F301786

General Info

Members Datasets Scaffolds Average Seq Length
196 153 392 259

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10014356|Ga0307413_100143561
Length 288
Sequence MSTVTSSSPTDTQTAGVDRPVAAEAIAAVLAPAARPPRPGALSTSLTFGWRAILKIKHVPEQLFDVTAFPIIMTLMFTYLFGGALAGSTREYLQFLLPGIMVTSVVMITMYTGIGVNTDIEKGVFDRFRTLPIWRPSALVGAIFGDVLRYVLAATTIMIVGLVLGFRPAGGVLGVLAGVGLLVVFSFAFSWIWTMFGLFLRSEKSVMGVSMLVLFPLTFLSNVFVQPETMPGWLQAFVEVNPITHLVAAVRALMAGAPDGFEITWVLVASAVIVAVFGTLTMRLYNRK

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
78 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
123 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
124 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
125 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
126 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
127 2808606394 Promicromonospora sp. C35 Isolate Unclassified
128 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
129 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
130 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
131 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
132 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
133 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
134 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
135 2858882152 Micromonospora noduli MED15 Isolate Nodule
136 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
137 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
138 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
139 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
140 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
141 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
142 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
143 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
144 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
145 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
146 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
147 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
148 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
149 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
150 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
151 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
152 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
153 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0
Isolates 16.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 7.65
Nodule 1.02
Rhizoplane 2.55
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10014356 3300031824 Bacteria 4019
2 JGI25406J46586_10015564 3300003203 Bacteria 3203
3 JGI25407J50210_10015821 3300003373 Bacteria 1950
4 Ga0070683_100052392 3300005329 Bacteria 3780
5 Ga0070683_100289258 3300005329 Bacteria 1559
6 Ga0070659_100008093 3300005366 Bacteria 7667
7 Ga0070667_100082105 3300005367 Bacteria 2759
8 Ga0070710_10162584 3300005437 Bacteria 1386
9 Ga0070710_10276559 3300005437 Bacteria 1088
10 Ga0070694_100000015 3300005444 Bacteria 77125
11 Ga0070685_10014519 3300005466 Bacteria 4175
12 Ga0070684_100027841 3300005535 Bacteria 4774
13 Ga0068853_100017251 3300005539 Bacteria 5958
14 Ga0070672_100020949 3300005543 Bacteria 4778
15 Ga0070672_100249728 3300005543 Bacteria 1494
16 Ga0068855_100004021 3300005563 Bacteria 17952
17 Ga0068855_100022747 3300005563 Bacteria 7512
18 Ga0068855_100313319 3300005563 Bacteria 1736
19 Ga0068857_100000943 3300005577 Bacteria 22140
20 Ga0068856_100038908 3300005614 Bacteria 4669
21 Ga0068856_100588902 3300005614 Bacteria 1133
22 Ga0068856_101073949 3300005614 Bacteria 823
23 Ga0068852_100014462 3300005616 Bacteria 6078
24 Ga0068859_100035694 3300005617 Bacteria 4989
25 Ga0068851_10000003 3300005834 Bacteria 293018
26 Ga0081455_10147636 3300005937 Bacteria 1816
27 Ga0081538_10001504 3300005981 Bacteria 23920
28 Ga0081538_10009505 3300005981 Bacteria 8104
29 Ga0081539_10000516 3300005985 Bacteria 80445
30 Ga0081539_10004503 3300005985 Bacteria 15323
31 Ga0075365_10022816 3300006038 Bacteria 3927
32 Ga0075368_10045315 3300006042 Bacteria 1737
33 Ga0075362_10072813 3300006177 Bacteria 1572
34 Ga0075370_10131874 3300006353 Bacteria 1458
35 Ga0075428_100002660 3300006844 Bacteria 19407
36 Ga0075428_100064078 3300006844 Bacteria 4025
37 Ga0097620_100035694 3300006931 Bacteria 4989
38 Ga0105240_10004319 3300009093 Bacteria 21696
39 Ga0105240_10324229 3300009093 Bacteria 1754
40 Ga0111539_10641735 3300009094 Bacteria 1236
41 Ga0105245_10045254 3300009098 Bacteria 3930
42 Ga0105245_10063758 3300009098 Bacteria 3328
43 Ga0114129_10000402 3300009147 Bacteria 50689
44 Ga0114129_10111913 3300009147 Bacteria 3766
45 Ga0105243_10001007 3300009148 Bacteria 26043
46 Ga0105248_10031673 3300009177 Bacteria 5907
47 Ga0105237_10000131 3300009545 Bacteria 105010
48 Ga0105237_10016784 3300009545 Bacteria 7601
49 Ga0105238_10100776 3300009551 Bacteria 2871
50 Ga0105239_10115826 3300010375 Bacteria 2973
51 Ga0163163_10186825 3300014325 Bacteria 2120
52 Ga0157379_10037508 3300014968 Bacteria 4322
53 Ga0209148_1000828 3300025254 Bacteria 22166
54 Ga0207656_10000002 3300025321 Bacteria 792178
55 Ga0207692_10184819 3300025898 Bacteria 1216
56 Ga0207692_10264786 3300025898 Bacteria 1035
57 Ga0207710_10055612 3300025900 Bacteria 1784
58 Ga0207688_10024581 3300025901 Bacteria 3305
59 Ga0207645_10218474 3300025907 Bacteria 1256
60 Ga0207654_10000001 3300025911 Bacteria 1816198
61 Ga0207695_10001590 3300025913 Bacteria 36878
62 Ga0207695_10050329 3300025913 Bacteria 4384
63 Ga0207671_10000002 3300025914 Bacteria 1144816
64 Ga0207671_10016018 3300025914 Bacteria 5842
65 Ga0207657_10005029 3300025919 Bacteria 13872
66 Ga0207681_10709209 3300025923 Bacteria 837
67 Ga0207694_10000092 3300025924 Bacteria 100605
68 Ga0207694_10097284 3300025924 Bacteria 2329
69 Ga0207687_10031239 3300025927 Bacteria 3598
70 Ga0207687_10036306 3300025927 Bacteria 3357
71 Ga0207664_10185369 3300025929 Bacteria 1789
72 Ga0207644_10150110 3300025931 Bacteria 1803
73 Ga0207690_10022045 3300025932 Bacteria 3957
74 Ga0207709_10053332 3300025935 Bacteria 2488
75 Ga0207691_10027759 3300025940 Bacteria 5305
76 Ga0207711_10121214 3300025941 Bacteria 2335
77 Ga0207679_10224231 3300025945 Bacteria 1583
78 Ga0207667_10004049 3300025949 Bacteria 18003
79 Ga0207667_10020838 3300025949 Bacteria 7279
80 Ga0207667_10186549 3300025949 Bacteria 2129
81 Ga0207702_10039504 3300026078 Bacteria 3954
82 Ga0207675_100617399 3300026118 Bacteria 1088
83 Ga0207698_10000277 3300026142 Bacteria 31170
84 Ga0307515_10001173 3300028794 Bacteria 59934
85 Ga0307515_10059669 3300028794 Bacteria 5461
86 Ga0307515_10171619 3300028794 Bacteria 2159
87 Ga0307512_10003431 3300030522 Bacteria 18469
88 Ga0307513_10000123 3300031456 Bacteria 108854
89 Ga0307513_10065622 3300031456 Bacteria 3819
90 Ga0307408_100400261 3300031548 Bacteria 1179
91 Ga0307514_10118175 3300031649 Bacteria 1858
92 Ga0307409_100117397 3300031995 Bacteria 2245
93 Ga0307409_100316819 3300031995 Bacteria 1458
94 Ga0307415_100149978 3300032126 Bacteria 1793
95 Ga0307415_100382938 3300032126 Bacteria 1195
96 Ga0373951_0000222 3300035091 Bacteria 19755
97 Ga0373941_0083404 3300035115 Bacteria 1083
98 Ga0373941_0102209 3300035115 Bacteria 999
99 Ga0373946_0061976 3300035171 Bacteria 1594
100 Ga0373955_0062749 3300035172 Bacteria 2056
101 Ga0395900_0045473 3300037418 Bacteria 4522
102 Ga0395898_0052139 3300037466 Bacteria 3997
103 Ga0451791_0757525 3300041451 Bacteria 1192
104 Ga0451791_0807488 3300041451 Bacteria 1014
105 Ga0451791_1332823 3300041451 Bacteria 1008
106 Ga0451795_0881777 3300041456 Bacteria 1649
107 Ga0451833_1297516 3300041491 Bacteria 1304
108 Ga0466963_0126732 3300044694 Bacteria 1760
109 Ga0466963_0167434 3300044694 Bacteria 1531
110 Ga0466963_0345694 3300044694 Bacteria 1047
111 Ga0466963_0383244 3300044694 Bacteria 991
112 Ga0466964_0155197 3300044706 Bacteria 1065
113 Ga0466971_0018351 3300044719 Bacteria 3098
114 Ga0466971_0186091 3300044719 Bacteria 977
115 Ga0466967_0056267 3300045976 Bacteria 3467
116 Ga0466967_0236053 3300045976 Bacteria 1742
117 Ga0466967_0289122 3300045976 Bacteria 1574
118 Ga0495627_053295 3300046453 Bacteria 1211
119 Ga0495629_0192128 3300046459 Bacteria 1413
120 Ga0495651_0371854 3300046462 Bacteria 939
121 Ga0495650_0001330 3300046471 Bacteria 24757
122 Ga0495665_0053403 3300046531 Bacteria 2137
123 Ga0495581_0016859 3300047315 Bacteria 4247
124 Ga0495581_0196941 3300047315 Bacteria 1178
125 Ga0495674_0024379 3300047319 Bacteria 5559
126 Ga0496110_0018557 3300048913 Bacteria 5834
127 Ga0496118_0017672 3300048921 Bacteria 6477
128 Ga0496118_0249996 3300048921 Bacteria 1008
129 Ga0496119_0004811 3300048922 Bacteria 13245
130 Ga0496120_0000655 3300048923 Bacteria 50898
131 Ga0496120_0004978 3300048923 Bacteria 10796
132 Ga0496120_0046369 3300048923 Bacteria 2512
133 Ga0496121_0000277 3300048924 Bacteria 107014
134 Ga0496122_0000360 3300048925 Bacteria 97913
135 Ga0496123_0002859 3300048926 Bacteria 20356
136 Ga0501032_0221509 3300049569 Bacteria 1231
137 Ga0501034_0181101 3300049571 Bacteria 2072
138 Ga0501036_0526136 3300049572 Bacteria 983
139 Ga0501037_0117862 3300049573 Bacteria 1910
140 Ga0501038_0181729 3300049574 Bacteria 1697
141 Ga0501042_0233853 3300049578 Bacteria 1326
142 Ga0501043_0284103 3300049579 Bacteria 1268
143 Ga0501047_0001409 3300049581 Bacteria 23584
144 Ga0501047_0087033 3300049581 Bacteria 3002
145 Ga0501070_0396601 3300049586 Bacteria 1116
146 Ga0501079_0018992 3300049741 Bacteria 5252
147 Ga0501080_0096915 3300049742 Bacteria 2739
148 Ga0501035_0023040 3300049822 Bacteria 5715
149 Ga0501044_0027058 3300049823 Bacteria 6067
150 nmdc:mga0yw44_113739_c1 3300050492 Bacteria 1736
151 nmdc:mga0yw44_5194_c1 3300050492 Bacteria 6105
152 nmdc:mga06z11_15116_c1 3300050494 Bacteria 3437
153 nmdc:mga05p37_270_c1 3300050507 Bacteria 53882
154 nmdc:mga09592_27_c1 3300050508 Bacteria 84251
155 nmdc:mga0qj67_24_c1 3300050509 Bacteria 106844
156 nmdc:mga06r32_99_c1 3300050510 Bacteria 61063
157 Ga0500651_0028601 3300053093 Bacteria 3505
158 Ga0500559_0005796 3300053136 Bacteria 5633
159 Ga0500559_0251776 3300053136 Bacteria 832
160 Ga0500573_0006685 3300053140 Bacteria 6255
161 Ga0500573_0011741 3300053140 Bacteria 4909
162 Ga0500577_0048251 3300053142 Bacteria 1587
163 Ga0500616_0006439 3300053153 Bacteria 7689
164 Ga0466962_0061804 3300061719 Bacteria 1788
165 2515494470 2515154088 Bacteria 5526283
166 2676486523 2675903059 Bacteria 8644972
167 2739608194 2739367654 Bacteria 6049412
168 2760303832 2758568522 Bacteria 5953541
169 2791914199 2791354901 Bacteria 8322202
170 2809027078 2808606394 Bacteria 6248540
171 2837184919 2837183177 Bacteria 4637169
172 2837269196 2837268691 Bacteria 7850704
173 2852645687 2852643534 Bacteria 3013378
174 2855671354 2855670206 Bacteria 7120389
175 2855678516 2855676851 Bacteria 7063653
176 2857292051 2857288857 Bacteria 7189066
177 2858850837 2858848962 Bacteria 6963058
178 2858883789 2858882152 Bacteria 7230291
179 2858894104 2858888857 Bacteria 7060307
180 2858900992 2858895516 Bacteria 7378898
181 2861522619 2861520306 Bacteria 8348283
182 2869051050 2869048445 Bacteria 6875584
183 2869062490 2869061728 Bacteria 7112407
184 2869070862 2869068681 Bacteria 7205615
185 2870623785 2870622029 Bacteria 3643329
186 2870723772 2870721527 Bacteria 9689237
187 2880498951 2880495981 Bacteria 7340502
188 2884703946 2884693830 Bacteria 11273186
189 2887479241 2887478801 Bacteria 8972725
190 2946079173 2946072368 Bacteria 8999607
191 2984525657 2984523437 Bacteria 4508481
192 2990088459 2990088156 Bacteria 6657676
193 8003871389 8003870546 Bacteria 7396674
194 8056214888 8056207758 Bacteria 8639239
195 8056580948 8056579771 Bacteria 5840325
196 8056672775 8056667051 Bacteria 6953971
197 Ga0307413_10014356
198 JGI25406J46586_10015564
199 JGI25407J50210_10015821
200 Ga0070683_100052392
201 Ga0070683_100289258
202 Ga0070659_100008093
203 Ga0070667_100082105
204 Ga0070710_10162584
205 Ga0070710_10276559
206 Ga0070694_100000015
207 Ga0070685_10014519
208 Ga0070684_100027841
209 Ga0068853_100017251
210 Ga0070672_100020949
211 Ga0070672_100249728
212 Ga0068855_100004021
213 Ga0068855_100022747
214 Ga0068855_100313319
215 Ga0068857_100000943
216 Ga0068856_100038908
217 Ga0068856_100588902
218 Ga0068856_101073949
219 Ga0068852_100014462
220 Ga0068859_100035694
221 Ga0068851_10000003
222 Ga0081455_10147636
223 Ga0081538_10001504
224 Ga0081538_10009505
225 Ga0081539_10000516
226 Ga0081539_10004503
227 Ga0075365_10022816
228 Ga0075368_10045315
229 Ga0075362_10072813
230 Ga0075370_10131874
231 Ga0075428_100002660
232 Ga0075428_100064078
233 Ga0097620_100035694
234 Ga0105240_10004319
235 Ga0105240_10324229
236 Ga0111539_10641735
237 Ga0105245_10045254
238 Ga0105245_10063758
239 Ga0114129_10000402
240 Ga0114129_10111913
241 Ga0105243_10001007
242 Ga0105248_10031673
243 Ga0105237_10000131
244 Ga0105237_10016784
245 Ga0105238_10100776
246 Ga0105239_10115826
247 Ga0163163_10186825
248 Ga0157379_10037508
249 Ga0209148_1000828
250 Ga0207656_10000002
251 Ga0207692_10184819
252 Ga0207692_10264786
253 Ga0207710_10055612
254 Ga0207688_10024581
255 Ga0207645_10218474
256 Ga0207654_10000001
257 Ga0207695_10001590
258 Ga0207695_10050329
259 Ga0207671_10000002
260 Ga0207671_10016018
261 Ga0207657_10005029
262 Ga0207681_10709209
263 Ga0207694_10000092
264 Ga0207694_10097284
265 Ga0207687_10031239
266 Ga0207687_10036306
267 Ga0207664_10185369
268 Ga0207644_10150110
269 Ga0207690_10022045
270 Ga0207709_10053332
271 Ga0207691_10027759
272 Ga0207711_10121214
273 Ga0207679_10224231
274 Ga0207667_10004049
275 Ga0207667_10020838
276 Ga0207667_10186549
277 Ga0207702_10039504
278 Ga0207675_100617399
279 Ga0207698_10000277
280 Ga0307515_10001173
281 Ga0307515_10059669
282 Ga0307515_10171619
283 Ga0307512_10003431
284 Ga0307513_10000123
285 Ga0307513_10065622
286 Ga0307408_100400261
287 Ga0307514_10118175
288 Ga0307409_100117397
289 Ga0307409_100316819
290 Ga0307415_100149978
291 Ga0307415_100382938
292 Ga0373951_0000222
293 Ga0373941_0083404
294 Ga0373941_0102209
295 Ga0373946_0061976
296 Ga0373955_0062749
297 Ga0395900_0045473
298 Ga0395898_0052139
299 Ga0451791_0757525
300 Ga0451791_0807488
301 Ga0451791_1332823
302 Ga0451795_0881777
303 Ga0451833_1297516
304 Ga0466963_0126732
305 Ga0466963_0167434
306 Ga0466963_0345694
307 Ga0466963_0383244
308 Ga0466964_0155197
309 Ga0466971_0018351
310 Ga0466971_0186091
311 Ga0466967_0056267
312 Ga0466967_0236053
313 Ga0466967_0289122
314 Ga0495627_053295
315 Ga0495629_0192128
316 Ga0495651_0371854
317 Ga0495650_0001330
318 Ga0495665_0053403
319 Ga0495581_0016859
320 Ga0495581_0196941
321 Ga0495674_0024379
322 Ga0496110_0018557
323 Ga0496118_0017672
324 Ga0496118_0249996
325 Ga0496119_0004811
326 Ga0496120_0000655
327 Ga0496120_0004978
328 Ga0496120_0046369
329 Ga0496121_0000277
330 Ga0496122_0000360
331 Ga0496123_0002859
332 Ga0501032_0221509
333 Ga0501034_0181101
334 Ga0501036_0526136
335 Ga0501037_0117862
336 Ga0501038_0181729
337 Ga0501042_0233853
338 Ga0501043_0284103
339 Ga0501047_0001409
340 Ga0501047_0087033
341 Ga0501070_0396601
342 Ga0501079_0018992
343 Ga0501080_0096915
344 Ga0501035_0023040
345 Ga0501044_0027058
346 nmdc:mga0yw44_113739_c1
347 nmdc:mga0yw44_5194_c1
348 nmdc:mga06z11_15116_c1
349 nmdc:mga05p37_270_c1
350 nmdc:mga09592_27_c1
351 nmdc:mga0qj67_24_c1
352 nmdc:mga06r32_99_c1
353 Ga0500651_0028601
354 Ga0500559_0005796
355 Ga0500559_0251776
356 Ga0500573_0006685
357 Ga0500573_0011741
358 Ga0500577_0048251
359 Ga0500616_0006439
360 Ga0466962_0061804
361 2515494470
362 2676486523
363 2739608194
364 2760303832
365 2791914199
366 2809027078
367 2837184919
368 2837269196
369 2852645687
370 2855671354
371 2855678516
372 2857292051
373 2858850837
374 2858883789
375 2858894104
376 2858900992
377 2861522619
378 2869051050
379 2869062490
380 2869070862
381 2870623785
382 2870723772
383 2880498951
384 2884703946
385 2887479241
386 2946079173
387 2984525657
388 2990088459
389 8003871389
390 8056214888
391 8056580948
392 8056672775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

45

255

0.93

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

51

283

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.6833 32 226
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.6523 36 226
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.6488 32 225
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.6471 36 226
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.644 32 226
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7881 86 247 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7861 86 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7738 84 257 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5398 84 257 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5378 86 254 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A127SX38-F1-model_v4 ABC2_membrane 0.9267 84 260 GO:0016020
GO:0140359
AF-A0A7L5ASJ5-F1-model_v4 Transport permease protein 0.9203 41 259 GO:0043190
GO:0140359
AF-A0A1E2RXS6-F1-model_v4 Daunorubicin/doxorubicin resistance ABC transporter permease protein DrrB 0.919 89 260 GO:0016020
GO:0140359
AF-A0A7X7CWJ3-F1-model_v4 Transport permease protein 0.9181 27 260 GO:0043190
GO:0140359
AF-A0A0F5VLK1-F1-model_v4 Transport permease protein 0.9181 33 259 GO:0043190
GO:0140359

Map