F300760

General Info

Members Datasets Scaffolds Average Seq Length
195 156 157 299

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000006|Ga0500635_0000006_148394_149314
Length 306
Sequence MSAADVIRSAPSLDDDAFSRLRGLRYTEPGAIGAALASRERRPLVRGDGRLFIVAADHPARGSLAVRDNATAMADRYDLLQRLALALSRPGVDGVLGTPDIIDDLALLGALDDKIAVGSMNRGGLRGSVFEMDDRYTGYDVESMVHNRLDAAKLLVRVNLEDAATVRTLEKTADAVTAAARAGLPIMLEPFLSRWSDDGRIVNDLSPDAVISSIAIASGLGASSAYTWLKLPVVDEMERVMAATTLPTLLLGGDSDKSPDDTYASWEAALALPGVRGLVVGRTLLYPQNEDVAQAVDTAAALVHGR

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
4 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
5 2773857759 Microbacterium sp. 1294 Isolate Unclassified
6 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
7 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
8 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
9 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
10 2858868258 Micromonospora sp. MH33 Isolate Unclassified
11 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
12 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
13 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
14 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
15 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
16 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
17 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
18 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
19 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
20 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
21 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
22 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
23 2919395869 Microbacterium resistens 2980 Isolate Unclassified
24 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
25 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
26 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
27 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
28 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
29 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
30 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
31 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
32 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
33 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
86 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
87 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
154 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
155 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
156 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.97
Metatranscriptomes 1.54
Isolates 19.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 6.15
Nodule 0.51
Rhizoplane 8.72
Rhizosphere 63.59
Stem 0
Stem Tuber 0.51
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10285771 3300003323 Bacteria 1700
2 Ga0055527_1000003 3300003760 Bacteria 705001
3 Ga0055542_1000005 3300003762 Bacteria 550280
4 Ga0055529_1000046 3300003763 Bacteria 209430
5 Ga0070658_10029311 3300005327 Bacteria 4421
6 Ga0070658_10442816 3300005327 Bacteria 1119
7 Ga0070683_100043884 3300005329 Bacteria 4121
8 Ga0070680_100032284 3300005336 Bacteria 4214
9 Ga0070714_100000708 3300005435 Bacteria 23584
10 Ga0070714_100048621 3300005435 Bacteria 3608
11 Ga0070713_100024532 3300005436 Bacteria 4699
12 Ga0070710_10005910 3300005437 Bacteria 5846
13 Ga0070711_100045175 3300005439 Bacteria 2994
14 Ga0070681_10027284 3300005458 Bacteria 5741
15 Ga0070706_100049999 3300005467 Bacteria 3857
16 Ga0070684_100299496 3300005535 Bacteria 1475
17 Ga0068856_100361449 3300005614 Bacteria 1470
18 Ga0075364_10203287 3300006051 Bacteria 1343
19 Ga0068871_100223350 3300006358 Bacteria 1633
20 Ga0068865_100412782 3300006881 Bacteria 1108
21 Ga0075435_100065893 3300007076 Bacteria 2945
22 Ga0105241_10041598 3300009174 Bacteria 3473
23 Ga0105239_10000214 3300010375 Bacteria 85558
24 Ga0157370_10017095 3300013104 Bacteria 7327
25 Ga0157370_10045959 3300013104 Bacteria 4187
26 Ga0157369_10042431 3300013105 Bacteria 4962
27 Ga0157369_10096389 3300013105 Bacteria 3156
28 Ga0157369_10098873 3300013105 Bacteria 3111
29 Ga0157369_10209849 3300013105 Bacteria 2041
30 Ga0157376_10058695 3300014969 Bacteria 3224
31 Ga0206354_11606290 3300020081 Bacteria 2354
32 Ga0206353_11342046 3300020082 Bacteria 3630
33 Ga0206353_11960773 3300020082 Bacteria 4738
34 Ga0209672_100003 3300025228 Bacteria 1560476
35 Ga0209147_100475 3300025229 Bacteria 24547
36 Ga0209677_100568 3300025253 Bacteria 20426
37 Ga0209148_1000004 3300025254 Bacteria 1844481
38 Ga0209455_1000080 3300025272 Bacteria 266151
39 Ga0207647_10012051 3300025904 Bacteria 6035
40 Ga0207699_10070148 3300025906 Bacteria 2139
41 Ga0207699_10112742 3300025906 Bacteria 1746
42 Ga0207705_10045023 3300025909 Bacteria 3172
43 Ga0207705_10265649 3300025909 Bacteria 1311
44 Ga0207684_10057709 3300025910 Bacteria 3294
45 Ga0207654_10146953 3300025911 Bacteria 1509
46 Ga0207707_10020673 3300025912 Bacteria 5748
47 Ga0207671_10220934 3300025914 Bacteria 1484
48 Ga0207693_10164484 3300025915 Bacteria 1746
49 Ga0207657_10036933 3300025919 Bacteria 4369
50 Ga0207652_10081788 3300025921 Bacteria 2825
51 Ga0207700_10056963 3300025928 Bacteria 2945
52 Ga0207700_10065026 3300025928 Bacteria 2781
53 Ga0207664_10000338 3300025929 Bacteria 34478
54 Ga0207665_10064410 3300025939 Bacteria 2491
55 Ga0207702_10079524 3300026078 Bacteria 2842
56 Ga0207702_10265184 3300026078 Bacteria 1618
57 Ga0207674_10166915 3300026116 Bacteria 2155
58 Ga0268264_10325611 3300028381 Bacteria 1455
59 Ga0307509_10114198 3300031507 Bacteria 2696
60 Ga0307508_10000771 3300031616 Bacteria 37891
61 Ga0307406_10000222 3300031901 Bacteria 34546
62 Ga0307406_10042528 3300031901 Bacteria 2837
63 Ga0307406_10103084 3300031901 Bacteria 1948
64 Ga0307507_10000033 3300033179 Bacteria 193728
65 Ga0373948_0000204 3300034817 Bacteria 6830
66 Ga0373958_0008417 3300034819 Bacteria 1670
67 Ga0373928_0012952 3300035084 Bacteria 1670
68 Ga0373940_0009011 3300035088 Bacteria 2307
69 Ga0373957_0072680 3300035120 Bacteria 1347
70 Ga0373935_0031499 3300035692 Bacteria 3292
71 Ga0395899_0003949 3300037312 Bacteria 11684
72 Ga0395899_0029461 3300037312 Bacteria 4128
73 Ga0395900_0002476 3300037418 Bacteria 20305
74 Ga0395900_0311509 3300037418 Bacteria 1557
75 Ga0395898_0000647 3300037466 Bacteria 63277
76 Ga0466965_0003094 3300044683 Bacteria 7251
77 Ga0466971_0006456 3300044719 Bacteria 5094
78 Ga0466968_0008966 3300044735 Bacteria 3843
79 Ga0466970_0053608 3300044765 Bacteria 2154
80 Ga0466957_0175535 3300044842 Bacteria 1397
81 Ga0466960_0002948 3300044901 Bacteria 6482
82 Ga0466959_0141834 3300045049 Bacteria 1697
83 Ga0495651_0005034 3300046462 Bacteria 10094
84 Ga0495653_0152882 3300046463 Bacteria 1610
85 Ga0495650_0000873 3300046471 Bacteria 35836
86 Ga0495664_0023578 3300046477 Bacteria 3572
87 Ga0495608_0024408 3300046511 Bacteria 4135
88 Ga0495618_0082139 3300046514 Bacteria 2058
89 Ga0495630_0126248 3300046517 Bacteria 1942
90 Ga0495652_0007003 3300046529 Bacteria 10419
91 Ga0495652_0028992 3300046529 Bacteria 4862
92 Ga0495609_0071615 3300046538 Bacteria 1523
93 Ga0495645_0069649 3300046543 Bacteria 2539
94 Ga0495657_0030387 3300046675 Bacteria 3784
95 Ga0495623_0018509 3300046679 Bacteria 4499
96 Ga0495646_0114567 3300046680 Bacteria 1532
97 Ga0495600_0049444 3300046809 Bacteria 2743
98 Ga0495602_0132040 3300048088 Bacteria 1990
99 Ga0496101_0143547 3300048904 Bacteria 1821
100 Ga0496102_0148249 3300048905 Bacteria 2203
101 Ga0496102_0426557 3300048905 Bacteria 1245
102 Ga0496103_0039678 3300048906 Bacteria 2893
103 Ga0496104_0032011 3300048907 Bacteria 4894
104 Ga0496104_0033080 3300048907 Bacteria 4813
105 Ga0496104_0175641 3300048907 Bacteria 2052
106 Ga0496105_0012351 3300048908 Bacteria 6761
107 Ga0496105_0048793 3300048908 Bacteria 3494
108 Ga0496106_0238376 3300048909 Bacteria 1453
109 Ga0496107_0464955 3300048910 Bacteria 939
110 Ga0496108_0015327 3300048911 Bacteria 6253
111 Ga0496110_0343128 3300048913 Bacteria 1360
112 Ga0496111_0199877 3300048914 Bacteria 1486
113 Ga0496114_0115335 3300048917 Bacteria 2305
114 Ga0496115_0013540 3300048918 Bacteria 6170
115 Ga0496115_0246528 3300048918 Bacteria 1471
116 Ga0496117_0000034 3300048920 Bacteria 328334
117 Ga0496117_0001986 3300048920 Bacteria 27157
118 Ga0496117_0008510 3300048920 Bacteria 9730
119 Ga0496118_0000360 3300048921 Bacteria 77010
120 Ga0496118_0019492 3300048921 Bacteria 6060
121 Ga0496118_0033274 3300048921 Bacteria 4231
122 Ga0496118_0116929 3300048921 Bacteria 1751
123 Ga0496119_0003061 3300048922 Bacteria 17686
124 Ga0496120_0015951 3300048923 Bacteria 4931
125 Ga0496120_0091479 3300048923 Bacteria 1624
126 Ga0496122_0000460 3300048925 Bacteria 84748
127 Ga0496122_0056303 3300048925 Bacteria 2932
128 Ga0496123_0001253 3300048926 Bacteria 36650
129 Ga0496123_0079845 3300048926 Bacteria 1997
130 Ga0496124_0000173 3300048927 Bacteria 129688
131 Ga0496124_0041096 3300048927 Bacteria 3994
132 Ga0496125_0006837 3300048928 Bacteria 12235
133 Ga0496126_0000526 3300048929 Bacteria 74672
134 Ga0496126_0011667 3300048929 Bacteria 9066
135 Ga0501034_0001600 3300049571 Bacteria 29443
136 Ga0501034_0095990 3300049571 Bacteria 2961
137 Ga0501034_0136263 3300049571 Bacteria 2436
138 Ga0501037_0152008 3300049573 Bacteria 1654
139 Ga0501038_0072521 3300049574 Bacteria 2918
140 Ga0501039_0624962 3300049575 Bacteria 844
141 Ga0501043_0047271 3300049579 Bacteria 3383
142 Ga0501047_0049600 3300049581 Bacteria 4053
143 Ga0501070_0000268 3300049586 Bacteria 49072
144 Ga0501035_0043663 3300049822 Bacteria 4039
145 Ga0501035_0153816 3300049822 Bacteria 1994
146 Ga0501035_0164068 3300049822 Bacteria 1922
147 Ga0501044_0185790 3300049823 Bacteria 2043
148 Ga0495601_0005992 3300053077 Bacteria 7093
149 Ga0495612_0001255 3300053078 Bacteria 10455
150 Ga0500635_0000006 3300053080 Bacteria 187108
151 Ga0495619_0006601 3300053085 Bacteria 7342
152 Ga0495619_0013162 3300053085 Bacteria 5213
153 Ga0495619_0145289 3300053085 Bacteria 1635
154 Ga0495619_0146013 3300053085 Bacteria 1631
155 Ga0500573_0007406 3300053140 Bacteria 5985
156 Ga0500588_0000862 3300053146 Bacteria 5303
157 Ga0466962_0067685 3300061719 Bacteria 1705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0624962 Ga0501039_0624962_14_796 260
2 3300005535 Ga0070684_100299496 Ga0070684_1002994962 273
3 3300005614 Ga0068856_100361449 Ga0068856_1003614492 273
4 3300007076 Ga0075435_100065893 Ga0075435_1000658933 273
5 3300035120 Ga0373957_0072680 Ga0373957_0072680_427_1302 274
6 3300046463 Ga0495653_0152882 Ga0495653_0152882_216_1091 274
7 3300046511 Ga0495608_0024408 Ga0495608_0024408_183_1058 274
8 3300046517 Ga0495630_0126248 Ga0495630_0126248_640_1515 274
9 3300046529 Ga0495652_0028992 Ga0495652_0028992_3026_3901 274
10 3300046675 Ga0495657_0030387 Ga0495657_0030387_938_1813 274
11 3300046680 Ga0495646_0114567 Ga0495646_0114567_449_1324 274
12 3300053085 Ga0495619_0013162 Ga0495619_0013162_235_1113 275
13 3300005467 Ga0070706_100049999 Ga0070706_1000499992 277
14 3300025910 Ga0207684_10057709 Ga0207684_100577092 277
15 3300005435 Ga0070714_100048621 Ga0070714_1000486213 281
16 3300026078 Ga0207702_10079524 Ga0207702_100795242 281
17 3300009174 Ga0105241_10041598 Ga0105241_100415983 282
18 3300014969 Ga0157376_10058695 Ga0157376_100586953 282
19 3300026116 Ga0207674_10166915 Ga0207674_101669153 282
20 3300034817 Ga0373948_0000204 Ga0373948_0000204_2062_2940 282
21 3300034819 Ga0373958_0008417 Ga0373958_0008417_314_1192 282
22 3300035084 Ga0373928_0012952 Ga0373928_0012952_678_1556 282
23 3300035088 Ga0373940_0009011 Ga0373940_0009011_373_1251 282
24 3300048905 Ga0496102_0426557 Ga0496102_0426557_292_1170 282
25 3300048907 Ga0496104_0175641 Ga0496104_0175641_534_1412 282
26 3300048909 Ga0496106_0238376 Ga0496106_0238376_143_1021 282
27 3300048910 Ga0496107_0464955 Ga0496107_0464955_12_890 282
28 3300048911 Ga0496108_0015327 Ga0496108_0015327_4538_5416 282
29 3300048913 Ga0496110_0343128 Ga0496110_0343128_331_1209 282
30 3300048918 Ga0496115_0013540 Ga0496115_0013540_3172_4050 282
31 3300005436 Ga0070713_100024532 Ga0070713_1000245323 284
32 3300006358 Ga0068871_100223350 Ga0068871_1002233502 284
33 3300025911 Ga0207654_10146953 Ga0207654_101469532 284
34 3300025915 Ga0207693_10164484 Ga0207693_101644841 284
35 3300025928 Ga0207700_10065026 Ga0207700_100650262 284
36 3300026078 Ga0207702_10265184 Ga0207702_102651842 284
37 3300028381 Ga0268264_10325611 Ga0268264_103256112 284
38 3300005327 Ga0070658_10442816 Ga0070658_104428162 285
39 3300005329 Ga0070683_100043884 Ga0070683_1000438842 285
40 3300005336 Ga0070680_100032284 Ga0070680_1000322845 285
41 3300005458 Ga0070681_10027284 Ga0070681_100272845 285
42 3300013104 Ga0157370_10017095 Ga0157370_100170955 285
43 3300013105 Ga0157369_10042431 Ga0157369_100424316 285
44 3300020082 Ga0206353_11342046 Ga0206353_113420462 285
45 3300025909 Ga0207705_10045023 Ga0207705_100450234 285
46 3300025912 Ga0207707_10020673 Ga0207707_100206732 285
47 3300025919 Ga0207657_10036933 Ga0207657_100369334 285
48 3300025921 Ga0207652_10081788 Ga0207652_100817882 285
49 3300035692 Ga0373935_0031499 Ga0373935_0031499_1622_2488 287
50 3300025914 Ga0207671_10220934 Ga0207671_102209341 288
51 3300031616 Ga0307508_10000771 Ga0307508_1000077118 288
52 3300048920 Ga0496117_0008510 Ga0496117_0008510_6973_7947 289
53 3300048921 Ga0496118_0000360 Ga0496118_0000360_20217_21191 289
54 3300048927 Ga0496124_0000173 Ga0496124_0000173_108404_109378 289
55 iso_pu_bacteria 2919395869 2919399387 289
56 iso_pu_bacteria 2995726249 2995726350 289
57 iso_pu_bacteria 2919523602 2919525587 290
58 iso_pu_bacteria 8055034563 8055037768 290
59 3300005437 Ga0070710_10005910 Ga0070710_100059102 291
60 3300005439 Ga0070711_100045175 Ga0070711_1000451753 291
61 3300025906 Ga0207699_10070148 Ga0207699_100701482 291
62 3300025928 Ga0207700_10056963 Ga0207700_100569633 291
63 iso_pu_bacteria 2858868258 2858870312 291
64 iso_pu_bacteria 8055412473 8055412732 291
65 3300005435 Ga0070714_100000708 Ga0070714_10000070810 293
66 3300025906 Ga0207699_10112742 Ga0207699_101127422 293
67 3300025929 Ga0207664_10000338 Ga0207664_1000033825 293
68 3300025939 Ga0207665_10064410 Ga0207665_100644103 293
69 3300053140 Ga0500573_0007406 Ga0500573_0007406_3108_3989 293
70 3300006881 Ga0068865_100412782 Ga0068865_1004127821 294
71 3300053085 Ga0495619_0006601 Ga0495619_0006601_4269_5153 294
72 iso_pu_bacteria 2643221616 2644096881 294
73 iso_pu_bacteria 2773857763 2774397942 294
74 iso_pu_bacteria 2773857763 2774400914 294
75 iso_pu_bacteria 2884763398 2884765908 294
76 3300048929 Ga0496126_0000526 Ga0496126_0000526_17991_18902 295
77 3300049571 Ga0501034_0095990 Ga0501034_0095990_1194_2084 295
78 3300049581 Ga0501047_0049600 Ga0501047_0049600_2940_3830 295
79 3300049822 Ga0501035_0164068 Ga0501035_0164068_697_1587 295
80 iso_pu_bacteria 2862993130 2862994935 295
81 iso_pu_bacteria 2915358134 2915362877 295
82 iso_pu_bacteria 2946041624 2946041968 295
83 iso_pu_bacteria 8004182704 8004184124 295
84 3300003760 Ga0055527_1000003 Ga0055527_1000003562 296
85 3300003762 Ga0055542_1000005 Ga0055542_1000005426 296
86 3300003763 Ga0055529_1000046 Ga0055529_100004685 296
87 3300025228 Ga0209672_100003 Ga0209672_1000031400 296
88 3300025229 Ga0209147_100475 Ga0209147_10047513 296
89 3300025254 Ga0209148_1000004 Ga0209148_10000041695 296
90 3300025272 Ga0209455_1000080 Ga0209455_1000080151 296
91 3300025904 Ga0207647_10012051 Ga0207647_100120512 296
92 3300031507 Ga0307509_10114198 Ga0307509_101141983 296
93 3300033179 Ga0307507_10000033 Ga0307507_1000003311 296
94 3300037312 Ga0395899_0029461 Ga0395899_0029461_1617_2537 296
95 3300037418 Ga0395900_0002476 Ga0395900_0002476_17601_18521 296
96 3300037466 Ga0395898_0000647 Ga0395898_0000647_36679_37599 296
97 3300046462 Ga0495651_0005034 Ga0495651_0005034_4691_5611 296
98 3300046477 Ga0495664_0023578 Ga0495664_0023578_611_1531 296
99 3300046514 Ga0495618_0082139 Ga0495618_0082139_79_999 296
100 3300046529 Ga0495652_0007003 Ga0495652_0007003_2476_3396 296
101 3300046543 Ga0495645_0069649 Ga0495645_0069649_932_1852 296
102 3300046679 Ga0495623_0018509 Ga0495623_0018509_1209_2129 296
103 3300046809 Ga0495600_0049444 Ga0495600_0049444_1658_2578 296
104 3300048088 Ga0495602_0132040 Ga0495602_0132040_281_1201 296
105 3300048904 Ga0496101_0143547 Ga0496101_0143547_822_1742 296
106 3300048906 Ga0496103_0039678 Ga0496103_0039678_668_1588 296
107 3300048907 Ga0496104_0033080 Ga0496104_0033080_2605_3525 296
108 3300048908 Ga0496105_0012351 Ga0496105_0012351_1289_2209 296
109 3300048914 Ga0496111_0199877 Ga0496111_0199877_172_1104 296
110 3300048918 Ga0496115_0246528 Ga0496115_0246528_328_1248 296
111 3300048920 Ga0496117_0001986 Ga0496117_0001986_7176_8108 296
112 3300048921 Ga0496118_0033274 Ga0496118_0033274_2986_3918 296
113 3300048922 Ga0496119_0003061 Ga0496119_0003061_10017_10949 296
114 3300048923 Ga0496120_0015951 Ga0496120_0015951_970_1902 296
115 3300048925 Ga0496122_0000460 Ga0496122_0000460_48902_49834 296
116 3300048926 Ga0496123_0001253 Ga0496123_0001253_32660_33592 296
117 3300048928 Ga0496125_0006837 Ga0496125_0006837_3062_3994 296
118 3300049573 Ga0501037_0152008 Ga0501037_0152008_336_1229 296
119 3300049579 Ga0501043_0047271 Ga0501043_0047271_2061_2954 296
120 3300049586 Ga0501070_0000268 Ga0501070_0000268_10106_11026 296
121 3300049822 Ga0501035_0043663 Ga0501035_0043663_2562_3482 296
122 3300049822 Ga0501035_0153816 Ga0501035_0153816_569_1462 296
123 3300049823 Ga0501044_0185790 Ga0501044_0185790_1059_1952 296
124 3300053077 Ga0495601_0005992 Ga0495601_0005992_1499_2419 296
125 3300053078 Ga0495612_0001255 Ga0495612_0001255_1323_2243 296
126 3300053080 Ga0500635_0000006 Ga0500635_0000006_148394_149314 296
127 3300053085 Ga0495619_0145289 Ga0495619_0145289_570_1490 296
128 3300053085 Ga0495619_0146013 Ga0495619_0146013_626_1546 296
129 iso_pu_bacteria 2757320536 2758225471 296
130 iso_pu_bacteria 2842888712 2842889016 296
131 iso_pu_bacteria 8055037949 8055039868 296
132 3300031901 Ga0307406_10000222 Ga0307406_1000022232 297
133 3300048917 Ga0496114_0115335 Ga0496114_0115335_1165_2064 297
134 3300048920 Ga0496117_0000034 Ga0496117_0000034_210281_211177 297
135 3300048929 Ga0496126_0011667 Ga0496126_0011667_6742_7662 297
136 iso_pu_bacteria 2643221546 2643751862 297
137 iso_pu_bacteria 2857723135 2857725313 297
138 iso_pu_bacteria 2906799679 2906802027 297
139 iso_pu_bacteria 2946033335 2946036030 297
140 iso_pu_bacteria 2946080515 2946082193 297
141 3300006051 Ga0075364_10203287 Ga0075364_102032872 298
142 3300013104 Ga0157370_10045959 Ga0157370_100459594 298
143 3300031901 Ga0307406_10103084 Ga0307406_101030841 298
144 3300044719 Ga0466971_0006456 Ga0466971_0006456_2279_3205 298
145 3300044842 Ga0466957_0175535 Ga0466957_0175535_309_1235 298
146 3300045049 Ga0466959_0141834 Ga0466959_0141834_607_1533 298
147 3300053146 Ga0500588_0000862 Ga0500588_0000862_734_1630 298
148 3300061719 Ga0466962_0067685 Ga0466962_0067685_492_1418 298
149 iso_pu_bacteria 2852646457 2852647921 298
150 3300013105 Ga0157369_10096389 Ga0157369_100963893 299
151 3300013105 Ga0157369_10098873 Ga0157369_100988734 299
152 3300031901 Ga0307406_10042528 Ga0307406_100425282 299
153 3300044683 Ga0466965_0003094 Ga0466965_0003094_4457_5356 299
154 3300044735 Ga0466968_0008966 Ga0466968_0008966_100_999 299
155 3300044901 Ga0466960_0002948 Ga0466960_0002948_2002_2901 299
156 3300048925 Ga0496122_0056303 Ga0496122_0056303_776_1684 299
157 3300025909 Ga0207705_10265649 Ga0207705_102656492 300
158 3300046471 Ga0495650_0000873 Ga0495650_0000873_3663_4565 300
159 3300049571 Ga0501034_0001600 Ga0501034_0001600_17560_18462 300
160 3300049571 Ga0501034_0136263 Ga0501034_0136263_917_1819 300
161 3300049574 Ga0501038_0072521 Ga0501038_0072521_1434_2336 300
162 iso_pu_bacteria 2773857759 2774382600 301
163 3300048907 Ga0496104_0032011 Ga0496104_0032011_1404_2318 302
164 3300048908 Ga0496105_0048793 Ga0496105_0048793_2261_3175 302
165 3300048921 Ga0496118_0019492 Ga0496118_0019492_4017_4931 302
166 3300048921 Ga0496118_0116929 Ga0496118_0116929_506_1486 303
167 iso_pu_bacteria 2919055335 2919056699 303
168 iso_pu_bacteria 2966924647 2966926005 303
169 3300005327 Ga0070658_10029311 Ga0070658_100293112 304
170 3300013105 Ga0157369_10209849 Ga0157369_102098492 304
171 3300020081 Ga0206354_11606290 Ga0206354_116062902 304
172 3300020082 Ga0206353_11960773 Ga0206353_119607732 304
173 3300025253 Ga0209677_100568 Ga0209677_10056811 304
174 3300037312 Ga0395899_0003949 Ga0395899_0003949_2661_3578 304
175 3300037418 Ga0395900_0311509 Ga0395900_0311509_532_1449 304
176 iso_pu_bacteria 2870628048 2870628859 304
177 3300010375 Ga0105239_10000214 Ga0105239_1000021439 307
178 iso_pu_bacteria 2751185788 2753301078 307
179 3300048926 Ga0496123_0079845 Ga0496123_0079845_1026_1967 313
180 iso_pu_bacteria 2928104781 2928107126 320
181 iso_pu_bacteria 2904501621 2904503467 325
182 iso_pu_bacteria 2908674828 2908675105 325
183 iso_pu_bacteria 2909074476 2909075568 325
184 iso_pu_bacteria 2919039151 2919039795 325
185 iso_pu_bacteria 2919042368 2919045896 325
186 iso_pu_bacteria 2928500415 2928503102 325
187 iso_pu_bacteria 2984551494 2984553251 325
188 iso_pu_bacteria 2904430863 2904431018 327
189 3300044765 Ga0466970_0053608 Ga0466970_0053608_903_1892 329
190 3300046538 Ga0495609_0071615 Ga0495609_0071615_52_1080 329
191 3300048905 Ga0496102_0148249 Ga0496102_0148249_141_1130 329
192 3300048923 Ga0496120_0091479 Ga0496120_0091479_269_1258 329
193 3300048927 Ga0496124_0041096 Ga0496124_0041096_1946_2935 329
194 3300003323 rootH1_10285771 rootH1_102857712 331
195 iso_pu_bacteria 2964326757 2964327321 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22649

Cgl0159

Cgl0159-like

49

300

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fok-assembly2.cif.gz_C crystal structure of cgl0159 from corynebacterium glutamicum (brevibacterium flavum). northeast structural genomics target cgr115 0.985 1 294
3fok-assembly2.cif.gz_C crystal structure of cgl0159 from corynebacterium glutamicum (brevibacterium flavum). northeast structural genomics target cgr115 0.9718 1 294
2qjg-assembly2.cif.gz_I m. jannaschii adh synthase complexed with f1,6p 0.8428 36 294
2qjg-assembly1.cif.gz_C m. jannaschii adh synthase complexed with f1,6p 0.839 23 294
2qjg-assembly2.cif.gz_S m. jannaschii adh synthase complexed with f1,6p 0.8298 23 294
ID Description Score Start End Superfamily
3fokJ00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9736 1 294 3.20.20.70
3fokJ00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.96 1 294 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8119 23 294 3.20.20.70
3glcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7623 18 294 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7446 23 294 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0D5CM56-F1-model_v4 Deoxyribose-phosphate aldolase 0.9946 9 295
AF-A0A6I3GY93-F1-model_v4 Cgl0159-like domain-containing protein 0.9941 45 232
AF-A0A0J6W353-F1-model_v4 Cgl0159-like domain-containing protein 0.9933 146 293
AF-I7G5R5-F1-model_v4 Cgl0159-like domain-containing protein 0.9921 44 294
AF-A0A1J4NJY7-F1-model_v4 Deoxyribose-phosphate aldolase 0.9917 24 219

Feature Viewer

pLDDT pTM Quality
87.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map