F301249

General Info

Members Datasets Scaffolds Average Seq Length
196 126 392 368

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100238725|Ga0070686_1002387251
Length 363
Sequence MSKRIIIAGGGTGGHIFPAIAIAHALKKIDKDCNILFIGAKGKMEMEKVPQAGYEIKGLNISGFNRGSLIKNIGLPFKVLRSLFQVRSIMRKFKPDAVIGVGGYSSFPVLRTAQASGIPNFIHESNSFAGRSNIMLGKKATKIFTGTAGMEKFFPAGKIMVTGNPVRESISSSAVTRPEGIKFFSLEENRKTVLVVGGSLGARSINEAIAHGLDELVDKEGLQLIWQTGKNNSGHPLEKTKNRKGVWVNEFIGQMEFAYAAADIVVARAGAMTVAELCVAEKPVVFVPYPFAAEDHQTANAKQLVEQKAATMIKDSEVKEKLVPALIALAKDVLKQNELKKNIGRLGIKDADRKIAAEIMKLI

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 0
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100238725 3300005544 Bacteria 1322
2 rootH2_10001202 3300003320 Bacteria 51390
3 rootH2_10011327 3300003320 Bacteria 6885
4 rootL2_10048246 3300003322 Bacteria 1872
5 Ga0065712_10005315 3300005290 Bacteria 3049
6 Ga0065712_10007901 3300005290 Bacteria 3886
7 Ga0065712_10012745 3300005290 Bacteria 2079
8 Ga0070683_100035947 3300005329 Bacteria 4531
9 Ga0070683_100070222 3300005329 Bacteria 3267
10 Ga0070683_100099869 3300005329 Bacteria 2732
11 Ga0070670_100009721 3300005331 Bacteria 8212
12 Ga0070670_100031426 3300005331 Bacteria 4573
13 Ga0070670_100155069 3300005331 Bacteria 1983
14 Ga0068869_100039695 3300005334 Bacteria 3362
15 Ga0070682_100054432 3300005337 Bacteria 2510
16 Ga0070660_100054653 3300005339 Bacteria 3084
17 Ga0070689_100105774 3300005340 Bacteria 2232
18 Ga0070669_100005537 3300005353 Bacteria 9117
19 Ga0070669_100069732 3300005353 Bacteria 2597
20 Ga0070675_100003793 3300005354 Bacteria 11478
21 Ga0070675_100114171 3300005354 Bacteria 2289
22 Ga0070671_100203203 3300005355 Bacteria 1680
23 Ga0070674_100255040 3300005356 Bacteria 1379
24 Ga0070673_100017210 3300005364 Bacteria 5133
25 Ga0070673_100024484 3300005364 Bacteria 4427
26 Ga0070688_100000309 3300005365 Bacteria 24809
27 Ga0070663_100191453 3300005455 Unclassified 1592
28 Ga0070662_100012206 3300005457 Bacteria 5690
29 Ga0068867_100012035 3300005459 Bacteria 6110
30 Ga0068867_100033804 3300005459 Bacteria 3705
31 Ga0070685_10040916 3300005466 Bacteria 2639
32 Ga0070698_100058852 3300005471 Bacteria 3883
33 Ga0070698_100321985 3300005471 Bacteria 1477
34 Ga0070679_100020299 3300005530 Bacteria 6475
35 Ga0070679_100205002 3300005530 Bacteria 1936
36 Ga0070679_100352634 3300005530 Bacteria 1419
37 Ga0070684_100009604 3300005535 Bacteria 7626
38 Ga0070684_100114994 3300005535 Bacteria 2415
39 Ga0068853_100146128 3300005539 Bacteria 2125
40 Ga0068853_100223404 3300005539 Bacteria 1721
41 Ga0070672_100019930 3300005543 Unclassified 4881
42 Ga0068855_100001432 3300005563 Bacteria 29672
43 Ga0070664_100305207 3300005564 Bacteria 1439
44 Ga0068857_100129920 3300005577 Bacteria 2272
45 Ga0068857_100165726 3300005577 Bacteria 2007
46 Ga0068854_100083126 3300005578 Unclassified 2367
47 Ga0068854_100087794 3300005578 Bacteria 2308
48 Ga0068856_100070267 3300005614 Bacteria 3463
49 Ga0068852_100033134 3300005616 Bacteria 4287
50 Ga0068852_100137627 3300005616 Bacteria 2256
51 Ga0068852_100182743 3300005616 Unclassified 1973
52 Ga0068859_100006844 3300005617 Bacteria 11581
53 Ga0068859_100040133 3300005617 Bacteria 4698
54 Ga0068859_100512396 3300005617 Bacteria 1295
55 Ga0068861_100001200 3300005719 Bacteria 16129
56 Ga0068861_100022262 3300005719 Bacteria 4564
57 Ga0068870_10026366 3300005840 Bacteria 2897
58 Ga0068863_100013646 3300005841 Bacteria 7838
59 Ga0068860_100026046 3300005843 Bacteria 5641
60 Ga0068862_100004144 3300005844 Bacteria 12282
61 Ga0068862_100342715 3300005844 Unclassified 1385
62 Ga0081540_1001649 3300005983 Bacteria 18988
63 Ga0081539_10001587 3300005985 Bacteria 37564
64 Ga0081539_10026371 3300005985 Bacteria 3709
65 Ga0097621_100095183 3300006237 Bacteria 2497
66 Ga0097621_100129039 3300006237 Bacteria 2150
67 Ga0097621_100299439 3300006237 Bacteria 1420
68 Ga0068871_100124596 3300006358 Bacteria 2179
69 Ga0068871_100148254 3300006358 Bacteria 1999
70 Ga0075428_100051381 3300006844 Bacteria 4520
71 Ga0068865_100200939 3300006881 Bacteria 1547
72 Ga0097620_100006844 3300006931 Bacteria 11581
73 Ga0097620_100040133 3300006931 Bacteria 4698
74 Ga0097620_100512393 3300006931 Bacteria 1295
75 Ga0105240_10003829 3300009093 Bacteria 23261
76 Ga0105240_10013277 3300009093 Bacteria 11325
77 Ga0111539_10016212 3300009094 Bacteria 9243
78 Ga0114129_10107388 3300009147 Bacteria 3855
79 Ga0105241_10017701 3300009174 Bacteria 5239
80 Ga0105242_10057544 3300009176 Bacteria 3185
81 Ga0105242_10312977 3300009176 Unclassified 1437
82 Ga0105242_10459597 3300009176 Unclassified 1202
83 Ga0105237_10008097 3300009545 Bacteria 11421
84 Ga0105237_10020422 3300009545 Bacteria 6828
85 Ga0105237_10021338 3300009545 Bacteria 6659
86 Ga0105238_10003096 3300009551 Bacteria 16583
87 Ga0105249_10003587 3300009553 Bacteria 13426
88 Ga0105249_10004323 3300009553 Bacteria 12288
89 Ga0105249_10026949 3300009553 Bacteria 5183
90 Ga0105249_10083992 3300009553 Bacteria 2965
91 Ga0105249_10200620 3300009553 Bacteria 1952
92 Ga0105239_10015248 3300010375 Bacteria 8515
93 Ga0157373_10034361 3300013100 Bacteria 3642
94 Ga0157373_10074938 3300013100 Bacteria 2387
95 Ga0157371_10042487 3300013102 Bacteria 3240
96 Ga0157371_10155571 3300013102 Bacteria 1631
97 Ga0157370_10003787 3300013104 Bacteria 17651
98 Ga0157369_10027357 3300013105 Bacteria 6322
99 Ga0157369_10119641 3300013105 Bacteria 2795
100 Ga0157369_10129712 3300013105 Bacteria 2672
101 Ga0157374_10000025 3300013296 Bacteria 245131
102 Ga0157378_10078366 3300013297 Bacteria 2980
103 Ga0157378_10247314 3300013297 Bacteria 1706
104 Ga0163162_10090697 3300013306 Bacteria 3138
105 Ga0163162_10207208 3300013306 Bacteria 2090
106 Ga0157372_10085345 3300013307 Bacteria 3580
107 Ga0157372_10151763 3300013307 Bacteria 2674
108 Ga0157375_10039405 3300013308 Bacteria 4548
109 Ga0157375_10207663 3300013308 Bacteria 2115
110 Ga0157380_10000709 3300014326 Bacteria 20825
111 Ga0157380_10081660 3300014326 Unclassified 2645
112 Ga0157377_10002380 3300014745 Bacteria 8297
113 Ga0157379_10323025 3300014968 Bacteria 1409
114 Ga0157376_10032939 3300014969 Bacteria 4167
115 Ga0157376_10252623 3300014969 Unclassified 1647
116 Ga0157376_10351492 3300014969 Bacteria 1411
117 Ga0207697_10033889 3300025315 Bacteria 2090
118 Ga0207643_10004866 3300025908 Bacteria 7197
119 Ga0207705_10242684 3300025909 Bacteria 1373
120 Ga0207684_10269225 3300025910 Unclassified 1470
121 Ga0207695_10000282 3300025913 Bacteria 126242
122 Ga0207695_10001411 3300025913 Bacteria 40483
123 Ga0207695_10035895 3300025913 Bacteria 5367
124 Ga0207671_10012912 3300025914 Bacteria 6686
125 Ga0207652_10076379 3300025921 Bacteria 2921
126 Ga0207652_10145618 3300025921 Bacteria 2120
127 Ga0207681_10002847 3300025923 Bacteria 10943
128 Ga0207681_10056691 3300025923 Bacteria 2673
129 Ga0207681_10231701 3300025923 Bacteria 1434
130 Ga0207659_10017376 3300025926 Bacteria 4699
131 Ga0207644_10186001 3300025931 Bacteria 1631
132 Ga0207706_10039214 3300025933 Bacteria 4199
133 Ga0207686_10022146 3300025934 Bacteria 3657
134 Ga0207669_10181898 3300025937 Bacteria 1508
135 Ga0207661_10114737 3300025944 Unclassified 2284
136 Ga0207667_10002943 3300025949 Bacteria 21138
137 Ga0207667_10017869 3300025949 Bacteria 7971
138 Ga0207651_10015271 3300025960 Bacteria 4458
139 Ga0207651_10040541 3300025960 Bacteria 3082
140 Ga0207712_10162065 3300025961 Bacteria 1739
141 Ga0207668_10250016 3300025972 Unclassified 1439
142 Ga0207640_10063593 3300025981 Unclassified 2453
143 Ga0207658_10070772 3300025986 Unclassified 2640
144 Ga0207639_10058668 3300026041 Bacteria 2961
145 Ga0207678_10183817 3300026067 Bacteria 1785
146 Ga0207702_10224926 3300026078 Bacteria 1750
147 Ga0207641_10000549 3300026088 Bacteria 42051
148 Ga0207641_10085438 3300026088 Bacteria 2749
149 Ga0207648_10002577 3300026089 Bacteria 19412
150 Ga0207648_10158279 3300026089 Bacteria 2000
151 Ga0207676_10136992 3300026095 Bacteria 2090
152 Ga0207674_10031145 3300026116 Bacteria 5605
153 Ga0207674_10051902 3300026116 Bacteria 4183
154 Ga0207674_10092813 3300026116 Bacteria 3008
155 Ga0207674_10121654 3300026116 Bacteria 2577
156 Ga0207675_100025046 3300026118 Bacteria 5553
157 Ga0207675_100033021 3300026118 Bacteria 4822
158 Ga0207675_100043761 3300026118 Bacteria 4182
159 Ga0207675_100053923 3300026118 Bacteria 3751
160 Ga0207698_10050455 3300026142 Bacteria 3174
161 Ga0207698_10203840 3300026142 Unclassified 1774
162 Ga0207698_10278432 3300026142 Bacteria 1546
163 Ga0268265_10034372 3300028380 Bacteria 3694
164 Ga0268264_10037024 3300028381 Bacteria 4021
165 Ga0268264_10160860 3300028381 Bacteria 2022
166 Ga0307511_10000228 3300030521 Bacteria 57237
167 Ga0265327_10000099 3300031251 Bacteria 190474
168 Ga0307509_10151521 3300031507 Bacteria 2233
169 Ga0436365_0021153 3300039437 Bacteria 19582
170 Ga0466969_0016272 3300044656 Bacteria 3895
171 Ga0466966_0000054 3300044684 Bacteria 82352
172 Ga0466961_0016792 3300044693 Unclassified 4706
173 Ga0453684_0112658 3300044712 Bacteria 3302
174 Ga0466959_0000012 3300045049 Bacteria 168961
175 Ga0466959_0007579 3300045049 Bacteria 7628
176 Ga0495608_0109464 3300046511 Bacteria 1777
177 Ga0495632_0123025 3300046519 Bacteria 1211
178 Ga0495587_0107156 3300046536 Bacteria 1607
179 Ga0495668_0000114 3300046616 Bacteria 127503
180 Ga0495634_0049003 3300046642 Bacteria 2842
181 Ga0495635_0073976 3300046663 Bacteria 2334
182 Ga0495658_0037375 3300046683 Bacteria 2683
183 Ga0495674_0072951 3300047319 Bacteria 2960
184 Ga0495676_0071233 3300047321 Bacteria 2673
185 Ga0495680_0143866 3300047322 Bacteria 1743
186 Ga0495684_0073811 3300047471 Bacteria 2592
187 Ga0495686_0000128 3300047472 Bacteria 156223
188 Ga0501037_0037806 3300049573 Bacteria 3559
189 Ga0501035_0322330 3300049822 Bacteria 1298
190 Ga0501044_0004615 3300049823 Bacteria 15414
191 Ga0501044_0025223 3300049823 Bacteria 6304
192 Ga0501226_002443 3300049853 Bacteria 2272
193 nmdc:mga05p37_226667_c1 3300050507 Unclassified 2253
194 nmdc:mga08y16_67226_c1 3300050511 Unclassified 3739
195 Ga0500583_0000048 3300053092 Bacteria 78503
196 2819589902 2818991444 Bacteria 6968812
197 Ga0070686_100238725
198 rootH2_10001202
199 rootH2_10011327
200 rootL2_10048246
201 Ga0065712_10005315
202 Ga0065712_10007901
203 Ga0065712_10012745
204 Ga0070683_100035947
205 Ga0070683_100070222
206 Ga0070683_100099869
207 Ga0070670_100009721
208 Ga0070670_100031426
209 Ga0070670_100155069
210 Ga0068869_100039695
211 Ga0070682_100054432
212 Ga0070660_100054653
213 Ga0070689_100105774
214 Ga0070669_100005537
215 Ga0070669_100069732
216 Ga0070675_100003793
217 Ga0070675_100114171
218 Ga0070671_100203203
219 Ga0070674_100255040
220 Ga0070673_100017210
221 Ga0070673_100024484
222 Ga0070688_100000309
223 Ga0070663_100191453
224 Ga0070662_100012206
225 Ga0068867_100012035
226 Ga0068867_100033804
227 Ga0070685_10040916
228 Ga0070698_100058852
229 Ga0070698_100321985
230 Ga0070679_100020299
231 Ga0070679_100205002
232 Ga0070679_100352634
233 Ga0070684_100009604
234 Ga0070684_100114994
235 Ga0068853_100146128
236 Ga0068853_100223404
237 Ga0070672_100019930
238 Ga0068855_100001432
239 Ga0070664_100305207
240 Ga0068857_100129920
241 Ga0068857_100165726
242 Ga0068854_100083126
243 Ga0068854_100087794
244 Ga0068856_100070267
245 Ga0068852_100033134
246 Ga0068852_100137627
247 Ga0068852_100182743
248 Ga0068859_100006844
249 Ga0068859_100040133
250 Ga0068859_100512396
251 Ga0068861_100001200
252 Ga0068861_100022262
253 Ga0068870_10026366
254 Ga0068863_100013646
255 Ga0068860_100026046
256 Ga0068862_100004144
257 Ga0068862_100342715
258 Ga0081540_1001649
259 Ga0081539_10001587
260 Ga0081539_10026371
261 Ga0097621_100095183
262 Ga0097621_100129039
263 Ga0097621_100299439
264 Ga0068871_100124596
265 Ga0068871_100148254
266 Ga0075428_100051381
267 Ga0068865_100200939
268 Ga0097620_100006844
269 Ga0097620_100040133
270 Ga0097620_100512393
271 Ga0105240_10003829
272 Ga0105240_10013277
273 Ga0111539_10016212
274 Ga0114129_10107388
275 Ga0105241_10017701
276 Ga0105242_10057544
277 Ga0105242_10312977
278 Ga0105242_10459597
279 Ga0105237_10008097
280 Ga0105237_10020422
281 Ga0105237_10021338
282 Ga0105238_10003096
283 Ga0105249_10003587
284 Ga0105249_10004323
285 Ga0105249_10026949
286 Ga0105249_10083992
287 Ga0105249_10200620
288 Ga0105239_10015248
289 Ga0157373_10034361
290 Ga0157373_10074938
291 Ga0157371_10042487
292 Ga0157371_10155571
293 Ga0157370_10003787
294 Ga0157369_10027357
295 Ga0157369_10119641
296 Ga0157369_10129712
297 Ga0157374_10000025
298 Ga0157378_10078366
299 Ga0157378_10247314
300 Ga0163162_10090697
301 Ga0163162_10207208
302 Ga0157372_10085345
303 Ga0157372_10151763
304 Ga0157375_10039405
305 Ga0157375_10207663
306 Ga0157380_10000709
307 Ga0157380_10081660
308 Ga0157377_10002380
309 Ga0157379_10323025
310 Ga0157376_10032939
311 Ga0157376_10252623
312 Ga0157376_10351492
313 Ga0207697_10033889
314 Ga0207643_10004866
315 Ga0207705_10242684
316 Ga0207684_10269225
317 Ga0207695_10000282
318 Ga0207695_10001411
319 Ga0207695_10035895
320 Ga0207671_10012912
321 Ga0207652_10076379
322 Ga0207652_10145618
323 Ga0207681_10002847
324 Ga0207681_10056691
325 Ga0207681_10231701
326 Ga0207659_10017376
327 Ga0207644_10186001
328 Ga0207706_10039214
329 Ga0207686_10022146
330 Ga0207669_10181898
331 Ga0207661_10114737
332 Ga0207667_10002943
333 Ga0207667_10017869
334 Ga0207651_10015271
335 Ga0207651_10040541
336 Ga0207712_10162065
337 Ga0207668_10250016
338 Ga0207640_10063593
339 Ga0207658_10070772
340 Ga0207639_10058668
341 Ga0207678_10183817
342 Ga0207702_10224926
343 Ga0207641_10000549
344 Ga0207641_10085438
345 Ga0207648_10002577
346 Ga0207648_10158279
347 Ga0207676_10136992
348 Ga0207674_10031145
349 Ga0207674_10051902
350 Ga0207674_10092813
351 Ga0207674_10121654
352 Ga0207675_100025046
353 Ga0207675_100033021
354 Ga0207675_100043761
355 Ga0207675_100053923
356 Ga0207698_10050455
357 Ga0207698_10203840
358 Ga0207698_10278432
359 Ga0268265_10034372
360 Ga0268264_10037024
361 Ga0268264_10160860
362 Ga0307511_10000228
363 Ga0265327_10000099
364 Ga0307509_10151521
365 Ga0436365_0021153
366 Ga0466969_0016272
367 Ga0466966_0000054
368 Ga0466961_0016792
369 Ga0453684_0112658
370 Ga0466959_0000012
371 Ga0466959_0007579
372 Ga0495608_0109464
373 Ga0495632_0123025
374 Ga0495587_0107156
375 Ga0495668_0000114
376 Ga0495634_0049003
377 Ga0495635_0073976
378 Ga0495658_0037375
379 Ga0495674_0072951
380 Ga0495676_0071233
381 Ga0495680_0143866
382 Ga0495684_0073811
383 Ga0495686_0000128
384 Ga0501037_0037806
385 Ga0501035_0322330
386 Ga0501044_0004615
387 Ga0501044_0025223
388 Ga0501226_002443
389 nmdc:mga05p37_226667_c1
390 nmdc:mga08y16_67226_c1
391 Ga0500583_0000048
392 2819589902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

5

145

0.98

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

192

358

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8697 4 360
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8599 4 360
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8311 3 364
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8289 3 364
7d1i-assembly1.cif.gz_A-2 crystal structure of acinetobacter baumannii murg 0.8026 3 360
ID Description Score Start End Superfamily
af_A0A0N7KD23_242_363_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.927 190 288 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9203 222 344 3.40.50.2000
af_P17443_6_162_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9077 3 166 3.40.50.2000
3s2uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9062 4 164 3.40.50.2000
af_K7KRG7_39_192_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9061 6 164 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q6A9S4-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9864 203 363 GO:0003677
GO:0006304
GO:0016758
AF-A0A258MD91-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9835 160 361 GO:0016758
AF-A0A257W761-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9793 162 363 GO:0016758
AF-A0A4Q5TSW4-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9704 193 364 GO:0016758
AF-A0A258MD91-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9692 160 361 GO:0016758

Map