F301752

General Info

Members Datasets Scaffolds Average Seq Length
196 111 195 506

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10012462|Ga0265340_100124622
Length 531
Sequence VRVKSKGAVYLVGAGPGDAGLLTLRGAELLRRADVVLYDALVNPDLLRLAPPSAELIARGKNMSLPQEEIVALLITRARDGKCVVRLKGGDPYIFGRGGEEAEALAAAKIPFEVVPGVSSVIAAPNYAGIPLTHREHCSSFTVFTGHENPDDAKTDLRYEQIAKIPGTKVVLMGTDRLNDWTQSLIAHGMPPETPVAMVRWGTLGRQKSVAGTLATIAALAAKEKISPPVLTIIGDVVKLRGKLNWFEQRPLFGQRIVVTRPIGKDAAPVSQDFRDGGPSSVALRRVDTPSLPKRLAELGADVLEVPTIKITGPADWSVIVDALLELNSYDWLVFTSANGVTAFFDLFFKRFQDMRDLGGARIAAVGPATAAKLRELHLQVDLTPKEAIGHKIAGEFAKFESIDNLKICLLRAEKANPDLPRALEELGAIVDDVAVYCTVAETGDPAGAGADLLEHGADWVTFTSGSTVEHFQERFDLPKLAKKFPQLKLASIGPETSKAIRALGLTPALEAKEHTTDGLIAGLRQFSKQA

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
64 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
65 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
66 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.51
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 2.04
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10150376 3300003323 Bacteria 3274
2 Ga0070690_100010691 3300005330 Bacteria 5349
3 Ga0070690_100036684 3300005330 Bacteria 3083
4 Ga0070689_100085450 3300005340 Bacteria 2481
5 Ga0070689_100136422 3300005340 Bacteria 1970
6 Ga0070714_100003192 3300005435 Bacteria 12190
7 Ga0070714_100024398 3300005435 Bacteria 4979
8 Ga0070711_100014521 3300005439 Bacteria 4963
9 Ga0070694_100017720 3300005444 Bacteria 4502
10 Ga0070681_10005737 3300005458 Bacteria 12001
11 Ga0070681_10150153 3300005458 Bacteria 2257
12 Ga0070684_100101524 3300005535 Bacteria 2570
13 Ga0070665_100000064 3300005548 Bacteria 216416
14 Ga0070665_100002012 3300005548 Bacteria 22861
15 Ga0070704_100021622 3300005549 Bacteria 4175
16 Ga0068855_100189132 3300005563 Bacteria 2323
17 Ga0068857_100047097 3300005577 Bacteria 3827
18 Ga0068856_100000696 3300005614 Bacteria 36434
19 Ga0068856_100086199 3300005614 Bacteria 3120
20 Ga0068859_100005397 3300005617 Bacteria 12999
21 Ga0068863_100118080 3300005841 Unclassified 2528
22 Ga0068858_100001509 3300005842 Bacteria 23898
23 Ga0097621_100080303 3300006237 Bacteria 2713
24 Ga0075428_100014333 3300006844 Bacteria 8812
25 Ga0097620_100005397 3300006931 Bacteria 12999
26 Ga0105240_10072069 3300009093 Bacteria 4271
27 Ga0111539_10011282 3300009094 Bacteria 11225
28 Ga0111539_10077710 3300009094 Bacteria 3906
29 Ga0105245_10024167 3300009098 Bacteria 5335
30 Ga0105248_10050856 3300009177 Bacteria 4649
31 Ga0105237_10086959 3300009545 Bacteria 3116
32 Ga0105238_10009109 3300009551 Bacteria 9932
33 Ga0105238_10038678 3300009551 Bacteria 4844
34 Ga0105249_10081945 3300009553 Bacteria 3001
35 Ga0157370_10040685 3300013104 Bacteria 4487
36 Ga0157374_10136751 3300013296 Bacteria 2376
37 Ga0157375_10000006 3300013308 Bacteria 384086
38 Ga0157375_10192030 3300013308 Unclassified 2197
39 Ga0163163_10000107 3300014325 Bacteria 87926
40 Ga0207707_10055923 3300025912 Bacteria 3432
41 Ga0207663_10002805 3300025916 Bacteria 8400
42 Ga0207694_10039471 3300025924 Bacteria 3633
43 Ga0207664_10006868 3300025929 Bacteria 7868
44 Ga0207664_10042195 3300025929 Bacteria 3560
45 Ga0207712_10086191 3300025961 Bacteria 2300
46 Ga0207702_10016968 3300026078 Bacteria 6025
47 Ga0207674_10060005 3300026116 Bacteria 3848
48 Ga0268266_10000035 3300028379 Bacteria 351632
49 Ga0268266_10002327 3300028379 Bacteria 20592
50 Ga0265337_1000306 3300028556 Bacteria 26055
51 Ga0265337_1001069 3300028556 Bacteria 14114
52 Ga0265337_1003255 3300028556 Bacteria 7094
53 Ga0265337_1006240 3300028556 Bacteria 4626
54 Ga0265337_1009113 3300028556 Bacteria 3563
55 Ga0265326_10022069 3300028558 Unclassified 1824
56 Ga0265319_1000013 3300028563 Bacteria 180699
57 Ga0265319_1011061 3300028563 Bacteria 3725
58 Ga0265334_10018906 3300028573 Bacteria 2840
59 Ga0265334_10056170 3300028573 Bacteria 1496
60 Ga0265323_10000411 3300028653 Bacteria 24543
61 Ga0265323_10027587 3300028653 Bacteria 2133
62 Ga0265336_10000982 3300028666 Bacteria 14073
63 Ga0265336_10017971 3300028666 Bacteria 2296
64 Ga0265338_10000008 3300028800 Bacteria 481542
65 Ga0265338_10000216 3300028800 Bacteria 106591
66 Ga0265338_10000232 3300028800 Bacteria 103731
67 Ga0265338_10000309 3300028800 Bacteria 88345
68 Ga0265338_10001302 3300028800 Bacteria 40875
69 Ga0265338_10003803 3300028800 Bacteria 20974
70 Ga0265338_10004027 3300028800 Bacteria 20163
71 Ga0265338_10004887 3300028800 Bacteria 17850
72 Ga0265338_10005012 3300028800 Bacteria 17505
73 Ga0265338_10009619 3300028800 Bacteria 11483
74 Ga0265338_10010806 3300028800 Bacteria 10642
75 Ga0265338_10011415 3300028800 Bacteria 10260
76 Ga0265338_10013253 3300028800 Bacteria 9327
77 Ga0265338_10016202 3300028800 Bacteria 8126
78 Ga0265338_10021579 3300028800 Bacteria 6709
79 Ga0265338_10064894 3300028800 Bacteria 3171
80 Ga0265338_10084586 3300028800 Bacteria 2647
81 Ga0265338_10102167 3300028800 Bacteria 2332
82 Ga0265324_10000796 3300029957 Bacteria 20666
83 Ga0265324_10000814 3300029957 Bacteria 20334
84 Ga0265324_10011316 3300029957 Bacteria 3404
85 Ga0265324_10014648 3300029957 Bacteria 2896
86 Ga0265324_10017651 3300029957 Bacteria 2594
87 Ga0265324_10020715 3300029957 Bacteria 2362
88 Ga0307511_10000819 3300030521 Bacteria 33223
89 Ga0265320_10000869 3300031240 Bacteria 22831
90 Ga0265320_10001329 3300031240 Bacteria 18052
91 Ga0265320_10022163 3300031240 Bacteria 3402
92 Ga0265320_10027448 3300031240 Bacteria 2968
93 Ga0265320_10027640 3300031240 Bacteria 2955
94 Ga0265325_10004051 3300031241 Bacteria 9350
95 Ga0265340_10012462 3300031247 Bacteria 4490
96 Ga0265340_10040311 3300031247 Bacteria 2301
97 Ga0265340_10058468 3300031247 Bacteria 1851
98 Ga0265339_10023094 3300031249 Bacteria 3597
99 Ga0265327_10004622 3300031251 Bacteria 12093
100 Ga0265316_10019757 3300031344 Bacteria 5753
101 Ga0265316_10027247 3300031344 Bacteria 4735
102 Ga0265316_10060849 3300031344 Bacteria 2934
103 Ga0265316_10079414 3300031344 Bacteria 2518
104 Ga0265313_10001793 3300031595 Bacteria 19613
105 Ga0265313_10002445 3300031595 Bacteria 16037
106 Ga0316575_10000016 3300031665 Bacteria 43743
107 Ga0316575_10005971 3300031665 Unclassified 4358
108 Ga0316575_10010182 3300031665 Unclassified 3448
109 Ga0316579_10016798 3300031691 Bacteria 3202
110 Ga0265314_10007327 3300031711 Bacteria 9579
111 Ga0265314_10025203 3300031711 Bacteria 4492
112 Ga0265314_10037497 3300031711 Unclassified 3512
113 Ga0265314_10047563 3300031711 Bacteria 3017
114 Ga0265342_10038789 3300031712 Bacteria 2899
115 Ga0265342_10100861 3300031712 Bacteria 1644
116 Ga0316576_10000853 3300031727 Bacteria 15473
117 Ga0316576_10103209 3300031727 Bacteria 2133
118 Ga0316578_10015894 3300031728 Bacteria 4061
119 Ga0316578_10053141 3300031728 Bacteria 2374
120 Ga0316578_10115702 3300031728 Bacteria 1611
121 Ga0316577_10010672 3300031733 Unclassified 4964
122 Ga0316577_10012400 3300031733 Unclassified 4643
123 Ga0316577_10029460 3300031733 Bacteria 3064
124 Ga0316583_10000261 3300032133 Bacteria 14407
125 Ga0316585_10002961 3300032137 Unclassified 4638
126 Ga0316580_10004180 3300032139 Bacteria 4165
127 Ga0316593_10003753 3300032168 Bacteria 3815
128 Ga0373930_0000444 3300034816 Bacteria 5535
129 Ga0373932_0000003 3300035112 Bacteria 459351
130 Ga0373943_0019802 3300035170 Bacteria 3098
131 Ga0373962_0000069 3300035242 Bacteria 22606
132 Ga0316574_0000099 3300035398 Bacteria 25083
133 Ga0316574_0015839 3300035398 Unclassified 4379
134 Ga0373931_0000063 3300035691 Bacteria 54303
135 Ga0373935_0039707 3300035692 Bacteria 2951
136 Ga0373927_0002280 3300035695 Bacteria 14048
137 Ga0373927_0025457 3300035695 Bacteria 3869
138 Ga0373927_0035247 3300035695 Bacteria 3254
139 Ga0373947_0008692 3300035725 Bacteria 5844
140 Ga0373947_0040863 3300035725 Bacteria 2764
141 Ga0373937_0133136 3300036401 Unclassified 2323
142 Ga0316582_0021135 3300036647 Bacteria 3838
143 Ga0316582_0055493 3300036647 Bacteria 2525
144 Ga0316582_0124873 3300036647 Unclassified 1725
145 Ga0316584_0000098 3300036712 Bacteria 35527
146 Ga0316584_0003410 3300036712 Bacteria 10312
147 Ga0316584_0116014 3300036712 Unclassified 2003
148 Ga0373925_0000396 3300037068 Bacteria 44612
149 Ga0373925_0000434 3300037068 Bacteria 42244
150 Ga0316581_0004813 3300037588 Bacteria 3474
151 Ga0451577_0002728 3300042876 Bacteria 20513
152 Ga0453684_0006244 3300044712 Bacteria 22833
153 Ga0453684_0007869 3300044712 Bacteria 19378
154 Ga0453684_0094986 3300044712 Bacteria 3666
155 Ga0453684_0292014 3300044712 Bacteria 1856
156 Ga0453684_0298707 3300044712 Bacteria 1831
157 Ga0495592_0000007 3300046454 Bacteria 180892
158 Ga0495629_0054079 3300046459 Bacteria 2808
159 Ga0495618_0020542 3300046514 Unclassified 4065
160 Ga0495618_0094649 3300046514 Unclassified 1910
161 Ga0495628_0000171 3300046516 Bacteria 56747
162 Ga0495628_0086613 3300046516 Bacteria 2429
163 Ga0495630_0000055 3300046517 Bacteria 91568
164 Ga0495630_0008134 3300046517 Bacteria 7534
165 Ga0495630_0009558 3300046517 Bacteria 6972
166 Ga0495666_0009131 3300046526 Bacteria 4961
167 Ga0495640_0035009 3300046533 Bacteria 3556
168 Ga0495640_0056968 3300046533 Bacteria 2668
169 Ga0495640_0098307 3300046533 Bacteria 1924
170 Ga0495586_0000098 3300046535 Bacteria 53179
171 Ga0495586_0000479 3300046535 Bacteria 23925
172 Ga0495586_0022110 3300046535 Bacteria 3394
173 Ga0495645_0000663 3300046543 Bacteria 23748
174 Ga0495634_0029950 3300046642 Bacteria 3763
175 Ga0495599_0021039 3300046678 Bacteria 4067
176 Ga0495647_0037329 3300046681 Bacteria 1833
177 Ga0495613_0013813 3300046689 Bacteria 5990
178 Ga0495600_0077710 3300046809 Bacteria 2168
179 Ga0495674_0002350 3300047319 Bacteria 18550
180 Ga0495674_0150265 3300047319 Bacteria 1953
181 Ga0495676_0024402 3300047321 Bacteria 5235
182 Ga0496101_0077572 3300048904 Bacteria 2448
183 Ga0496104_0035383 3300048907 Bacteria 4663
184 Ga0496107_0008207 3300048910 Bacteria 7222
185 Ga0496115_0008251 3300048918 Bacteria 7699
186 Ga0501031_0000292 3300049568 Bacteria 28530
187 Ga0501031_0015260 3300049568 Bacteria 4988
188 Ga0501033_0008437 3300049570 Bacteria 7980
189 Ga0501043_0124099 3300049579 Bacteria 2025
190 Ga0501035_0014806 3300049822 Bacteria 7199
191 Ga0501044_0000427 3300049823 Bacteria 52004
192 nmdc:mga06r32_96901_c1 3300050510 Bacteria 2889
193 Ga0500650_0003703 3300053098 Bacteria 5378
194 Ga0500555_000003 3300053103 Bacteria 392994
195 Ga0500616_0009000 3300053153 Bacteria 6116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10056170 Ga0265334_100561702 421
2 3300044712 Ga0453684_0298707 Ga0453684_0298707_517_1815 432
3 3300028558 Ga0265326_10022069 Ga0265326_100220692 438
4 3300046681 Ga0495647_0037329 Ga0495647_0037329_421_1818 446
5 3300048904 Ga0496101_0077572 Ga0496101_0077572_1086_2432 448
6 3300009094 Ga0111539_10077710 Ga0111539_100777103 466
7 3300005435 Ga0070714_100024398 Ga0070714_1000243986 474
8 3300009098 Ga0105245_10024167 Ga0105245_100241677 474
9 3300025929 Ga0207664_10042195 Ga0207664_100421953 474
10 3300048907 Ga0496104_0035383 Ga0496104_0035383_1693_3129 474
11 3300048910 Ga0496107_0008207 Ga0496107_0008207_1995_3431 474
12 3300006237 Ga0097621_100080303 Ga0097621_1000803032 475
13 3300046517 Ga0495630_0008134 Ga0495630_0008134_34_1491 476
14 3300013308 Ga0157375_10192030 Ga0157375_101920302 477
15 3300028556 Ga0265337_1003255 Ga0265337_10032552 480
16 3300046459 Ga0495629_0054079 Ga0495629_0054079_1297_2763 480
17 3300031247 Ga0265340_10058468 Ga0265340_100584681 482
18 3300047319 Ga0495674_0150265 Ga0495674_0150265_458_1912 484
19 3300009094 Ga0111539_10011282 Ga0111539_100112822 488
20 3300031728 Ga0316578_10053141 Ga0316578_100531411 489
21 3300005548 Ga0070665_100002012 Ga0070665_10000201230 490
22 3300028379 Ga0268266_10002327 Ga0268266_100023272 490
23 3300009545 Ga0105237_10086959 Ga0105237_100869592 492
24 3300031344 Ga0265316_10019757 Ga0265316_100197576 493
25 3300044712 Ga0453684_0292014 Ga0453684_0292014_264_1772 494
26 3300053103 Ga0500555_000003 Ga0500555_000003_356443_357963 494
27 3300053153 Ga0500616_0009000 Ga0500616_0009000_744_2264 494
28 3300005439 Ga0070711_100014521 Ga0070711_1000145212 495
29 3300005614 Ga0068856_100000696 Ga0068856_1000006965 495
30 3300025916 Ga0207663_10002805 Ga0207663_100028057 495
31 3300028556 Ga0265337_1001069 Ga0265337_10010695 495
32 3300028653 Ga0265323_10000411 Ga0265323_100004118 495
33 3300028666 Ga0265336_10000982 Ga0265336_100009829 495
34 3300028800 Ga0265338_10000008 Ga0265338_10000008394 495
35 3300028800 Ga0265338_10000216 Ga0265338_100002169 495
36 3300028800 Ga0265338_10000232 Ga0265338_100002323 495
37 3300028800 Ga0265338_10000309 Ga0265338_1000030958 495
38 3300028800 Ga0265338_10003803 Ga0265338_1000380311 495
39 3300028800 Ga0265338_10004887 Ga0265338_100048876 495
40 3300028800 Ga0265338_10021579 Ga0265338_100215795 495
41 3300029957 Ga0265324_10000814 Ga0265324_100008146 495
42 3300031240 Ga0265320_10000869 Ga0265320_1000086911 495
43 3300031240 Ga0265320_10001329 Ga0265320_100013297 495
44 3300031240 Ga0265320_10022163 Ga0265320_100221632 495
45 3300031344 Ga0265316_10060849 Ga0265316_100608492 495
46 3300031344 Ga0265316_10079414 Ga0265316_100794142 495
47 3300031712 Ga0265342_10100861 Ga0265342_101008611 495
48 3300006844 Ga0075428_100014333 Ga0075428_1000143334 496
49 3300044712 Ga0453684_0094986 Ga0453684_0094986_1307_2827 496
50 3300046533 Ga0495640_0098307 Ga0495640_0098307_285_1799 496
51 3300005330 Ga0070690_100010691 Ga0070690_1000106911 497
52 3300005330 Ga0070690_100036684 Ga0070690_1000366842 497
53 3300005340 Ga0070689_100085450 Ga0070689_1000854502 497
54 3300005444 Ga0070694_100017720 Ga0070694_1000177203 497
55 3300005549 Ga0070704_100021622 Ga0070704_1000216222 497
56 3300005563 Ga0068855_100189132 Ga0068855_1001891322 497
57 3300009551 Ga0105238_10009109 Ga0105238_100091092 497
58 3300009553 Ga0105249_10081945 Ga0105249_100819452 497
59 3300025924 Ga0207694_10039471 Ga0207694_100394714 497
60 3300025961 Ga0207712_10086191 Ga0207712_100861911 497
61 3300028556 Ga0265337_1000306 Ga0265337_100030629 497
62 3300028556 Ga0265337_1006240 Ga0265337_10062402 497
63 3300028556 Ga0265337_1009113 Ga0265337_10091132 497
64 3300028563 Ga0265319_1011061 Ga0265319_10110612 497
65 3300028573 Ga0265334_10018906 Ga0265334_100189062 497
66 3300028653 Ga0265323_10027587 Ga0265323_100275872 497
67 3300028666 Ga0265336_10017971 Ga0265336_100179712 497
68 3300028800 Ga0265338_10005012 Ga0265338_100050126 497
69 3300028800 Ga0265338_10009619 Ga0265338_100096196 497
70 3300028800 Ga0265338_10064894 Ga0265338_100648942 497
71 3300028800 Ga0265338_10084586 Ga0265338_100845861 497
72 3300031240 Ga0265320_10027448 Ga0265320_100274482 497
73 3300031240 Ga0265320_10027640 Ga0265320_100276402 497
74 3300031241 Ga0265325_10004051 Ga0265325_100040512 497
75 3300031249 Ga0265339_10023094 Ga0265339_100230942 497
76 3300031344 Ga0265316_10027247 Ga0265316_100272472 497
77 3300031595 Ga0265313_10001793 Ga0265313_100017936 497
78 3300031711 Ga0265314_10007327 Ga0265314_100073274 497
79 3300031711 Ga0265314_10025203 Ga0265314_100252034 497
80 3300031711 Ga0265314_10037497 Ga0265314_100374971 497
81 3300031712 Ga0265342_10038789 Ga0265342_100387892 497
82 3300034816 Ga0373930_0000444 Ga0373930_0000444_3711_5234 497
83 3300035112 Ga0373932_0000003 Ga0373932_0000003_271852_273375 497
84 3300035242 Ga0373962_0000069 Ga0373962_0000069_488_2011 497
85 3300035691 Ga0373931_0000063 Ga0373931_0000063_2024_3547 497
86 3300035695 Ga0373927_0025457 Ga0373927_0025457_93_1616 497
87 3300035695 Ga0373927_0035247 Ga0373927_0035247_522_2045 497
88 3300035725 Ga0373947_0040863 Ga0373947_0040863_818_2341 497
89 3300037068 Ga0373925_0000434 Ga0373925_0000434_35840_37363 497
90 3300046454 Ga0495592_0000007 Ga0495592_0000007_142548_144047 497
91 3300046514 Ga0495618_0020542 Ga0495618_0020542_704_2203 497
92 3300046516 Ga0495628_0000171 Ga0495628_0000171_46166_47665 497
93 3300046517 Ga0495630_0009558 Ga0495630_0009558_4690_6189 497
94 3300046533 Ga0495640_0056968 Ga0495640_0056968_556_2055 497
95 3300046535 Ga0495586_0000479 Ga0495586_0000479_11599_13098 497
96 3300046543 Ga0495645_0000663 Ga0495645_0000663_10358_11857 497
97 3300049568 Ga0501031_0000292 Ga0501031_0000292_14841_16343 497
98 3300049570 Ga0501033_0008437 Ga0501033_0008437_5565_7067 497
99 3300049579 Ga0501043_0124099 Ga0501043_0124099_262_1764 497
100 3300049822 Ga0501035_0014806 Ga0501035_0014806_68_1570 497
101 3300049823 Ga0501044_0000427 Ga0501044_0000427_27981_29483 497
102 3300005340 Ga0070689_100136422 Ga0070689_1001364221 498
103 3300005548 Ga0070665_100000064 Ga0070665_100000064100 498
104 3300005577 Ga0068857_100047097 Ga0068857_1000470974 498
105 3300005617 Ga0068859_100005397 Ga0068859_1000053976 498
106 3300005842 Ga0068858_100001509 Ga0068858_10000150916 498
107 3300006931 Ga0097620_100005397 Ga0097620_1000053976 498
108 3300009093 Ga0105240_10072069 Ga0105240_100720695 498
109 3300009177 Ga0105248_10050856 Ga0105248_100508564 498
110 3300026116 Ga0207674_10060005 Ga0207674_100600052 498
111 3300028379 Ga0268266_10000035 Ga0268266_10000035295 498
112 3300028563 Ga0265319_1000013 Ga0265319_100001329 498
113 3300028800 Ga0265338_10004027 Ga0265338_1000402712 498
114 3300028800 Ga0265338_10010806 Ga0265338_100108062 498
115 3300028800 Ga0265338_10102167 Ga0265338_101021671 498
116 3300030521 Ga0307511_10000819 Ga0307511_100008192 498
117 3300031247 Ga0265340_10012462 Ga0265340_100124622 498
118 3300031247 Ga0265340_10040311 Ga0265340_100403112 498
119 3300031595 Ga0265313_10002445 Ga0265313_100024454 498
120 3300031733 Ga0316577_10029460 Ga0316577_100294602 498
121 3300046535 Ga0495586_0022110 Ga0495586_0022110_1522_3099 498
122 3300046689 Ga0495613_0013813 Ga0495613_0013813_2823_4400 498
123 3300053098 Ga0500650_0003703 Ga0500650_0003703_1142_2674 498
124 3300005614 Ga0068856_100086199 Ga0068856_1000861993 499
125 3300009551 Ga0105238_10038678 Ga0105238_100386783 499
126 3300026078 Ga0207702_10016968 Ga0207702_100169683 499
127 3300029957 Ga0265324_10014648 Ga0265324_100146483 499
128 3300031665 Ga0316575_10000016 Ga0316575_1000001631 499
129 3300031728 Ga0316578_10115702 Ga0316578_101157021 499
130 3300032133 Ga0316583_10000261 Ga0316583_1000026112 499
131 3300035398 Ga0316574_0000099 Ga0316574_0000099_13962_15479 499
132 3300044712 Ga0453684_0007869 Ga0453684_0007869_8144_9673 499
133 3300046516 Ga0495628_0086613 Ga0495628_0086613_98_1621 499
134 3300046809 Ga0495600_0077710 Ga0495600_0077710_546_2069 499
135 iso_pu_bacteria 2740891818 2740990484 499
136 3300029957 Ga0265324_10000796 Ga0265324_1000079613 500
137 3300029957 Ga0265324_10011316 Ga0265324_100113162 500
138 3300029957 Ga0265324_10017651 Ga0265324_100176512 500
139 3300029957 Ga0265324_10020715 Ga0265324_100207152 500
140 3300031251 Ga0265327_10004622 Ga0265327_100046223 500
141 3300031665 Ga0316575_10005971 Ga0316575_100059713 500
142 3300031665 Ga0316575_10010182 Ga0316575_100101822 500
143 3300031691 Ga0316579_10016798 Ga0316579_100167982 500
144 3300031727 Ga0316576_10000853 Ga0316576_100008534 500
145 3300031727 Ga0316576_10103209 Ga0316576_101032092 500
146 3300031728 Ga0316578_10015894 Ga0316578_100158941 500
147 3300031733 Ga0316577_10010672 Ga0316577_100106725 500
148 3300031733 Ga0316577_10012400 Ga0316577_100124003 500
149 3300032137 Ga0316585_10002961 Ga0316585_100029612 500
150 3300032139 Ga0316580_10004180 Ga0316580_100041803 500
151 3300032168 Ga0316593_10003753 Ga0316593_100037532 500
152 3300035398 Ga0316574_0015839 Ga0316574_0015839_2201_3721 500
153 3300036647 Ga0316582_0021135 Ga0316582_0021135_1452_2972 500
154 3300036647 Ga0316582_0055493 Ga0316582_0055493_162_1682 500
155 3300036647 Ga0316582_0124873 Ga0316582_0124873_56_1576 500
156 3300036712 Ga0316584_0000098 Ga0316584_0000098_22134_23660 500
157 3300036712 Ga0316584_0003410 Ga0316584_0003410_662_2182 500
158 3300036712 Ga0316584_0116014 Ga0316584_0116014_396_1922 500
159 3300037588 Ga0316581_0004813 Ga0316581_0004813_1082_2602 500
160 3300046514 Ga0495618_0094649 Ga0495618_0094649_311_1837 500
161 3300046678 Ga0495599_0021039 Ga0495599_0021039_2509_4035 500
162 3300005841 Ga0068863_100118080 Ga0068863_1001180802 501
163 3300013308 Ga0157375_10000006 Ga0157375_1000000637 501
164 3300014325 Ga0163163_10000107 Ga0163163_1000010762 501
165 3300028800 Ga0265338_10011415 Ga0265338_100114159 501
166 3300028800 Ga0265338_10013253 Ga0265338_100132538 501
167 3300028800 Ga0265338_10016202 Ga0265338_100162026 501
168 3300031711 Ga0265314_10047563 Ga0265314_100475633 501
169 3300035170 Ga0373943_0019802 Ga0373943_0019802_514_2055 501
170 3300035692 Ga0373935_0039707 Ga0373935_0039707_935_2476 501
171 3300035695 Ga0373927_0002280 Ga0373927_0002280_3119_4660 501
172 3300035725 Ga0373947_0008692 Ga0373947_0008692_142_1683 501
173 3300036401 Ga0373937_0133136 Ga0373937_0133136_219_1751 501
174 3300037068 Ga0373925_0000396 Ga0373925_0000396_632_2173 501
175 3300042876 Ga0451577_0002728 Ga0451577_0002728_16573_18093 501
176 3300044712 Ga0453684_0006244 Ga0453684_0006244_4272_5792 501
177 3300046517 Ga0495630_0000055 Ga0495630_0000055_68213_69784 501
178 3300046526 Ga0495666_0009131 Ga0495666_0009131_2336_3877 501
179 3300046533 Ga0495640_0035009 Ga0495640_0035009_666_2237 501
180 3300046535 Ga0495586_0000098 Ga0495586_0000098_30035_31606 501
181 3300046642 Ga0495634_0029950 Ga0495634_0029950_1982_3553 501
182 3300047319 Ga0495674_0002350 Ga0495674_0002350_15475_17046 501
183 3300047321 Ga0495676_0024402 Ga0495676_0024402_1853_3424 501
184 3300049568 Ga0501031_0015260 Ga0501031_0015260_2511_4049 501
185 3300050510 nmdc:mga06r32_96901_c1 nmdc:mga06r32_96901_c1_490_2022 501
186 3300005458 Ga0070681_10150153 Ga0070681_101501532 502
187 3300003323 rootH1_10150376 rootH1_101503764 503
188 3300005435 Ga0070714_100003192 Ga0070714_1000031922 503
189 3300005458 Ga0070681_10005737 Ga0070681_100057377 503
190 3300005535 Ga0070684_100101524 Ga0070684_1001015241 503
191 3300013104 Ga0157370_10040685 Ga0157370_100406852 503
192 3300013296 Ga0157374_10136751 Ga0157374_101367512 503
193 3300025912 Ga0207707_10055923 Ga0207707_100559234 503
194 3300025929 Ga0207664_10006868 Ga0207664_100068682 503
195 3300028800 Ga0265338_10001302 Ga0265338_100013026 503
196 3300048918 Ga0496115_0008251 Ga0496115_0008251_1035_2576 503

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02602

HEM4

Uroporphyrinogen-III synthase HemD

291

522

0.97

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

8

218

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4d-assembly3.cif.gz_F crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9712 2 242
1s4d-assembly5.cif.gz_J crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9622 2 241
6pr0-assembly1.cif.gz_B p133h-s128a s. typhimurium siroheme synthase 0.9622 2 239
1s4d-assembly5.cif.gz_K crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9618 2 241
2ybq-assembly1.cif.gz_A-2 the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii 0.9599 1 236
ID Description Score Start End Superfamily
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.957 2 112 3.40.1010.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9561 2 112 3.40.1010.10
1s4dE01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9491 1 111 3.40.1010.10
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9407 116 239 3.30.950.10
1s4dH02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9405 112 239 3.30.950.10
ID Description Score Start End GO Terms
AF-A0A7K4NN19-F1-model_v4 Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) 0.9774 151 239 GO:0004851
GO:0019354
GO:0032259
AF-A0A7J4N8S3-F1-model_v4 Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) 0.9758 149 235 GO:0004851
GO:0019354
GO:0032259
AF-A0A7V1I0I9-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9746 2 273 GO:0004851
GO:0019354
GO:0032259
AF-A0A3A0AH43-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.97 1 239 GO:0004851
GO:0019354
GO:0032259
AF-A0A6H0IW50-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9696 2 239 GO:0004851
GO:0019354
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.4 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map