F300421

General Info

Members Datasets Scaffolds Average Seq Length
195 138 390 332

Family's Representative Sequence

Representative Sequence 3300038705|Ga0237819_01728|Ga0237819_01728_627_1751
Length 374
Sequence MMTMPSAAAFFFMVWSIPRKTMAHPAPFDAAPQHGPRPLPLFLELLRSETAASPDRAAAAIRGLKAYQHARRADRGPPMPVAARIGRACLRDYGGSGRPAVFVPSLINPPFVLDLAPDNSLMRWVASQGIRPLLLDWGAPLPEESGMGIAGHVETLLLPLLDALGEDAALVGYCLGGTMAVAAASLHPVAGLALIAAPWHFSGFPQGARNDMTSLWEGAKPTCAALGYLPMEILQTAFWKLDPGRTVGKYERFGMLDPESAEARAFVALEDWANAGAPLTLEAGREAFEDLFGMDLPGNGRWHVGGKAIDPAGLSCPLLDVVSLSDRIVPAASSTGLAERLELSAGHVGMVVGSRAKAQLWQPLAAWLSHLHNH

Samples

Sample ID Description Type Environment
1 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
99 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 2.05
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0237819_01728 3300038705 Bacteria 5201
2 LJQas_1001893 3300000549 Bacteria 3028
3 JGI24739J22299_10037566 3300001989 Bacteria 1631
4 JGI24737J22298_10002157 3300001990 Bacteria 7020
5 JGI25165J46597_1000043 3300003214 Bacteria 264515
6 JGI25165J46597_1000445 3300003214 Bacteria 41632
7 Ga0065707_10146250 3300005295 Bacteria 1710
8 Ga0070676_10002939 3300005328 Bacteria 8793
9 Ga0070670_100006395 3300005331 Bacteria 9973
10 Ga0068869_100000096 3300005334 Bacteria 40808
11 Ga0070666_10000068 3300005335 Bacteria 76194
12 Ga0068868_100000149 3300005338 Bacteria 45719
13 Ga0070660_100111347 3300005339 Bacteria 2178
14 Ga0070669_100000018 3300005353 Bacteria 195789
15 Ga0070671_100000011 3300005355 Bacteria 202057
16 Ga0070674_100027647 3300005356 Bacteria 3718
17 Ga0070673_100000006 3300005364 Bacteria 184299
18 Ga0070659_100045028 3300005366 Bacteria 3456
19 Ga0070667_100000273 3300005367 Bacteria 58596
20 Ga0070705_100012154 3300005440 Bacteria 4368
21 Ga0068867_100000001 3300005459 Bacteria 427563
22 Ga0070665_100317532 3300005548 Bacteria 1562
23 Ga0068859_100000805 3300005617 Bacteria 31840
24 Ga0068859_100008172 3300005617 Bacteria 10616
25 Ga0068864_100000858 3300005618 Bacteria 25592
26 Ga0068864_100009279 3300005618 Bacteria 8114
27 Ga0068866_10025496 3300005718 Bacteria 2780
28 Ga0068861_100000046 3300005719 Bacteria 56414
29 Ga0068861_100001451 3300005719 Bacteria 14997
30 Ga0068863_100001370 3300005841 Bacteria 24218
31 Ga0068863_100003599 3300005841 Bacteria 15295
32 Ga0068858_100000439 3300005842 Bacteria 43456
33 Ga0068858_100012215 3300005842 Bacteria 8098
34 Ga0068860_100000269 3300005843 Bacteria 76230
35 Ga0068860_100003894 3300005843 Bacteria 15335
36 Ga0068862_100000877 3300005844 Bacteria 29301
37 Ga0068865_100000003 3300006881 Bacteria 231761
38 Ga0097620_100000805 3300006931 Bacteria 31840
39 Ga0097620_100008172 3300006931 Bacteria 10616
40 Ga0105251_10036551 3300009011 Bacteria 2416
41 Ga0105240_10014288 3300009093 Bacteria 10843
42 Ga0105240_10026739 3300009093 Bacteria 7568
43 Ga0105240_10062518 3300009093 Bacteria 4635
44 Ga0105245_10000113 3300009098 Bacteria 78545
45 Ga0105245_10001504 3300009098 Bacteria 21087
46 Ga0105247_10000758 3300009101 Bacteria 24920
47 Ga0105247_10005724 3300009101 Bacteria 7778
48 Ga0105243_10000373 3300009148 Bacteria 48115
49 Ga0105243_10091178 3300009148 Bacteria 2509
50 Ga0105242_10000448 3300009176 Bacteria 32719
51 Ga0105248_10027144 3300009177 Bacteria 6370
52 Ga0105248_10035610 3300009177 Bacteria 5569
53 Ga0105237_10024064 3300009545 Bacteria 6231
54 Ga0105238_10041202 3300009551 Bacteria 4678
55 Ga0105249_10000574 3300009553 Bacteria 33721
56 Ga0105249_10004128 3300009553 Bacteria 12544
57 Ga0105249_10413906 3300009553 Bacteria 1381
58 Ga0105239_10000694 3300010375 Bacteria 47928
59 Ga0105246_10002472 3300011119 Bacteria 11164
60 Ga0157373_10023039 3300013100 Bacteria 4516
61 Ga0157370_10000069 3300013104 Bacteria 112889
62 Ga0157369_10296755 3300013105 Bacteria 1682
63 Ga0157374_10001004 3300013296 Bacteria 24430
64 Ga0157378_10000902 3300013297 Bacteria 27366
65 Ga0163162_10004913 3300013306 Bacteria 12887
66 Ga0163162_10016649 3300013306 Bacteria 7186
67 Ga0163162_10210202 3300013306 Bacteria 2075
68 Ga0157372_10007993 3300013307 Bacteria 11249
69 Ga0157372_10850655 3300013307 Bacteria 1059
70 Ga0163163_10055016 3300014325 Bacteria 3933
71 Ga0163163_10104198 3300014325 Bacteria 2862
72 Ga0157379_10006792 3300014968 Bacteria 9891
73 Ga0157379_10035672 3300014968 Bacteria 4434
74 Ga0157376_10000089 3300014969 Bacteria 69351
75 Ga0209026_1001328 3300025250 Bacteria 11105
76 Ga0209148_1000996 3300025254 Bacteria 18233
77 Ga0209233_1000079 3300025261 Bacteria 346944
78 Ga0209233_1000313 3300025261 Bacteria 54941
79 Ga0207697_10003329 3300025315 Bacteria 7999
80 Ga0207697_10110020 3300025315 Bacteria 1179
81 Ga0207710_10006122 3300025900 Bacteria 5152
82 Ga0207680_10000341 3300025903 Bacteria 22237
83 Ga0207647_10000195 3300025904 Bacteria 49520
84 Ga0207647_10037703 3300025904 Bacteria 3063
85 Ga0207645_10008876 3300025907 Bacteria 6980
86 Ga0207705_10000802 3300025909 Bacteria 25817
87 Ga0207695_10001501 3300025913 Bacteria 38827
88 Ga0207695_10020680 3300025913 Bacteria 7531
89 Ga0207695_10067705 3300025913 Bacteria 3661
90 Ga0207671_10004851 3300025914 Bacteria 12657
91 Ga0207657_10082528 3300025919 Bacteria 2698
92 Ga0207681_10000008 3300025923 Bacteria 414329
93 Ga0207694_10036612 3300025924 Bacteria 3767
94 Ga0207687_10001599 3300025927 Bacteria 15593
95 Ga0207687_10004766 3300025927 Bacteria 9021
96 Ga0207644_10000006 3300025931 Bacteria 408793
97 Ga0207644_10016139 3300025931 Bacteria 5024
98 Ga0207706_10015334 3300025933 Bacteria 6925
99 Ga0207686_10000412 3300025934 Bacteria 29644
100 Ga0207709_10000173 3300025935 Bacteria 86350
101 Ga0207709_10085722 3300025935 Bacteria 2043
102 Ga0207669_10009473 3300025937 Bacteria 4642
103 Ga0207704_10000001 3300025938 Bacteria 716296
104 Ga0207711_10020390 3300025941 Bacteria 5527
105 Ga0207711_10217881 3300025941 Bacteria 1745
106 Ga0207689_10001595 3300025942 Bacteria 21464
107 Ga0207667_10002169 3300025949 Bacteria 24595
108 Ga0207651_10000002 3300025960 Bacteria 427663
109 Ga0207712_10000476 3300025961 Bacteria 33733
110 Ga0207668_10005394 3300025972 Bacteria 7527
111 Ga0207640_10055845 3300025981 Bacteria 2589
112 Ga0207658_10002605 3300025986 Bacteria 13093
113 Ga0207677_10000030 3300026023 Bacteria 120692
114 Ga0207703_10001250 3300026035 Bacteria 23825
115 Ga0207703_10002089 3300026035 Bacteria 17556
116 Ga0207641_10002987 3300026088 Bacteria 15303
117 Ga0207641_10004855 3300026088 Bacteria 11569
118 Ga0207648_10000001 3300026089 Bacteria 427499
119 Ga0207676_10000504 3300026095 Bacteria 32958
120 Ga0207676_10004372 3300026095 Bacteria 9991
121 Ga0207675_100000122 3300026118 Bacteria 63834
122 Ga0207675_100000822 3300026118 Bacteria 30908
123 Ga0268266_10025911 3300028379 Bacteria 4989
124 Ga0268266_10204139 3300028379 Bacteria 1810
125 Ga0268265_10000064 3300028380 Bacteria 144164
126 Ga0268265_10000424 3300028380 Bacteria 45348
127 Ga0268264_10000010 3300028381 Bacteria 596543
128 Ga0268264_10000184 3300028381 Bacteria 131402
129 Ga0268264_10001182 3300028381 Bacteria 25302
130 Ga0307513_10027618 3300031456 Bacteria 6511
131 Ga0307508_10002479 3300031616 Bacteria 19477
132 Ga0307410_10127635 3300031852 Bacteria 1864
133 Ga0307412_10009421 3300031911 Bacteria 5603
134 Ga0395899_0003766 3300037312 Bacteria 11972
135 Ga0395900_0067300 3300037418 Bacteria 3680
136 Ga0237816_02751 3300039145 Bacteria 1326
137 Ga0451804_0366730 3300041463 Bacteria 1384
138 Ga0451853_3730709 3300041512 Bacteria 2752
139 Ga0439448_0000793 3300042005 Bacteria 7679
140 Ga0466970_0163596 3300044765 Bacteria 1231
141 Ga0466957_0139760 3300044842 Bacteria 1559
142 Ga0466958_0363264 3300045836 Bacteria 933
143 Ga0495638_0001199 3300046460 Bacteria 24756
144 Ga0495638_0059356 3300046460 Bacteria 2369
145 Ga0495585_0040665 3300046492 Bacteria 2610
146 Ga0495583_0000656 3300046506 Bacteria 45452
147 Ga0495606_0009471 3300046507 Bacteria 8238
148 Ga0495666_0078927 3300046526 Bacteria 1559
149 Ga0495652_0205624 3300046529 Bacteria 1491
150 Ga0495625_0091539 3300046660 Bacteria 2102
151 Ga0495671_0101516 3300046692 Bacteria 1406
152 Ga0495686_0000201 3300047472 Bacteria 110982
153 Ga0495686_0000733 3300047472 Bacteria 43762
154 Ga0495686_0002106 3300047472 Bacteria 19503
155 Ga0495686_0002673 3300047472 Bacteria 16411
156 Ga0495686_0013666 3300047472 Bacteria 5626
157 Ga0495686_0146338 3300047472 Bacteria 1390
158 Ga0496102_0000100 3300048905 Bacteria 123531
159 Ga0496102_0296636 3300048905 Bacteria 1524
160 Ga0496103_0000070 3300048906 Bacteria 121077
161 Ga0496116_0002579 3300048919 Bacteria 18871
162 Ga0496117_0000194 3300048920 Bacteria 123531
163 Ga0496117_0025730 3300048920 Bacteria 4620
164 Ga0496118_0000146 3300048921 Bacteria 123531
165 Ga0496118_0006952 3300048921 Bacteria 12229
166 Ga0496118_0019582 3300048921 Bacteria 6042
167 Ga0496118_0040617 3300048921 Bacteria 3696
168 Ga0496119_0012504 3300048922 Bacteria 6887
169 Ga0496120_0053658 3300048923 Bacteria 2289
170 Ga0496121_0003464 3300048924 Bacteria 22491
171 Ga0496121_0008737 3300048924 Bacteria 11819
172 Ga0496121_0011319 3300048924 Bacteria 9928
173 Ga0496121_0028419 3300048924 Bacteria 5205
174 Ga0496122_0002977 3300048925 Bacteria 23060
175 Ga0496122_0029713 3300048925 Bacteria 4600
176 Ga0496123_0016942 3300048926 Bacteria 5886
177 Ga0496123_0028104 3300048926 Bacteria 4172
178 Ga0496124_0000185 3300048927 Bacteria 123531
179 Ga0496124_0014016 3300048927 Bacteria 7777
180 Ga0496125_0035237 3300048928 Bacteria 4396
181 Ga0496126_0015753 3300048929 Bacteria 7597
182 Ga0495682_0016616 3300049460 Bacteria 2785
183 Ga0501033_0098685 3300049570 Bacteria 2133
184 Ga0501257_000171 3300049686 Bacteria 13114
185 Ga0501044_0090826 3300049823 Bacteria 3081
186 Ga0501044_0111222 3300049823 Bacteria 2747
187 Ga0500643_001971 3300053087 Bacteria 11122
188 Ga0500643_008514 3300053087 Bacteria 4025
189 Ga0500555_001152 3300053103 Bacteria 8705
190 Ga0500562_019227 3300053108 Bacteria 1766
191 Ga0500592_000065 3300053116 Bacteria 28864
192 Ga0500559_0010564 3300053136 Bacteria 3961
193 Ga0500577_0027344 3300053142 Bacteria 1952
194 Ga0500616_0010224 3300053153 Bacteria 5627
195 Ga0500627_0000086 3300053158 Bacteria 31214
196 Ga0237819_01728
197 LJQas_1001893
198 JGI24739J22299_10037566
199 JGI24737J22298_10002157
200 JGI25165J46597_1000043
201 JGI25165J46597_1000445
202 Ga0065707_10146250
203 Ga0070676_10002939
204 Ga0070670_100006395
205 Ga0068869_100000096
206 Ga0070666_10000068
207 Ga0068868_100000149
208 Ga0070660_100111347
209 Ga0070669_100000018
210 Ga0070671_100000011
211 Ga0070674_100027647
212 Ga0070673_100000006
213 Ga0070659_100045028
214 Ga0070667_100000273
215 Ga0070705_100012154
216 Ga0068867_100000001
217 Ga0070665_100317532
218 Ga0068859_100000805
219 Ga0068859_100008172
220 Ga0068864_100000858
221 Ga0068864_100009279
222 Ga0068866_10025496
223 Ga0068861_100000046
224 Ga0068861_100001451
225 Ga0068863_100001370
226 Ga0068863_100003599
227 Ga0068858_100000439
228 Ga0068858_100012215
229 Ga0068860_100000269
230 Ga0068860_100003894
231 Ga0068862_100000877
232 Ga0068865_100000003
233 Ga0097620_100000805
234 Ga0097620_100008172
235 Ga0105251_10036551
236 Ga0105240_10014288
237 Ga0105240_10026739
238 Ga0105240_10062518
239 Ga0105245_10000113
240 Ga0105245_10001504
241 Ga0105247_10000758
242 Ga0105247_10005724
243 Ga0105243_10000373
244 Ga0105243_10091178
245 Ga0105242_10000448
246 Ga0105248_10027144
247 Ga0105248_10035610
248 Ga0105237_10024064
249 Ga0105238_10041202
250 Ga0105249_10000574
251 Ga0105249_10004128
252 Ga0105249_10413906
253 Ga0105239_10000694
254 Ga0105246_10002472
255 Ga0157373_10023039
256 Ga0157370_10000069
257 Ga0157369_10296755
258 Ga0157374_10001004
259 Ga0157378_10000902
260 Ga0163162_10004913
261 Ga0163162_10016649
262 Ga0163162_10210202
263 Ga0157372_10007993
264 Ga0157372_10850655
265 Ga0163163_10055016
266 Ga0163163_10104198
267 Ga0157379_10006792
268 Ga0157379_10035672
269 Ga0157376_10000089
270 Ga0209026_1001328
271 Ga0209148_1000996
272 Ga0209233_1000079
273 Ga0209233_1000313
274 Ga0207697_10003329
275 Ga0207697_10110020
276 Ga0207710_10006122
277 Ga0207680_10000341
278 Ga0207647_10000195
279 Ga0207647_10037703
280 Ga0207645_10008876
281 Ga0207705_10000802
282 Ga0207695_10001501
283 Ga0207695_10020680
284 Ga0207695_10067705
285 Ga0207671_10004851
286 Ga0207657_10082528
287 Ga0207681_10000008
288 Ga0207694_10036612
289 Ga0207687_10001599
290 Ga0207687_10004766
291 Ga0207644_10000006
292 Ga0207644_10016139
293 Ga0207706_10015334
294 Ga0207686_10000412
295 Ga0207709_10000173
296 Ga0207709_10085722
297 Ga0207669_10009473
298 Ga0207704_10000001
299 Ga0207711_10020390
300 Ga0207711_10217881
301 Ga0207689_10001595
302 Ga0207667_10002169
303 Ga0207651_10000002
304 Ga0207712_10000476
305 Ga0207668_10005394
306 Ga0207640_10055845
307 Ga0207658_10002605
308 Ga0207677_10000030
309 Ga0207703_10001250
310 Ga0207703_10002089
311 Ga0207641_10002987
312 Ga0207641_10004855
313 Ga0207648_10000001
314 Ga0207676_10000504
315 Ga0207676_10004372
316 Ga0207675_100000122
317 Ga0207675_100000822
318 Ga0268266_10025911
319 Ga0268266_10204139
320 Ga0268265_10000064
321 Ga0268265_10000424
322 Ga0268264_10000010
323 Ga0268264_10000184
324 Ga0268264_10001182
325 Ga0307513_10027618
326 Ga0307508_10002479
327 Ga0307410_10127635
328 Ga0307412_10009421
329 Ga0395899_0003766
330 Ga0395900_0067300
331 Ga0237816_02751
332 Ga0451804_0366730
333 Ga0451853_3730709
334 Ga0439448_0000793
335 Ga0466970_0163596
336 Ga0466957_0139760
337 Ga0466958_0363264
338 Ga0495638_0001199
339 Ga0495638_0059356
340 Ga0495585_0040665
341 Ga0495583_0000656
342 Ga0495606_0009471
343 Ga0495666_0078927
344 Ga0495652_0205624
345 Ga0495625_0091539
346 Ga0495671_0101516
347 Ga0495686_0000201
348 Ga0495686_0000733
349 Ga0495686_0002106
350 Ga0495686_0002673
351 Ga0495686_0013666
352 Ga0495686_0146338
353 Ga0496102_0000100
354 Ga0496102_0296636
355 Ga0496103_0000070
356 Ga0496116_0002579
357 Ga0496117_0000194
358 Ga0496117_0025730
359 Ga0496118_0000146
360 Ga0496118_0006952
361 Ga0496118_0019582
362 Ga0496118_0040617
363 Ga0496119_0012504
364 Ga0496120_0053658
365 Ga0496121_0003464
366 Ga0496121_0008737
367 Ga0496121_0011319
368 Ga0496121_0028419
369 Ga0496122_0002977
370 Ga0496122_0029713
371 Ga0496123_0016942
372 Ga0496123_0028104
373 Ga0496124_0000185
374 Ga0496124_0014016
375 Ga0496125_0035237
376 Ga0496126_0015753
377 Ga0495682_0016616
378 Ga0501033_0098685
379 Ga0501257_000171
380 Ga0501044_0090826
381 Ga0501044_0111222
382 Ga0500643_001971
383 Ga0500643_008514
384 Ga0500555_001152
385 Ga0500562_019227
386 Ga0500592_000065
387 Ga0500559_0010564
388 Ga0500577_0027344
389 Ga0500616_0010224
390 Ga0500627_0000086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k3c-assembly1.cif.gz_A crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. 0.7601 31 329
6k5e-assembly2.cif.gz_F crystal structure of bioh from klebsiella pneumonia 0.7461 48 331
5xav-assembly1.cif.gz_A structure of phac from chromobacterium sp. usm2 0.7455 31 334
6k5e-assembly2.cif.gz_F crystal structure of bioh from klebsiella pneumonia 0.7406 48 331
2qjw-assembly2.cif.gz_D crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.736 57 331
ID Description Score Start End Superfamily
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8463 48 329 3.40.50.1820
af_A0A1D6J508_11_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7903 56 157 3.40.50.1820
af_B7Z150_335_565_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7689 125 158 3.40.50.1820
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7667 48 329 3.40.50.1820
af_A0A1P8BAJ1_50_318_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7445 125 159 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A031JDW0-F1-model_v4 deleted 0.9909 52 329
AF-A0A4Q3AQ98-F1-model_v4 Alpha/beta fold hydrolase 0.9849 110 335
AF-A0A1G3K1Y6-F1-model_v4 Poly-beta-hydroxybutyrate polymerase 0.9825 18 329
AF-A0A5E7YHX3-F1-model_v4 Poly-beta-hydroxybutyrate polymerase (EC 2.3.1.-) 0.982 38 329 GO:0016746
AF-A0A1E3LSF4-F1-model_v4 Poly-beta-hydroxybutyrate polymerase 0.9806 2 335

Map