F301882

General Info

Members Datasets Scaffolds Average Seq Length
196 147 196 166

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1186072|Ga0436363_1186072_48_623
Length 191
Sequence MPPKPKVPGLIKGLGVTFKEMTKTMFPNEGLKKLVPAPSKGAHTVQYPHVKEAPPTRARGVIALLEENCTVCMLCVRSCPDWCIYIEGHKYKAPPRREGGKPRTVSALDRFDIDYALCMYCGICVEVCPFDALFWSPEYEYSEINIADLLHDKTRLGEWMDTVPEPPAAEAGSEVKTKKYASPAAARAKNK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
88 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.69
Nodule 0
Rhizoplane 7.65
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100856571 3300005329 Bacteria 872
2 Ga0070687_100395507 3300005343 Bacteria 905
3 Ga0070687_100528751 3300005343 Bacteria 799
4 Ga0070661_100906983 3300005344 Bacteria 728
5 Ga0070688_100617192 3300005365 Bacteria 832
6 Ga0070701_10144077 3300005438 Bacteria 1366
7 Ga0070705_100281566 3300005440 Bacteria 1182
8 Ga0070700_100037094 3300005441 Bacteria 2962
9 Ga0070708_100017962 3300005445 Bacteria 5914
10 Ga0070708_100493763 3300005445 Bacteria 1155
11 Ga0070681_10401151 3300005458 Bacteria 1283
12 Ga0068867_100765985 3300005459 Bacteria 858
13 Ga0070707_101385644 3300005468 Bacteria 670
14 Ga0070698_101235620 3300005471 Bacteria 697
15 Ga0070695_100088837 3300005545 Bacteria 2059
16 Ga0070695_100434080 3300005545 Bacteria 1003
17 Ga0070693_100370774 3300005547 Bacteria 985
18 Ga0070665_101138788 3300005548 Bacteria 791
19 Ga0068861_100346878 3300005719 Bacteria 1301
20 Ga0068860_100006205 3300005843 Bacteria 12016
21 Ga0075365_10436455 3300006038 Bacteria 925
22 Ga0075363_100065362 3300006048 Bacteria 1967
23 Ga0075364_10314294 3300006051 Bacteria 1067
24 Ga0075362_10208350 3300006177 Bacteria 953
25 Ga0075367_10175192 3300006178 Bacteria 1336
26 Ga0075367_10315621 3300006178 Bacteria 985
27 Ga0075367_10391455 3300006178 Bacteria 879
28 Ga0097621_100277037 3300006237 Bacteria 1476
29 Ga0075370_10214457 3300006353 Bacteria 1137
30 Ga0075428_102257372 3300006844 Bacteria 561
31 Ga0111539_10242892 3300009094 Bacteria 2096
32 Ga0105245_10022572 3300009098 Bacteria 5524
33 Ga0105245_10023564 3300009098 Bacteria 5403
34 Ga0105245_10272687 3300009098 Bacteria 1651
35 Ga0105245_10604515 3300009098 Bacteria 1123
36 Ga0114129_12827613 3300009147 Bacteria 576
37 Ga0105243_10569158 3300009148 Bacteria 1086
38 Ga0105241_10042483 3300009174 Bacteria 3440
39 Ga0105237_10665766 3300009545 Bacteria 1048
40 Ga0105249_10720762 3300009553 Bacteria 1058
41 Ga0105249_10737055 3300009553 Bacteria 1047
42 Ga0105249_11122295 3300009553 Bacteria 857
43 Ga0157371_10505970 3300013102 Bacteria 892
44 Ga0157374_10653016 3300013296 Bacteria 1064
45 Ga0157378_10115778 3300013297 Bacteria 2464
46 Ga0157378_10217631 3300013297 Bacteria 1814
47 Ga0157378_10228500 3300013297 Bacteria 1772
48 Ga0157375_11013136 3300013308 Bacteria 970
49 Ga0157377_10408145 3300014745 Bacteria 927
50 Ga0157379_10973603 3300014968 Bacteria 808
51 Ga0157379_11349216 3300014968 Bacteria 690
52 Ga0163161_10454160 3300017792 Bacteria 1036
53 Ga0207705_11166389 3300025909 Bacteria 592
54 Ga0207654_10286392 3300025911 Bacteria 1116
55 Ga0207707_10149090 3300025912 Bacteria 2045
56 Ga0207707_10594728 3300025912 Bacteria 937
57 Ga0207663_10348028 3300025916 Bacteria 1121
58 Ga0207652_11786930 3300025921 Bacteria 520
59 Ga0207646_10791242 3300025922 Bacteria 845
60 Ga0207687_10021549 3300025927 Bacteria 4283
61 Ga0207706_10693713 3300025933 Bacteria 870
62 Ga0207670_10392603 3300025936 Bacteria 1108
63 Ga0207711_10562154 3300025941 Bacteria 1064
64 Ga0207661_11055807 3300025944 Bacteria 748
65 Ga0207712_10560597 3300025961 Bacteria 984
66 Ga0207678_10900180 3300026067 Bacteria 782
67 Ga0207708_10101782 3300026075 Bacteria 2224
68 Ga0207648_10159947 3300026089 Bacteria 1989
69 Ga0207675_100113351 3300026118 Bacteria 2560
70 Ga0207675_100541751 3300026118 Bacteria 1162
71 Ga0207675_101480301 3300026118 Bacteria 700
72 Ga0207428_11234964 3300027907 Bacteria 519
73 Ga0268264_10038286 3300028381 Bacteria 3957
74 Ga0265325_10217311 3300031241 Bacteria 876
75 Ga0265327_10003642 3300031251 Bacteria 14492
76 Ga0265327_10219790 3300031251 Bacteria 855
77 Ga0316579_10046460 3300031691 Bacteria 2026
78 Ga0265342_10138383 3300031712 Bacteria 1360
79 Ga0316576_10001293 3300031727 Bacteria 13302
80 Ga0316578_10031602 3300031728 Bacteria 3018
81 Ga0316577_10000860 3300031733 Bacteria 13288
82 Ga0307406_10182197 3300031901 Bacteria 1530
83 Ga0307407_10211043 3300031903 Bacteria 1307
84 Ga0307409_100017516 3300031995 Bacteria 4779
85 Ga0307411_10215393 3300032005 Bacteria 1486
86 Ga0307415_100051287 3300032126 Bacteria 2799
87 Ga0307415_101060530 3300032126 Bacteria 756
88 Ga0316585_10034877 3300032137 Bacteria 1592
89 Ga0373941_0159780 3300035115 Bacteria 833
90 Ga0373943_0045187 3300035170 Bacteria 2146
91 Ga0373946_0155503 3300035171 Bacteria 1070
92 Ga0316574_0002541 3300035398 Bacteria 9176
93 Ga0316574_0129409 3300035398 Bacteria 1624
94 Ga0316574_0214872 3300035398 Bacteria 1233
95 Ga0373935_0150258 3300035692 Bacteria 1580
96 Ga0373927_0044813 3300035695 Bacteria 2862
97 Ga0373947_0244874 3300035725 Bacteria 1184
98 Ga0373937_0190693 3300036401 Bacteria 1926
99 Ga0316582_0059075 3300036647 Bacteria 2454
100 Ga0316584_0000507 3300036712 Bacteria 20573
101 Ga0316584_0072756 3300036712 Bacteria 2576
102 Ga0316584_0164507 3300036712 Bacteria 1647
103 Ga0400483_045014 3300039062 Bacteria 6101
104 Ga0436365_0354478 3300039437 Bacteria 716
105 Ga0436365_1205939 3300039437 Bacteria 1981
106 Ga0436365_1308611 3300039437 Bacteria 596
107 Ga0436365_1723786 3300039437 Bacteria 5166
108 Ga0436360_0030020 3300039438 Bacteria 723
109 Ga0436360_0191392 3300039438 Bacteria 652
110 Ga0436360_0353664 3300039438 Bacteria 796
111 Ga0436363_1186072 3300039450 Bacteria 641
112 Ga0436362_0426280 3300039453 Bacteria 891
113 Ga0436362_1082493 3300039453 Bacteria 736
114 Ga0436362_1184616 3300039453 Bacteria 5053
115 Ga0439465_0203427 3300041413 Bacteria 722
116 Ga0451791_1577216 3300041451 Bacteria 1159
117 Ga0451835_0200535 3300041492 Bacteria 590
118 Ga0439446_0093291 3300042156 Bacteria 945
119 Ga0451577_0001387 3300042876 Bacteria 32416
120 Ga0453684_0003331 3300044712 Bacteria 36455
121 Ga0466960_0172873 3300044901 Bacteria 1167
122 Ga0466967_1083303 3300045976 Bacteria 798
123 Ga0495629_0162976 3300046459 Bacteria 1549
124 Ga0495629_0263868 3300046459 Bacteria 1183
125 Ga0495582_0418290 3300046473 Bacteria 773
126 Ga0495630_0132509 3300046517 Bacteria 1893
127 Ga0495630_0209185 3300046517 Bacteria 1489
128 Ga0495666_0194377 3300046526 Bacteria 934
129 Ga0495665_0143785 3300046531 Bacteria 1246
130 Ga0495640_0111478 3300046533 Bacteria 1788
131 Ga0495621_0055107 3300046539 Bacteria 1430
132 Ga0495634_0177609 3300046642 Bacteria 1335
133 Ga0495588_0452772 3300046674 Bacteria 673
134 Ga0495658_0208881 3300046683 Bacteria 1219
135 Ga0495613_0000685 3300046689 Bacteria 26812
136 Ga0495613_0304678 3300046689 Bacteria 1102
137 Ga0495624_0237717 3300046690 Bacteria 1103
138 Ga0495674_0273633 3300047319 Bacteria 1385
139 Ga0495676_0338160 3300047321 Bacteria 1008
140 Ga0495676_0639842 3300047321 Bacteria 691
141 Ga0495680_0121145 3300047322 Bacteria 1931
142 Ga0495680_0305630 3300047322 Bacteria 1116
143 Ga0495680_0460514 3300047322 Bacteria 869
144 Ga0495680_0537906 3300047322 Bacteria 789
145 Ga0495684_0113444 3300047471 Bacteria 2044
146 Ga0495593_0327953 3300047673 Bacteria 765
147 Ga0496100_1108970 3300048903 Bacteria 624
148 Ga0496102_0325835 3300048905 Bacteria 1447
149 Ga0496105_0096994 3300048908 Bacteria 2435
150 Ga0496108_0113522 3300048911 Bacteria 2318
151 Ga0496108_0358891 3300048911 Bacteria 1272
152 Ga0496109_0004708 3300048912 Bacteria 11390
153 Ga0496109_1770413 3300048912 Bacteria 551
154 Ga0496110_0004705 3300048913 Bacteria 10615
155 Ga0496110_0235224 3300048913 Bacteria 1667
156 Ga0496111_0260365 3300048914 Bacteria 1287
157 Ga0496112_0003736 3300048915 Bacteria 12712
158 Ga0496112_0110476 3300048915 Bacteria 2719
159 Ga0496114_0083554 3300048917 Bacteria 2702
160 Ga0496114_0262290 3300048917 Bacteria 1521
161 Ga0501033_0000587 3300049570 Bacteria 33655
162 Ga0501038_0391253 3300049574 Bacteria 1077
163 Ga0501040_0048900 3300049576 Bacteria 2891
164 Ga0501069_0083587 3300049585 Bacteria 1800
165 Ga0501069_0483322 3300049585 Bacteria 738
166 Ga0501071_0082096 3300049587 Bacteria 2360
167 Ga0501072_0001973 3300049588 Bacteria 15290
168 Ga0501072_0100115 3300049588 Bacteria 2304
169 Ga0501072_0269405 3300049588 Bacteria 1355
170 Ga0501073_0131497 3300049589 Bacteria 1735
171 Ga0501074_0328645 3300049590 Bacteria 1085
172 Ga0501076_0113805 3300049592 Bacteria 2189
173 Ga0501080_0181034 3300049742 Bacteria 1939
174 Ga0501080_0587743 3300049742 Bacteria 989
175 Ga0501044_0003952 3300049823 Bacteria 16601
176 Ga0501045_0082699 3300049824 Bacteria 2368
177 nmdc:mga03683_195213_c1 3300050489 Bacteria 927
178 nmdc:mga00v17_1356_c1 3300050491 Bacteria 12814
179 nmdc:mga0yw44_111212_c2 3300050492 Bacteria 1227
180 nmdc:mga06z11_142508_c1 3300050494 Bacteria 1356
181 nmdc:mga06z11_196332_c1 3300050494 Bacteria 1170
182 nmdc:mga06z11_43820_c2 3300050494 Bacteria 1380
183 nmdc:mga04h51_187316_c1 3300050495 Bacteria 808
184 nmdc:mga07m45_243587_c1 3300050496 Bacteria 1046
185 nmdc:mga05p37_1858050_c1 3300050507 Bacteria 578
186 nmdc:mga08y16_94273_c1 3300050511 Bacteria 3118
187 nmdc:mga0n895_288296_c1 3300050512 Bacteria 1664
188 nmdc:mga0n895_55236_c1 3300050512 Bacteria 3908
189 Ga0500646_0087860 3300053090 Unclassified 958
190 Ga0500641_0015415 3300053096 Unclassified 2836
191 Ga0500604_0077162 3300053151 Bacteria 1071
192 Ga0501084_0000009 3300054114 Bacteria 194961
193 Ga0501084_0969790 3300054114 Bacteria 715
194 Ga0587115_075975 3300059626 Bacteria 588
195 Ga0587069_048426 3300059642 Bacteria 749
196 Ga0501082_0027672 3300060353 Bacteria 4880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100113351 Ga0207675_1001133512 140
2 3300049576 Ga0501040_0048900 Ga0501040_0048900_99_647 140
3 3300039437 Ga0436365_1308611 Ga0436365_1308611_27_497 146
4 3300053096 Ga0500641_0015415 Ga0500641_0015415_1743_2312 146
5 3300005545 Ga0070695_100088837 Ga0070695_1000888373 147
6 3300009098 Ga0105245_10022572 Ga0105245_100225721 147
7 3300013297 Ga0157378_10217631 Ga0157378_102176312 147
8 3300017792 Ga0163161_10454160 Ga0163161_104541602 147
9 3300025916 Ga0207663_10348028 Ga0207663_103480282 147
10 3300025922 Ga0207646_10791242 Ga0207646_107912422 147
11 3300025927 Ga0207687_10021549 Ga0207687_100215494 147
12 3300025941 Ga0207711_10562154 Ga0207711_105621541 147
13 3300026118 Ga0207675_101480301 Ga0207675_1014803011 147
14 3300035170 Ga0373943_0045187 Ga0373943_0045187_528_1001 147
15 3300035692 Ga0373935_0150258 Ga0373935_0150258_296_769 147
16 3300035695 Ga0373927_0044813 Ga0373927_0044813_1578_2051 147
17 3300035725 Ga0373947_0244874 Ga0373947_0244874_46_519 147
18 3300036401 Ga0373937_0190693 Ga0373937_0190693_422_895 147
19 3300046459 Ga0495629_0162976 Ga0495629_0162976_852_1325 147
20 3300046517 Ga0495630_0132509 Ga0495630_0132509_462_935 147
21 3300046531 Ga0495665_0143785 Ga0495665_0143785_522_995 147
22 3300046642 Ga0495634_0177609 Ga0495634_0177609_298_777 147
23 3300046674 Ga0495588_0452772 Ga0495588_0452772_150_623 147
24 3300046690 Ga0495624_0237717 Ga0495624_0237717_46_519 147
25 3300047319 Ga0495674_0273633 Ga0495674_0273633_58_531 147
26 3300047321 Ga0495676_0338160 Ga0495676_0338160_458_931 147
27 3300047322 Ga0495680_0305630 Ga0495680_0305630_590_1063 147
28 3300047471 Ga0495684_0113444 Ga0495684_0113444_46_519 147
29 3300047673 Ga0495593_0327953 Ga0495593_0327953_176_649 147
30 3300048905 Ga0496102_0325835 Ga0496102_0325835_685_1158 147
31 3300048912 Ga0496109_1770413 Ga0496109_1770413_41_514 147
32 3300050512 nmdc:mga0n895_55236_c1 nmdc:mga0n895_55236_c1_2728_3201 147
33 3300053090 Ga0500646_0087860 Ga0500646_0087860_432_929 147
34 3300005438 Ga0070701_10144077 Ga0070701_101440773 148
35 3300005440 Ga0070705_100281566 Ga0070705_1002815662 148
36 3300005441 Ga0070700_100037094 Ga0070700_1000370943 148
37 3300005471 Ga0070698_101235620 Ga0070698_1012356202 148
38 3300005547 Ga0070693_100370774 Ga0070693_1003707742 148
39 3300006038 Ga0075365_10436455 Ga0075365_104364552 148
40 3300009094 Ga0111539_10242892 Ga0111539_102428923 148
41 3300009098 Ga0105245_10272687 Ga0105245_102726872 148
42 3300009148 Ga0105243_10569158 Ga0105243_105691582 148
43 3300009553 Ga0105249_11122295 Ga0105249_111222951 148
44 3300025909 Ga0207705_11166389 Ga0207705_111663892 148
45 3300026075 Ga0207708_10101782 Ga0207708_101017822 148
46 3300027907 Ga0207428_11234964 Ga0207428_112349641 148
47 3300044901 Ga0466960_0172873 Ga0466960_0172873_11_490 148
48 3300050511 nmdc:mga08y16_94273_c1 nmdc:mga08y16_94273_c1_1963_2439 148
49 3300050512 nmdc:mga0n895_288296_c1 nmdc:mga0n895_288296_c1_640_1116 148
50 3300053151 Ga0500604_0077162 Ga0500604_0077162_362_880 148
51 3300005343 Ga0070687_100395507 Ga0070687_1003955072 149
52 3300005365 Ga0070688_100617192 Ga0070688_1006171922 149
53 3300005445 Ga0070708_100017962 Ga0070708_1000179622 149
54 3300005445 Ga0070708_100493763 Ga0070708_1004937632 149
55 3300005458 Ga0070681_10401151 Ga0070681_104011512 149
56 3300005468 Ga0070707_101385644 Ga0070707_1013856442 149
57 3300005545 Ga0070695_100434080 Ga0070695_1004340802 149
58 3300005548 Ga0070665_101138788 Ga0070665_1011387882 149
59 3300006237 Ga0097621_100277037 Ga0097621_1002770372 149
60 3300009098 Ga0105245_10604515 Ga0105245_106045152 149
61 3300009147 Ga0114129_12827613 Ga0114129_128276131 149
62 3300009553 Ga0105249_10737055 Ga0105249_107370552 149
63 3300014968 Ga0157379_10973603 Ga0157379_109736032 149
64 3300025912 Ga0207707_10149090 Ga0207707_101490904 149
65 3300025921 Ga0207652_11786930 Ga0207652_117869301 149
66 3300025944 Ga0207661_11055807 Ga0207661_110558072 149
67 3300026067 Ga0207678_10900180 Ga0207678_109001801 149
68 3300026089 Ga0207648_10159947 Ga0207648_101599474 149
69 3300031241 Ga0265325_10217311 Ga0265325_102173112 149
70 3300031251 Ga0265327_10003642 Ga0265327_100036427 149
71 3300031251 Ga0265327_10219790 Ga0265327_102197902 149
72 3300031712 Ga0265342_10138383 Ga0265342_101383833 149
73 3300031901 Ga0307406_10182197 Ga0307406_101821972 149
74 3300031903 Ga0307407_10211043 Ga0307407_102110432 149
75 3300031995 Ga0307409_100017516 Ga0307409_1000175164 149
76 3300032005 Ga0307411_10215393 Ga0307411_102153932 149
77 3300032126 Ga0307415_101060530 Ga0307415_1010605302 149
78 3300035171 Ga0373946_0155503 Ga0373946_0155503_558_1034 149
79 3300039438 Ga0436360_0191392 Ga0436360_0191392_20_538 149
80 3300039438 Ga0436360_0353664 Ga0436360_0353664_215_733 149
81 3300039453 Ga0436362_0426280 Ga0436362_0426280_51_569 149
82 3300047322 Ga0495680_0460514 Ga0495680_0460514_151_633 149
83 3300048908 Ga0496105_0096994 Ga0496105_0096994_22_504 149
84 3300048911 Ga0496108_0113522 Ga0496108_0113522_1746_2228 149
85 3300048912 Ga0496109_0004708 Ga0496109_0004708_3282_3764 149
86 3300048915 Ga0496112_0003736 Ga0496112_0003736_9178_9660 149
87 3300048915 Ga0496112_0110476 Ga0496112_0110476_702_1181 149
88 3300049570 Ga0501033_0000587 Ga0501033_0000587_22085_22573 149
89 3300049585 Ga0501069_0083587 Ga0501069_0083587_561_1049 149
90 3300049589 Ga0501073_0131497 Ga0501073_0131497_1073_1552 149
91 3300049823 Ga0501044_0003952 Ga0501044_0003952_1823_2311 149
92 3300050507 nmdc:mga05p37_1858050_c1 nmdc:mga05p37_1858050_c1_39_518 149
93 3300005343 Ga0070687_100528751 Ga0070687_1005287511 150
94 3300006844 Ga0075428_102257372 Ga0075428_1022573721 150
95 3300009545 Ga0105237_10665766 Ga0105237_106657661 150
96 3300013102 Ga0157371_10505970 Ga0157371_105059702 150
97 3300039437 Ga0436365_1723786 Ga0436365_1723786_2391_2876 150
98 3300039438 Ga0436360_0030020 Ga0436360_0030020_172_696 150
99 3300039453 Ga0436362_1082493 Ga0436362_1082493_57_581 150
100 3300039453 Ga0436362_1184616 Ga0436362_1184616_3899_4384 150
101 3300041492 Ga0451835_0200535 Ga0451835_0200535_34_579 150
102 3300042156 Ga0439446_0093291 Ga0439446_0093291_208_693 150
103 3300047322 Ga0495680_0537906 Ga0495680_0537906_93_578 150
104 3300049588 Ga0501072_0100115 Ga0501072_0100115_539_1024 150
105 3300054114 Ga0501084_0000009 Ga0501084_0000009_68143_68628 150
106 3300059626 Ga0587115_075975 Ga0587115_075975_41_526 150
107 3300049574 Ga0501038_0391253 Ga0501038_0391253_62_550 151
108 3300049587 Ga0501071_0082096 Ga0501071_0082096_991_1479 151
109 3300049592 Ga0501076_0113805 Ga0501076_0113805_381_863 151
110 3300049824 Ga0501045_0082699 Ga0501045_0082699_1026_1514 151
111 3300054114 Ga0501084_0969790 Ga0501084_0969790_200_688 151
112 3300014968 Ga0157379_11349216 Ga0157379_113492161 152
113 3300046459 Ga0495629_0263868 Ga0495629_0263868_416_976 152
114 3300005719 Ga0068861_100346878 Ga0068861_1003468781 153
115 3300005843 Ga0068860_100006205 Ga0068860_1000062057 153
116 3300009553 Ga0105249_10720762 Ga0105249_107207622 153
117 3300013308 Ga0157375_11013136 Ga0157375_110131361 153
118 3300025933 Ga0207706_10693713 Ga0207706_106937132 153
119 3300025961 Ga0207712_10560597 Ga0207712_105605972 153
120 3300028381 Ga0268264_10038286 Ga0268264_100382863 153
121 3300031691 Ga0316579_10046460 Ga0316579_100464604 153
122 3300031727 Ga0316576_10001293 Ga0316576_1000129313 153
123 3300031728 Ga0316578_10031602 Ga0316578_100316024 153
124 3300031733 Ga0316577_10000860 Ga0316577_100008606 153
125 3300032137 Ga0316585_10034877 Ga0316585_100348772 153
126 3300035398 Ga0316574_0002541 Ga0316574_0002541_6435_6938 153
127 3300035398 Ga0316574_0129409 Ga0316574_0129409_162_665 153
128 3300035398 Ga0316574_0214872 Ga0316574_0214872_180_683 153
129 3300036647 Ga0316582_0059075 Ga0316582_0059075_659_1162 153
130 3300036712 Ga0316584_0000507 Ga0316584_0000507_6685_7188 153
131 3300036712 Ga0316584_0072756 Ga0316584_0072756_149_652 153
132 3300036712 Ga0316584_0164507 Ga0316584_0164507_132_635 153
133 3300048911 Ga0496108_0358891 Ga0496108_0358891_272_763 153
134 3300048917 Ga0496114_0262290 Ga0496114_0262290_357_848 153
135 3300049585 Ga0501069_0483322 Ga0501069_0483322_177_668 153
136 3300049588 Ga0501072_0001973 Ga0501072_0001973_12486_13046 153
137 3300049588 Ga0501072_0269405 Ga0501072_0269405_213_773 153
138 3300049590 Ga0501074_0328645 Ga0501074_0328645_189_749 153
139 3300049742 Ga0501080_0587743 Ga0501080_0587743_139_699 153
140 3300050492 nmdc:mga0yw44_111212_c2 nmdc:mga0yw44_111212_c2_27_530 153
141 3300060353 Ga0501082_0027672 Ga0501082_0027672_2836_3396 153
142 3300006051 Ga0075364_10314294 Ga0075364_103142942 154
143 3300006178 Ga0075367_10175192 Ga0075367_101751922 154
144 3300006178 Ga0075367_10315621 Ga0075367_103156212 154
145 3300006353 Ga0075370_10214457 Ga0075370_102144572 154
146 3300035115 Ga0373941_0159780 Ga0373941_0159780_300_797 154
147 3300048913 Ga0496110_0004705 Ga0496110_0004705_5200_5694 154
148 3300048913 Ga0496110_0235224 Ga0496110_0235224_302_814 154
149 3300048914 Ga0496111_0260365 Ga0496111_0260365_515_1009 154
150 3300048917 Ga0496114_0083554 Ga0496114_0083554_194_706 154
151 3300050491 nmdc:mga00v17_1356_c1 nmdc:mga00v17_1356_c1_1177_1698 154
152 3300050494 nmdc:mga06z11_196332_c1 nmdc:mga06z11_196332_c1_456_968 154
153 3300050494 nmdc:mga06z11_43820_c2 nmdc:mga06z11_43820_c2_392_913 154
154 3300050496 nmdc:mga07m45_243587_c1 nmdc:mga07m45_243587_c1_342_863 154
155 3300005344 Ga0070661_100906983 Ga0070661_1009069832 157
156 3300006177 Ga0075362_10208350 Ga0075362_102083502 158
157 3300014745 Ga0157377_10408145 Ga0157377_104081452 158
158 3300025936 Ga0207670_10392603 Ga0207670_103926032 158
159 3300032126 Ga0307415_100051287 Ga0307415_1000512874 158
160 3300039062 Ga0400483_045014 Ga0400483_045014_1910_2446 158
161 3300039437 Ga0436365_1205939 Ga0436365_1205939_1049_1609 158
162 3300041413 Ga0439465_0203427 Ga0439465_0203427_116_655 158
163 3300041451 Ga0451791_1577216 Ga0451791_1577216_248_766 158
164 3300042876 Ga0451577_0001387 Ga0451577_0001387_7469_7972 158
165 3300044712 Ga0453684_0003331 Ga0453684_0003331_28975_29478 158
166 3300045976 Ga0466967_1083303 Ga0466967_1083303_246_755 158
167 3300049742 Ga0501080_0181034 Ga0501080_0181034_1173_1733 158
168 3300050489 nmdc:mga03683_195213_c1 nmdc:mga03683_195213_c1_174_698 158
169 3300005329 Ga0070683_100856571 Ga0070683_1008565712 159
170 3300005459 Ga0068867_100765985 Ga0068867_1007659851 159
171 3300006048 Ga0075363_100065362 Ga0075363_1000653624 159
172 3300006178 Ga0075367_10391455 Ga0075367_103914552 159
173 3300009098 Ga0105245_10023564 Ga0105245_100235645 159
174 3300009174 Ga0105241_10042483 Ga0105241_100424832 159
175 3300013296 Ga0157374_10653016 Ga0157374_106530162 159
176 3300013297 Ga0157378_10115778 Ga0157378_101157783 159
177 3300013297 Ga0157378_10228500 Ga0157378_102285002 159
178 3300025911 Ga0207654_10286392 Ga0207654_102863922 159
179 3300025912 Ga0207707_10594728 Ga0207707_105947281 159
180 3300026118 Ga0207675_100541751 Ga0207675_1005417512 159
181 3300039437 Ga0436365_0354478 Ga0436365_0354478_145_681 159
182 3300039450 Ga0436363_1186072 Ga0436363_1186072_48_623 159
183 3300046473 Ga0495582_0418290 Ga0495582_0418290_120_680 159
184 3300046517 Ga0495630_0209185 Ga0495630_0209185_99_659 159
185 3300046526 Ga0495666_0194377 Ga0495666_0194377_207_767 159
186 3300046533 Ga0495640_0111478 Ga0495640_0111478_532_1071 159
187 3300046539 Ga0495621_0055107 Ga0495621_0055107_89_649 159
188 3300046683 Ga0495658_0208881 Ga0495658_0208881_367_927 159
189 3300046689 Ga0495613_0000685 Ga0495613_0000685_7040_7600 159
190 3300046689 Ga0495613_0304678 Ga0495613_0304678_355_915 159
191 3300047321 Ga0495676_0639842 Ga0495676_0639842_20_580 159
192 3300047322 Ga0495680_0121145 Ga0495680_0121145_1005_1565 159
193 3300048903 Ga0496100_1108970 Ga0496100_1108970_90_596 159
194 3300050494 nmdc:mga06z11_142508_c1 nmdc:mga06z11_142508_c1_41_568 159
195 3300050495 nmdc:mga04h51_187316_c1 nmdc:mga04h51_187316_c1_95_622 159
196 3300059642 Ga0587069_048426 Ga0587069_048426_201_716 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13187

Fer4_9

4Fe-4S dicluster domain

68

133

0.94

PF00037

Fer4

4Fe-4S binding domain

111

134

0.93

PF12838

Fer4_7

4Fe-4S dicluster domain

42

132

0.84

PF13237

Fer4_10

4Fe-4S dicluster domain

62

129

0.83

Feature Viewer

pLDDT pTM Quality
52.27 0.23 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map