F300477

General Info

Members Datasets Scaffolds Average Seq Length
195 127 390 112

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0226136|Ga0453683_0226136_271_672
Length 133
Sequence LKKEDRSDKLYLEDLLTAMNRIAEYIEGYNFDQFKKDYKTVDAVVRNFEIIGEASKNISEIIKLQYPEIPWQEMYYLRNRVMHEYFGIDYDIIWDVAKNYLPENTNQIKKILKSHDEIWARRITRRKGTLRKP

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
126 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
127 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0
Rhizoplane 1.03
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0226136 3300044673 Bacteria 1190
2 JGI24741J21665_1070356 3300001915 Bacteria 519
3 JGI24740J21852_10001519 3300001979 Bacteria 10660
4 JGI24740J21852_10008163 3300001979 Bacteria 4196
5 JGI24743J22301_10069559 3300001991 Bacteria 733
6 JGI24744J21845_10004832 3300002077 Bacteria 2785
7 JGI25153J46596_10028750 3300003215 Bacteria 1922
8 rootH2_10292551 3300003320 Bacteria 1455
9 rootL2_10342399 3300003322 Bacteria 1313
10 rootH1_10366247 3300003323 Bacteria 1283
11 JGI25160J50197_1037974 3300003354 Unclassified 1146
12 Ga0065165_1024057 3300005262 Bacteria 2054
13 Ga0070658_10000280 3300005327 Bacteria 44712
14 Ga0070658_10166404 3300005327 Bacteria 1851
15 Ga0070658_10618427 3300005327 Bacteria 939
16 Ga0070676_10200622 3300005328 Bacteria 1307
17 Ga0070680_100110662 3300005336 Bacteria 2286
18 Ga0070682_100010522 3300005337 Bacteria 5250
19 Ga0070682_101355405 3300005337 Bacteria 606
20 Ga0068868_101629247 3300005338 Bacteria 607
21 Ga0070691_10016494 3300005341 Bacteria 3393
22 Ga0070661_100068150 3300005344 Bacteria 2615
23 Ga0070673_100003559 3300005364 Bacteria 9722
24 Ga0070673_100475913 3300005364 Bacteria 1127
25 Ga0070659_100000090 3300005366 Bacteria 67539
26 Ga0070659_100599869 3300005366 Bacteria 946
27 Ga0070663_100015993 3300005455 Bacteria 4858
28 Ga0070678_100003734 3300005456 Bacteria 8524
29 Ga0070678_101193206 3300005456 Unclassified 705
30 Ga0070681_10147131 3300005458 Bacteria 2284
31 Ga0068867_102340708 3300005459 Bacteria 508
32 Ga0074259_11707682 3300005507 Bacteria 510
33 Ga0070679_100156060 3300005530 Bacteria 2257
34 Ga0070684_100418677 3300005535 Bacteria 1236
35 Ga0068853_100005906 3300005539 Bacteria 9658
36 Ga0068853_100743548 3300005539 Bacteria 937
37 Ga0070672_100038123 3300005543 Bacteria 3671
38 Ga0070672_101674043 3300005543 Bacteria 571
39 Ga0070686_100134044 3300005544 Bacteria 1716
40 Ga0070693_100875073 3300005547 Bacteria 671
41 Ga0070665_100319738 3300005548 Bacteria 1556
42 Ga0068855_100188016 3300005563 Bacteria 2331
43 Ga0068855_101599576 3300005563 Bacteria 667
44 Ga0070664_100168066 3300005564 Bacteria 1944
45 Ga0068857_100018641 3300005577 Bacteria 6091
46 Ga0068857_101628227 3300005577 Unclassified 630
47 Ga0068854_100860967 3300005578 Bacteria 794
48 Ga0068854_101894672 3300005578 Unclassified 548
49 Ga0068856_100204512 3300005614 Bacteria 1989
50 Ga0068856_101366370 3300005614 Bacteria 723
51 Ga0068852_100001916 3300005616 Bacteria 14171
52 Ga0068852_100145065 3300005616 Bacteria 2201
53 Ga0068866_10032003 3300005718 Bacteria 2539
54 Ga0068860_100090010 3300005843 Bacteria 2922
55 Ga0068862_101867570 3300005844 Bacteria 610
56 Ga0068871_101984406 3300006358 Unclassified 554
57 Ga0068865_100000704 3300006881 Bacteria 18817
58 Ga0105240_10475243 3300009093 Bacteria 1394
59 Ga0105240_11160421 3300009093 Bacteria 819
60 Ga0105245_10381392 3300009098 Bacteria 1404
61 Ga0105241_10178744 3300009174 Bacteria 1758
62 Ga0105248_12084415 3300009177 Bacteria 645
63 Ga0105237_10000588 3300009545 Bacteria 50672
64 Ga0105237_10002980 3300009545 Bacteria 20473
65 Ga0105237_10014174 3300009545 Bacteria 8345
66 Ga0105237_10024307 3300009545 Bacteria 6200
67 Ga0105237_10231431 3300009545 Unclassified 1849
68 Ga0105239_10087430 3300010375 Bacteria 3436
69 Ga0105239_10790342 3300010375 Unclassified 1087
70 Ga0157373_10075227 3300013100 Unclassified 2383
71 Ga0157373_10838999 3300013100 Bacteria 679
72 Ga0157371_10000265 3300013102 Bacteria 71188
73 Ga0157370_10085302 3300013104 Bacteria 2967
74 Ga0157370_10268965 3300013104 Bacteria 1575
75 Ga0157370_10686834 3300013104 Bacteria 935
76 Ga0157370_10812685 3300013104 Unclassified 850
77 Ga0157374_10045008 3300013296 Bacteria 4083
78 Ga0157374_10206138 3300013296 Bacteria 1927
79 Ga0157374_10857389 3300013296 Bacteria 925
80 Ga0157378_10015953 3300013297 Bacteria 6579
81 Ga0157378_10765461 3300013297 Bacteria 989
82 Ga0157378_12220377 3300013297 Bacteria 600
83 Ga0157372_10000020 3300013307 Bacteria 208056
84 Ga0157372_10138437 3300013307 Bacteria 2804
85 Ga0157372_10710455 3300013307 Bacteria 1169
86 Ga0157372_10943692 3300013307 Bacteria 1000
87 Ga0157375_10000022 3300013308 Bacteria 239765
88 Ga0157375_11203938 3300013308 Bacteria 889
89 Ga0157380_10055747 3300014326 Unclassified 3140
90 Ga0157376_10343755 3300014969 Bacteria 1426
91 Ga0207425_1019002 3300025245 Bacteria 1486
92 Ga0209758_1043867 3300025297 Unclassified 1642
93 Ga0207426_1000261 3300025302 Bacteria 112697
94 Ga0207645_10000672 3300025907 Bacteria 28332
95 Ga0207705_10000094 3300025909 Bacteria 107005
96 Ga0207705_10303461 3300025909 Bacteria 1225
97 Ga0207705_11169153 3300025909 Bacteria 591
98 Ga0207654_10092298 3300025911 Bacteria 1848
99 Ga0207707_10130640 3300025912 Bacteria 2197
100 Ga0207695_10561391 3300025913 Bacteria 1023
101 Ga0207671_10002487 3300025914 Bacteria 19684
102 Ga0207671_10002958 3300025914 Bacteria 17482
103 Ga0207671_10007447 3300025914 Bacteria 9497
104 Ga0207671_10008715 3300025914 Bacteria 8556
105 Ga0207660_10053726 3300025917 Bacteria 2872
106 Ga0207649_10166515 3300025920 Bacteria 1531
107 Ga0207652_10131105 3300025921 Bacteria 2236
108 Ga0207687_10104589 3300025927 Bacteria 2090
109 Ga0207644_10589816 3300025931 Unclassified 922
110 Ga0207690_10000235 3300025932 Bacteria 40691
111 Ga0207690_10923235 3300025932 Bacteria 724
112 Ga0207686_10154569 3300025934 Bacteria 1601
113 Ga0207704_10000042 3300025938 Bacteria 89683
114 Ga0207691_11416728 3300025940 Bacteria 570
115 Ga0207689_10002524 3300025942 Bacteria 17006
116 Ga0207661_10657277 3300025944 Bacteria 963
117 Ga0207679_10712162 3300025945 Bacteria 911
118 Ga0207667_10151828 3300025949 Bacteria 2384
119 Ga0207639_10081485 3300026041 Unclassified 2563
120 Ga0207639_10355229 3300026041 Bacteria 1310
121 Ga0207639_11380094 3300026041 Bacteria 661
122 Ga0207639_11577551 3300026041 Bacteria 616
123 Ga0207678_10025829 3300026067 Bacteria 5125
124 Ga0207702_10164230 3300026078 Bacteria 2030
125 Ga0207702_11096908 3300026078 Bacteria 790
126 Ga0207674_10030499 3300026116 Bacteria 5667
127 Ga0207674_10079918 3300026116 Bacteria 3273
128 Ga0207683_10003832 3300026121 Bacteria 13030
129 Ga0207698_10034661 3300026142 Bacteria 3682
130 Ga0207698_10079668 3300026142 Bacteria 2635
131 Ga0268266_10980790 3300028379 Bacteria 818
132 Ga0268265_12295357 3300028380 Bacteria 546
133 Ga0268264_10090847 3300028381 Bacteria 2633
134 Ga0265327_10423414 3300031251 Bacteria 577
135 Ga0265316_10115766 3300031344 Bacteria 2027
136 Ga0265316_10138374 3300031344 Bacteria 1831
137 Ga0265316_11082302 3300031344 Bacteria 556
138 Ga0307509_10162053 3300031507 Bacteria 2132
139 Ga0316576_10911197 3300031727 Bacteria 629
140 Ga0307409_100015747 3300031995 Unclassified 4976
141 Ga0307416_101395222 3300032002 Unclassified 806
142 Ga0316583_10044697 3300032133 Bacteria 1565
143 Ga0307510_10034601 3300033180 Bacteria 5655
144 Ga0373938_0249301 3300034957 Unclassified 507
145 Ga0395899_0000136 3300037312 Bacteria 112112
146 Ga0451802_0851665 3300041460 Unclassified 544
147 Ga0451839_0829260 3300041496 Bacteria 2792
148 Ga0451577_0000010 3300042876 Bacteria 616686
149 Ga0451577_0000379 3300042876 Bacteria 82741
150 Ga0451577_0267252 3300042876 Bacteria 1549
151 Ga0451577_0267509 3300042876 Bacteria 1548
152 Ga0451577_1662095 3300042876 Bacteria 562
153 Ga0453683_0000195 3300044673 Bacteria 82741
154 Ga0453683_0001512 3300044673 Bacteria 19846
155 Ga0453683_0039489 3300044673 Bacteria 2966
156 Ga0453684_0000213 3300044712 Bacteria 253663
157 Ga0453684_0001147 3300044712 Bacteria 82741
158 Ga0453684_0009182 3300044712 Bacteria 17385
159 Ga0453684_0011156 3300044712 Bacteria 15147
160 Ga0453684_0182457 3300044712 Bacteria 2463
161 Ga0453684_0413483 3300044712 Bacteria 1508
162 Ga0453684_0577237 3300044712 Bacteria 1235
163 Ga0453684_0624825 3300044712 Bacteria 1178
164 Ga0453684_0669409 3300044712 Bacteria 1131
165 Ga0453684_0843509 3300044712 Bacteria 985
166 Ga0466959_0275265 3300045049 Bacteria 1156
167 Ga0466959_0487101 3300045049 Bacteria 834
168 Ga0451576_0000528 3300045051 Bacteria 82741
169 Ga0451576_0011702 3300045051 Bacteria 9941
170 Ga0451576_0013412 3300045051 Bacteria 9168
171 Ga0451576_0058211 3300045051 Bacteria 4039
172 Ga0451576_0297585 3300045051 Bacteria 1687
173 Ga0451576_0378453 3300045051 Bacteria 1484
174 Ga0495606_0016541 3300046507 Bacteria 5616
175 Ga0495631_0006455 3300046518 Bacteria 6052
176 Ga0495622_0164384 3300046557 Unclassified 1000
177 Ga0495668_0152013 3300046616 Bacteria 1268
178 Ga0495611_0000088 3300046648 Bacteria 64558
179 Ga0495661_0195504 3300046665 Bacteria 1062
180 Ga0495683_0021249 3300047323 Bacteria 3346
181 Ga0495686_0001755 3300047472 Bacteria 22226
182 Ga0496115_0002288 3300048918 Bacteria 13717
183 Ga0501033_0045170 3300049570 Bacteria 3279
184 Ga0501034_0100771 3300049571 Bacteria 2882
185 Ga0501043_0266490 3300049579 Unclassified 1316
186 Ga0501070_0238592 3300049586 Bacteria 1488
187 Ga0501073_0033415 3300049589 Bacteria 3663
188 Ga0501080_0265661 3300049742 Bacteria 1562
189 Ga0501083_0030624 3300049744 Bacteria 3695
190 Ga0501044_0014915 3300049823 Bacteria 8378
191 Ga0500646_0045883 3300053090 Unclassified 1245
192 Ga0500650_0066051 3300053098 Bacteria 1690
193 Ga0500588_0088267 3300053146 Bacteria 1050
194 Ga0500634_0028306 3300053161 Bacteria 3053
195 8003151283 8003151029 Bacteria 8187759
196 Ga0453683_0226136
197 JGI24741J21665_1070356
198 JGI24740J21852_10001519
199 JGI24740J21852_10008163
200 JGI24743J22301_10069559
201 JGI24744J21845_10004832
202 JGI25153J46596_10028750
203 rootH2_10292551
204 rootL2_10342399
205 rootH1_10366247
206 JGI25160J50197_1037974
207 Ga0065165_1024057
208 Ga0070658_10000280
209 Ga0070658_10166404
210 Ga0070658_10618427
211 Ga0070676_10200622
212 Ga0070680_100110662
213 Ga0070682_100010522
214 Ga0070682_101355405
215 Ga0068868_101629247
216 Ga0070691_10016494
217 Ga0070661_100068150
218 Ga0070673_100003559
219 Ga0070673_100475913
220 Ga0070659_100000090
221 Ga0070659_100599869
222 Ga0070663_100015993
223 Ga0070678_100003734
224 Ga0070678_101193206
225 Ga0070681_10147131
226 Ga0068867_102340708
227 Ga0074259_11707682
228 Ga0070679_100156060
229 Ga0070684_100418677
230 Ga0068853_100005906
231 Ga0068853_100743548
232 Ga0070672_100038123
233 Ga0070672_101674043
234 Ga0070686_100134044
235 Ga0070693_100875073
236 Ga0070665_100319738
237 Ga0068855_100188016
238 Ga0068855_101599576
239 Ga0070664_100168066
240 Ga0068857_100018641
241 Ga0068857_101628227
242 Ga0068854_100860967
243 Ga0068854_101894672
244 Ga0068856_100204512
245 Ga0068856_101366370
246 Ga0068852_100001916
247 Ga0068852_100145065
248 Ga0068866_10032003
249 Ga0068860_100090010
250 Ga0068862_101867570
251 Ga0068871_101984406
252 Ga0068865_100000704
253 Ga0105240_10475243
254 Ga0105240_11160421
255 Ga0105245_10381392
256 Ga0105241_10178744
257 Ga0105248_12084415
258 Ga0105237_10000588
259 Ga0105237_10002980
260 Ga0105237_10014174
261 Ga0105237_10024307
262 Ga0105237_10231431
263 Ga0105239_10087430
264 Ga0105239_10790342
265 Ga0157373_10075227
266 Ga0157373_10838999
267 Ga0157371_10000265
268 Ga0157370_10085302
269 Ga0157370_10268965
270 Ga0157370_10686834
271 Ga0157370_10812685
272 Ga0157374_10045008
273 Ga0157374_10206138
274 Ga0157374_10857389
275 Ga0157378_10015953
276 Ga0157378_10765461
277 Ga0157378_12220377
278 Ga0157372_10000020
279 Ga0157372_10138437
280 Ga0157372_10710455
281 Ga0157372_10943692
282 Ga0157375_10000022
283 Ga0157375_11203938
284 Ga0157380_10055747
285 Ga0157376_10343755
286 Ga0207425_1019002
287 Ga0209758_1043867
288 Ga0207426_1000261
289 Ga0207645_10000672
290 Ga0207705_10000094
291 Ga0207705_10303461
292 Ga0207705_11169153
293 Ga0207654_10092298
294 Ga0207707_10130640
295 Ga0207695_10561391
296 Ga0207671_10002487
297 Ga0207671_10002958
298 Ga0207671_10007447
299 Ga0207671_10008715
300 Ga0207660_10053726
301 Ga0207649_10166515
302 Ga0207652_10131105
303 Ga0207687_10104589
304 Ga0207644_10589816
305 Ga0207690_10000235
306 Ga0207690_10923235
307 Ga0207686_10154569
308 Ga0207704_10000042
309 Ga0207691_11416728
310 Ga0207689_10002524
311 Ga0207661_10657277
312 Ga0207679_10712162
313 Ga0207667_10151828
314 Ga0207639_10081485
315 Ga0207639_10355229
316 Ga0207639_11380094
317 Ga0207639_11577551
318 Ga0207678_10025829
319 Ga0207702_10164230
320 Ga0207702_11096908
321 Ga0207674_10030499
322 Ga0207674_10079918
323 Ga0207683_10003832
324 Ga0207698_10034661
325 Ga0207698_10079668
326 Ga0268266_10980790
327 Ga0268265_12295357
328 Ga0268264_10090847
329 Ga0265327_10423414
330 Ga0265316_10115766
331 Ga0265316_10138374
332 Ga0265316_11082302
333 Ga0307509_10162053
334 Ga0316576_10911197
335 Ga0307409_100015747
336 Ga0307416_101395222
337 Ga0316583_10044697
338 Ga0307510_10034601
339 Ga0373938_0249301
340 Ga0395899_0000136
341 Ga0451802_0851665
342 Ga0451839_0829260
343 Ga0451577_0000010
344 Ga0451577_0000379
345 Ga0451577_0267252
346 Ga0451577_0267509
347 Ga0451577_1662095
348 Ga0453683_0000195
349 Ga0453683_0001512
350 Ga0453683_0039489
351 Ga0453684_0000213
352 Ga0453684_0001147
353 Ga0453684_0009182
354 Ga0453684_0011156
355 Ga0453684_0182457
356 Ga0453684_0413483
357 Ga0453684_0577237
358 Ga0453684_0624825
359 Ga0453684_0669409
360 Ga0453684_0843509
361 Ga0466959_0275265
362 Ga0466959_0487101
363 Ga0451576_0000528
364 Ga0451576_0011702
365 Ga0451576_0013412
366 Ga0451576_0058211
367 Ga0451576_0297585
368 Ga0451576_0378453
369 Ga0495606_0016541
370 Ga0495631_0006455
371 Ga0495622_0164384
372 Ga0495668_0152013
373 Ga0495611_0000088
374 Ga0495661_0195504
375 Ga0495683_0021249
376 Ga0495686_0001755
377 Ga0496115_0002288
378 Ga0501033_0045170
379 Ga0501034_0100771
380 Ga0501043_0266490
381 Ga0501070_0238592
382 Ga0501073_0033415
383 Ga0501080_0265661
384 Ga0501083_0030624
385 Ga0501044_0014915
386 Ga0500646_0045883
387 Ga0500650_0066051
388 Ga0500588_0088267
389 Ga0500634_0028306
390 8003151283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01934

HepT-like

Ribonuclease HepT-like

15

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ae9-assembly1.cif.gz_B crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.8947 1 53
6m6u-assembly1.cif.gz_I crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.8492 3 65
6m6u-assembly1.cif.gz_D crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.7331 3 83
7ae6-assembly1.cif.gz_B crystal structure of di-ampylated hepn(r102a) toxin 0.7051 1 83
7ae9-assembly2.cif.gz_D crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.6952 1 83
ID Description Score Start End Superfamily
af_Q58775_1_109_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8826 1 88 1.20.120.330
af_Q58613_1_121_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8777 1 86 1.20.120.330
af_P34231_464_656_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8257 4 53 2.30.29.30
af_Q58775_1_109_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8201 1 88 1.20.120.330
af_Q58613_1_121_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8004 1 86 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2H0WYI3-F1-model_v4 DUF86 domain-containing protein 0.9888 6 83 GO:0004540
GO:0110001
AF-A0A3R7W9C0-F1-model_v4 DUF4255 domain-containing protein 0.9809 1 79 GO:0004540
GO:0110001
AF-A0A0U2US01-F1-model_v4 DUF86 domain-containing protein 0.9803 4 77 GO:0004540
GO:0110001
AF-A0A352T2E9-F1-model_v4 DUF86 domain-containing protein 0.9797 6 74 GO:0004540
GO:0110001
AF-A0A7C5ZEL2-F1-model_v4 DUF86 domain-containing protein 0.9793 5 81 GO:0004540
GO:0110001

Map