 Ga0105238_10272419
262 Ga0105238_10483190
263 Ga0105239_10004043
264 Ga0105239_10080071
265 Ga0105239_10491609
266 Ga0157373_10011350
267 Ga0157373_10033682
268 Ga0157371_10019021
269 Ga0157371_10092321
270 Ga0157370_10001680
271 Ga0157370_10017369
272 Ga0157370_10077916
273 Ga0157370_10181842
274 Ga0157369_10000001
275 Ga0157369_10028666
276 Ga0157369_10032491
277 Ga0157369_10153915
278 Ga0157372_10211043
279 Ga0157372_10291694
280 Ga0157372_10330635
281 Ga0182008_10001304
282 Ga0182008_10001315
283 Ga0182008_10009220
284 Ga0182008_10022321
285 Ga0182006_1007680
286 Ga0182007_10000810
287 Ga0182007_10001122
288 Ga0182007_10019098
289 Ga0182005_1000035
290 Ga0182005_1002690
291 Ga0209674_100354
292 Ga0207427_100157
293 Ga0209437_100254
294 Ga0209437_105956
295 Ga0209646_1000473
296 Ga0209026_1000628
297 Ga0209677_100379
298 Ga0209759_1000211
299 Ga0209233_1000252
300 Ga0209455_1000095
301 Ga0209051_1008398
302 Ga0207705_10006039
303 Ga0207705_10010513
304 Ga0207705_10032221
305 Ga0207705_10061418
306 Ga0207707_10007608
307 Ga0207707_10007673
308 Ga0207707_10012885
309 Ga0207707_10031787
310 Ga0207695_10007150
311 Ga0207695_10020170
312 Ga0207695_10023462
313 Ga0207695_10274934
314 Ga0207671_10004550
315 Ga0207671_10173030
316 Ga0207660_10002675
317 Ga0207660_10002728
318 Ga0207660_10007105
319 Ga0207657_10033934
320 Ga0207657_10080347
321 Ga0207649_10325268
322 Ga0207652_10003171
323 Ga0207652_10003941
324 Ga0207652_10006266
325 Ga0207652_10006522
326 Ga0207652_10011425
327 Ga0207652_10043822
328 Ga0207694_10365182
329 Ga0207694_10448047
330 Ga0207664_10000023
331 Ga0207690_10001854
332 Ga0207690_10002881
333 Ga0207690_10007687
334 Ga0207667_10009736
335 Ga0207667_10016524
336 Ga0207667_10028786
337 Ga0207667_10043021
338 Ga0207667_10111999
339 Ga0207667_10218133
340 Ga0207640_10003049
341 Ga0207640_10004218
342 Ga0207640_10010892
343 Ga0207678_10133952
344 Ga0207678_10222510
345 Ga0207702_10000138
346 Ga0207702_10009554
347 Ga0207702_10371636
348 Ga0207674_10022347
349 Ga0207674_10052983
350 Ga0207674_10348036
351 Ga0316579_10022524
352 Ga0307414_10452475
353 Ga0395899_0105191
354 Ga0395900_0000024
355 Ga0316581_0026994
356 Ga0395901_0001108
357 Ga0395901_0391490
358 Ga0466982_0000066
359 Ga0466966_0000369
360 Ga0466966_0019898
361 Ga0466961_0057407
362 Ga0466961_0251249
363 Ga0466971_0009066
364 Ga0466957_0235865
365 Ga0466959_0000375
366 Ga0466959_0017392
367 Ga0466959_0184029
368 Ga0495638_0000497
369 Ga0495606_0004291
370 Ga0495610_0001365
371 Ga0495620_0020914
372 Ga0495632_0000787
373 Ga0495609_0014548
374 Ga0495670_0003563
375 Ga0495671_0003900
376 Ga0495660_0000282
377 Ga0495636_0162939
378 Ga0496116_0099357
379 Ga0496121_0002657
380 Ga0495682_0000692
381 Ga0501033_0000774
382 Ga0501047_0044733
383 Ga0501080_0004974
384 Ga0501035_0006424
385 Ga0501044_0022452
386 Ga0501044_0053467
387 Ga0500641_0027895
388 Ga0466962_0224065
389 2894417884
390 2919404582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

56

148

0.87

PF13649

Methyltransf_25

Methyltransferase domain

55

144

0.87

PF08242

Methyltransf_12

Methyltransferase domain

56

145

0.85

PF13489

Methyltransf_23

Methyltransferase domain

32

209

0.81

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

32

172

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.7861 25 146
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.7765 31 146
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.7561 32 144
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.7548 30 252
7pd7-assembly1.cif.gz_A crocagin methyl transferase cgnl 0.7495 29 148
ID Description Score Start End Superfamily
af_A8MQH8_165_275_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.868 97 146 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8513 33 144 3.40.50.150
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8383 34 150 3.40.50.150
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8265 34 136 3.40.50.150
af_Q9LK30_263_406_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8197 50 143 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3M0F6G6-F1-model_v4 deleted 0.9788 27 251
AF-A0A7C9HLL1-F1-model_v4 Methyltransferase domain-containing protein 0.9774 37 252 GO:0008757
GO:0032259
AF-A0A7C9HLL1-F1-model_v4 Methyltransferase domain-containing protein 0.9686 37 252 GO:0008757
GO:0032259
AF-A0A3M0F6G6-F1-model_v4 deleted 0.9619 27 251
AF-A0A529FH21-F1-model_v4 Methyltransferase domain-containing protein 0.959 91 252 GO:0008168
GO:0032259

Map