F304551

General Info

Members Datasets Scaffolds Average Seq Length
198 133 197 167

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10072093|Ga0207651_100720934
Length 148
Sequence MAEPFLSEIRIMSFGFPPKGWALCDGQLLPINQNQALFSLLGTTYGGDGRVNFGLPNLQGRTPIHMGAAGHTLGERGGEQGHTLSISELPTNFLASPLSQTYTPAAALGAMQATTVANVGGSQAHLNMQPFLVLNFSIALQGIFPSQT

Samples

Sample ID Description Type Environment
1 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
129 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.02
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0.51
Rhizoplane 2.53
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100282037 3300005330 Bacteria 1185
2 Ga0068869_100001770 3300005334 Bacteria 12931
3 Ga0070666_10002501 3300005335 Bacteria 11120
4 Ga0070666_10050046 3300005335 Bacteria 2810
5 Ga0070680_100202314 3300005336 Bacteria 1675
6 Ga0070687_100934883 3300005343 Unclassified 624
7 Ga0070661_100455513 3300005344 Bacteria 1018
8 Ga0070671_100113172 3300005355 Bacteria 2280
9 Ga0070667_100225713 3300005367 Bacteria 1668
10 Ga0070667_100640019 3300005367 Bacteria 981
11 Ga0070710_10015710 3300005437 Bacteria 3837
12 Ga0070705_100078149 3300005440 Bacteria 2023
13 Ga0070708_100129163 3300005445 Bacteria 2338
14 Ga0070708_100230401 3300005445 Bacteria 1738
15 Ga0070708_100300238 3300005445 Bacteria 1512
16 Ga0070708_100536081 3300005445 Bacteria 1104
17 Ga0070663_100036080 3300005455 Bacteria 3434
18 Ga0070678_101045064 3300005456 Bacteria 752
19 Ga0070685_10002224 3300005466 Bacteria 10011
20 Ga0070706_100076328 3300005467 Bacteria 3101
21 Ga0070707_100055856 3300005468 Bacteria 3785
22 Ga0070707_100105650 3300005468 Bacteria 2730
23 Ga0070707_100369175 3300005468 Bacteria 1394
24 Ga0070707_101578617 3300005468 Bacteria 623
25 Ga0070698_100256238 3300005471 Bacteria 1682
26 Ga0070699_100029384 3300005518 Bacteria 4739
27 Ga0070679_100494543 3300005530 Bacteria 1167
28 Ga0068853_100011726 3300005539 Bacteria 7122
29 Ga0068853_100542237 3300005539 Bacteria 1101
30 Ga0070693_100278588 3300005547 Bacteria 1119
31 Ga0068855_100073046 3300005563 Bacteria 3986
32 Ga0068856_100019362 3300005614 Bacteria 6607
33 Ga0070702_101049091 3300005615 Bacteria 648
34 Ga0068852_100072822 3300005616 Bacteria 3020
35 Ga0068852_100627900 3300005616 Unclassified 1080
36 Ga0068859_100035697 3300005617 Bacteria 4989
37 Ga0068859_100127778 3300005617 Bacteria 2612
38 Ga0068864_100032817 3300005618 Bacteria 4413
39 Ga0068863_100033985 3300005841 Bacteria 4857
40 Ga0068863_100071186 3300005841 Bacteria 3290
41 Ga0068858_100015521 3300005842 Bacteria 7163
42 Ga0068858_100572408 3300005842 Bacteria 1094
43 Ga0068858_100746905 3300005842 Unclassified 953
44 Ga0068858_102089222 3300005842 Bacteria 560
45 Ga0068860_100000890 3300005843 Bacteria 33156
46 Ga0068860_100038278 3300005843 Bacteria 4587
47 Ga0070717_10000191 3300006028 Bacteria 43325
48 Ga0070716_101052859 3300006173 Bacteria 646
49 Ga0070712_100101465 3300006175 Bacteria 2129
50 Ga0070712_100145391 3300006175 Bacteria 1814
51 Ga0097621_100228065 3300006237 Bacteria 1625
52 Ga0068871_100208312 3300006358 Bacteria 1690
53 Ga0075434_100011576 3300006871 Bacteria 8328
54 Ga0075434_100054940 3300006871 Bacteria 3957
55 Ga0075434_100178863 3300006871 Bacteria 2141
56 Ga0075436_100001244 3300006914 Bacteria 17316
57 Ga0075436_100048677 3300006914 Bacteria 2925
58 Ga0075436_100110035 3300006914 Bacteria 1922
59 Ga0097620_100035697 3300006931 Bacteria 4989
60 Ga0097620_100127780 3300006931 Bacteria 2612
61 Ga0075435_100011911 3300007076 Bacteria 6422
62 Ga0075435_100157412 3300007076 Bacteria 1912
63 Ga0105240_10000239 3300009093 Bacteria 109259
64 Ga0105240_10008722 3300009093 Bacteria 14458
65 Ga0105240_10050241 3300009093 Bacteria 5259
66 Ga0105245_10076383 3300009098 Bacteria 3051
67 Ga0105245_10119597 3300009098 Bacteria 2459
68 Ga0105245_10191229 3300009098 Bacteria 1960
69 Ga0105245_10967274 3300009098 Bacteria 895
70 Ga0105242_10810231 3300009176 Unclassified 928
71 Ga0105248_10043660 3300009177 Bacteria 5027
72 Ga0105248_10122467 3300009177 Bacteria 2934
73 Ga0105248_11082700 3300009177 Bacteria 906
74 Ga0105237_10016724 3300009545 Bacteria 7616
75 Ga0105238_10001918 3300009551 Bacteria 20874
76 Ga0099796_10395506 3300010159 Unclassified 605
77 Ga0105239_10021673 3300010375 Bacteria 7083
78 Ga0105239_10153345 3300010375 Bacteria 2572
79 Ga0105239_10456521 3300010375 Bacteria 1450
80 Ga0105239_10508491 3300010375 Bacteria 1370
81 Ga0105246_10002517 3300011119 Bacteria 11080
82 Ga0105246_10071283 3300011119 Bacteria 2446
83 Ga0157371_10286677 3300013102 Bacteria 1190
84 Ga0157374_10155376 3300013296 Bacteria 2226
85 Ga0157378_10000226 3300013297 Bacteria 54962
86 Ga0157378_10083423 3300013297 Bacteria 2892
87 Ga0157378_10768829 3300013297 Bacteria 987
88 Ga0163162_10043702 3300013306 Bacteria 4486
89 Ga0157372_10521863 3300013307 Bacteria 1385
90 Ga0157372_11536442 3300013307 Bacteria 767
91 Ga0163163_10003458 3300014325 Bacteria 13422
92 Ga0157379_10039121 3300014968 Bacteria 4231
93 Ga0157376_10000021 3300014969 Bacteria 240083
94 Ga0163161_10561430 3300017792 Unclassified 937
95 Ga0207692_10010801 3300025898 Bacteria 3863
96 Ga0207692_11018843 3300025898 Bacteria 547
97 Ga0207680_10004480 3300025903 Bacteria 6627
98 Ga0207680_10030716 3300025903 Bacteria 3034
99 Ga0207699_10000020 3300025906 Bacteria 179154
100 Ga0207699_10288405 3300025906 Bacteria 1143
101 Ga0207684_10010404 3300025910 Bacteria 8190
102 Ga0207695_10000082 3300025913 Bacteria 284333
103 Ga0207695_10010850 3300025913 Bacteria 11096
104 Ga0207695_10026988 3300025913 Bacteria 6398
105 Ga0207693_10110900 3300025915 Bacteria 2151
106 Ga0207693_10192441 3300025915 Bacteria 1605
107 Ga0207662_10408145 3300025918 Bacteria 922
108 Ga0207649_10683709 3300025920 Bacteria 795
109 Ga0207646_10009596 3300025922 Bacteria 9548
110 Ga0207646_10087209 3300025922 Bacteria 2793
111 Ga0207646_10683847 3300025922 Bacteria 918
112 Ga0207694_10001472 3300025924 Bacteria 20135
113 Ga0207687_10098226 3300025927 Bacteria 2149
114 Ga0207687_10145415 3300025927 Bacteria 1803
115 Ga0207687_10424010 3300025927 Bacteria 1098
116 Ga0207700_10537302 3300025928 Bacteria 1037
117 Ga0207644_10085305 3300025931 Bacteria 2342
118 Ga0207686_10630621 3300025934 Bacteria 846
119 Ga0207665_10102280 3300025939 Bacteria 2002
120 Ga0207665_11059424 3300025939 Bacteria 646
121 Ga0207711_10071535 3300025941 Bacteria 3010
122 Ga0207711_11065527 3300025941 Bacteria 749
123 Ga0207689_10011112 3300025942 Bacteria 7731
124 Ga0207651_10072093 3300025960 Bacteria 2451
125 Ga0207651_10453152 3300025960 Bacteria 1101
126 Ga0207640_10201376 3300025981 Bacteria 1509
127 Ga0207703_10010566 3300026035 Bacteria 7215
128 Ga0207703_10454391 3300026035 Bacteria 1197
129 Ga0207703_10459206 3300026035 Bacteria 1191
130 Ga0207639_10000008 3300026041 Bacteria 434844
131 Ga0207678_10041035 3300026067 Bacteria 4012
132 Ga0207702_10030748 3300026078 Bacteria 4473
133 Ga0207641_10069315 3300026088 Bacteria 3027
134 Ga0207641_10099476 3300026088 Bacteria 2559
135 Ga0207676_10028710 3300026095 Bacteria 4158
136 Ga0207683_11002696 3300026121 Bacteria 775
137 Ga0207698_10072501 3300026142 Bacteria 2738
138 Ga0207698_10451681 3300026142 Unclassified 1241
139 Ga0268264_10499384 3300028381 Bacteria 1186
140 Ga0265337_1086937 3300028556 Bacteria 853
141 Ga0265313_10001611 3300031595 Bacteria 20969
142 Ga0307508_10132059 3300031616 Bacteria 2101
143 Ga0265342_10342208 3300031712 Bacteria 780
144 Ga0307516_10055818 3300031730 Bacteria 3854
145 Ga0373940_0153880 3300035088 Bacteria 734
146 Ga0373961_0000245 3300035241 Bacteria 25270
147 Ga0373961_0005491 3300035241 Bacteria 3046
148 Ga0373935_0036975 3300035692 Bacteria 3054
149 Ga0436365_1564440 3300039437 Bacteria 14747
150 Ga0436362_0946624 3300039453 Bacteria 915
151 Ga0451802_0262433 3300041460 Bacteria 663
152 Ga0451807_2633531 3300041486 Bacteria 1695
153 Ga0453683_0065998 3300044673 Bacteria 2262
154 Ga0466963_0015226 3300044694 Bacteria 4758
155 Ga0466963_0140965 3300044694 Bacteria 1670
156 Ga0466967_0049229 3300045976 Bacteria 3684
157 Ga0495679_010380 3300047446 Bacteria 3659
158 Ga0496110_0008976 3300048913 Bacteria 8063
159 Ga0496112_0129858 3300048915 Bacteria 2491
160 Ga0496114_0000040 3300048917 Bacteria 137465
161 Ga0496118_0066258 3300048921 Bacteria 2637
162 Ga0501034_0000462 3300049571 Bacteria 67291
163 Ga0501034_0346971 3300049571 Bacteria 1413
164 Ga0501036_0065288 3300049572 Bacteria 3081
165 Ga0501037_0207704 3300049573 Bacteria 1382
166 Ga0501043_0225535 3300049579 Bacteria 1448
167 Ga0501046_0031293 3300049580 Bacteria 4315
168 Ga0501047_0038356 3300049581 Bacteria 4636
169 Ga0501047_0311574 3300049581 Bacteria 1414
170 Ga0501067_0239588 3300049583 Bacteria 1010
171 Ga0501068_0289146 3300049584 Bacteria 1048
172 Ga0501069_0050086 3300049585 Bacteria 2322
173 Ga0501070_0013611 3300049586 Bacteria 6856
174 Ga0501070_0426745 3300049586 Bacteria 1070
175 Ga0501074_0069229 3300049590 Bacteria 2537
176 Ga0501079_0077104 3300049741 Bacteria 2578
177 Ga0501080_0042679 3300049742 Bacteria 4222
178 Ga0501080_0279012 3300049742 Bacteria 1519
179 Ga0501044_0344954 3300049823 Bacteria 1410
180 Ga0501045_0351721 3300049824 Bacteria 1097
181 nmdc:mga0n895_177297_c1 3300050512 Bacteria 2162
182 nmdc:mga0n895_36897_c1 3300050512 Bacteria 4723
183 nmdc:mga0n895_7983_c1 3300050512 Bacteria 9127
184 nmdc:mga0rr50_145584_c1 3300050513 Bacteria 1910
185 nmdc:mga0rr50_8787_c1 3300050513 Bacteria 6304
186 nmdc:mga08x19_17_c1 3300050514 Bacteria 313678
187 nmdc:mga08x19_31272_c1 3300050514 Bacteria 3348
188 nmdc:mga08x19_44515_c1 3300050514 Bacteria 2834
189 Ga0495655_0000072 3300053083 Bacteria 20024
190 Ga0500651_0002859 3300053093 Bacteria 9272
191 Ga0501084_0064835 3300054114 Bacteria 3056
192 Ga0500661_016907 3300055283 Bacteria 1303
193 Ga0587109_070543 3300059624 Bacteria 755
194 Ga0587067_037896 3300059640 Bacteria 923
195 Ga0587068_002067 3300059641 Bacteria 2390
196 Ga0587079_003962 3300059647 Bacteria 1978
197 Ga0501082_0019281 3300060353 Bacteria 5880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025960 Ga0207651_10072093 Ga0207651_100720934 147
2 3300025927 Ga0207687_10098226 Ga0207687_100982263 148
3 3300005440 Ga0070705_100078149 Ga0070705_1000781493 150
4 3300028556 Ga0265337_1086937 Ga0265337_10869371 153
5 3300031595 Ga0265313_10001611 Ga0265313_100016118 153
6 3300031712 Ga0265342_10342208 Ga0265342_103422082 153
7 3300039453 Ga0436362_0946624 Ga0436362_0946624_117_632 154
8 3300041460 Ga0451802_0262433 Ga0451802_0262433_111_623 155
9 3300009093 Ga0105240_10008722 Ga0105240_100087222 156
10 3300028381 Ga0268264_10499384 Ga0268264_104993843 156
11 iso_pu_bacteria 2908739725 2908747876 161
12 3300005344 Ga0070661_100455513 Ga0070661_1004555132 165
13 3300005437 Ga0070710_10015710 Ga0070710_100157102 165
14 3300005445 Ga0070708_100536081 Ga0070708_1005360812 165
15 3300006175 Ga0070712_100145391 Ga0070712_1001453911 165
16 3300006871 Ga0075434_100178863 Ga0075434_1001788634 165
17 3300006914 Ga0075436_100110035 Ga0075436_1001100351 165
18 3300010375 Ga0105239_10021673 Ga0105239_100216733 165
19 3300025898 Ga0207692_10010801 Ga0207692_100108012 165
20 3300025915 Ga0207693_10192441 Ga0207693_101924413 165
21 3300025920 Ga0207649_10683709 Ga0207649_106837092 165
22 3300025928 Ga0207700_10537302 Ga0207700_105373022 165
23 3300050512 nmdc:mga0n895_177297_c1 nmdc:mga0n895_177297_c1_187_684 165
24 3300005335 Ga0070666_10002501 Ga0070666_1000250114 166
25 3300005355 Ga0070671_100113172 Ga0070671_1001131722 166
26 3300005445 Ga0070708_100230401 Ga0070708_1002304011 166
27 3300005445 Ga0070708_100300238 Ga0070708_1003002382 166
28 3300005456 Ga0070678_101045064 Ga0070678_1010450641 166
29 3300005468 Ga0070707_101578617 Ga0070707_1015786171 166
30 3300005518 Ga0070699_100029384 Ga0070699_1000293842 166
31 3300005547 Ga0070693_100278588 Ga0070693_1002785882 166
32 3300005563 Ga0068855_100073046 Ga0068855_1000730464 166
33 3300005842 Ga0068858_100572408 Ga0068858_1005724082 166
34 3300013297 Ga0157378_10768829 Ga0157378_107688292 166
35 3300025903 Ga0207680_10004480 Ga0207680_100044807 166
36 3300025931 Ga0207644_10085305 Ga0207644_100853052 166
37 3300025960 Ga0207651_10453152 Ga0207651_104531522 166
38 3300026121 Ga0207683_11002696 Ga0207683_110026962 166
39 3300044694 Ga0466963_0015226 Ga0466963_0015226_2845_3345 166
40 3300049571 Ga0501034_0000462 Ga0501034_0000462_66462_66965 166
41 3300049571 Ga0501034_0346971 Ga0501034_0346971_543_1046 166
42 3300049572 Ga0501036_0065288 Ga0501036_0065288_2064_2567 166
43 3300049573 Ga0501037_0207704 Ga0501037_0207704_568_1071 166
44 3300049579 Ga0501043_0225535 Ga0501043_0225535_533_1036 166
45 3300049580 Ga0501046_0031293 Ga0501046_0031293_3583_4086 166
46 3300049581 Ga0501047_0038356 Ga0501047_0038356_3775_4278 166
47 3300049581 Ga0501047_0311574 Ga0501047_0311574_569_1072 166
48 3300049583 Ga0501067_0239588 Ga0501067_0239588_479_982 166
49 3300049584 Ga0501068_0289146 Ga0501068_0289146_130_633 166
50 3300049585 Ga0501069_0050086 Ga0501069_0050086_1020_1523 166
51 3300049586 Ga0501070_0013611 Ga0501070_0013611_3121_3624 166
52 3300049586 Ga0501070_0426745 Ga0501070_0426745_315_818 166
53 3300049590 Ga0501074_0069229 Ga0501074_0069229_1663_2166 166
54 3300049741 Ga0501079_0077104 Ga0501079_0077104_1900_2403 166
55 3300049742 Ga0501080_0042679 Ga0501080_0042679_970_1473 166
56 3300049742 Ga0501080_0279012 Ga0501080_0279012_569_1072 166
57 3300049823 Ga0501044_0344954 Ga0501044_0344954_339_842 166
58 3300049824 Ga0501045_0351721 Ga0501045_0351721_97_600 166
59 3300050514 nmdc:mga08x19_31272_c1 nmdc:mga08x19_31272_c1_2482_2982 166
60 3300054114 Ga0501084_0064835 Ga0501084_0064835_1198_1701 166
61 3300055283 Ga0500661_016907 Ga0500661_016907_419_925 166
62 3300059640 Ga0587067_037896 Ga0587067_037896_379_879 166
63 3300060353 Ga0501082_0019281 Ga0501082_0019281_2079_2582 166
64 3300005334 Ga0068869_100001770 Ga0068869_1000017708 167
65 3300005336 Ga0070680_100202314 Ga0070680_1002023142 167
66 3300005343 Ga0070687_100934883 Ga0070687_1009348831 167
67 3300005367 Ga0070667_100640019 Ga0070667_1006400192 167
68 3300005467 Ga0070706_100076328 Ga0070706_1000763284 167
69 3300005468 Ga0070707_100055856 Ga0070707_1000558564 167
70 3300005468 Ga0070707_100105650 Ga0070707_1001056501 167
71 3300005468 Ga0070707_100369175 Ga0070707_1003691752 167
72 3300005471 Ga0070698_100256238 Ga0070698_1002562383 167
73 3300005530 Ga0070679_100494543 Ga0070679_1004945432 167
74 3300005539 Ga0068853_100542237 Ga0068853_1005422372 167
75 3300005614 Ga0068856_100019362 Ga0068856_1000193622 167
76 3300005615 Ga0070702_101049091 Ga0070702_1010490911 167
77 3300005616 Ga0068852_100627900 Ga0068852_1006279001 167
78 3300005617 Ga0068859_100035697 Ga0068859_1000356978 167
79 3300005617 Ga0068859_100127778 Ga0068859_1001277782 167
80 3300005618 Ga0068864_100032817 Ga0068864_1000328172 167
81 3300005841 Ga0068863_100033985 Ga0068863_1000339852 167
82 3300005841 Ga0068863_100071186 Ga0068863_1000711863 167
83 3300005842 Ga0068858_102089222 Ga0068858_1020892221 167
84 3300005843 Ga0068860_100000890 Ga0068860_10000089021 167
85 3300005843 Ga0068860_100038278 Ga0068860_1000382786 167
86 3300006028 Ga0070717_10000191 Ga0070717_1000019148 167
87 3300006173 Ga0070716_101052859 Ga0070716_1010528591 167
88 3300006175 Ga0070712_100101465 Ga0070712_1001014653 167
89 3300006237 Ga0097621_100228065 Ga0097621_1002280652 167
90 3300006358 Ga0068871_100208312 Ga0068871_1002083123 167
91 3300006871 Ga0075434_100011576 Ga0075434_1000115762 167
92 3300006871 Ga0075434_100054940 Ga0075434_1000549404 167
93 3300006914 Ga0075436_100001244 Ga0075436_1000012444 167
94 3300006914 Ga0075436_100048677 Ga0075436_1000486775 167
95 3300006931 Ga0097620_100035697 Ga0097620_1000356978 167
96 3300006931 Ga0097620_100127780 Ga0097620_1001277804 167
97 3300007076 Ga0075435_100011911 Ga0075435_1000119115 167
98 3300007076 Ga0075435_100157412 Ga0075435_1001574122 167
99 3300009098 Ga0105245_10076383 Ga0105245_100763832 167
100 3300009098 Ga0105245_10119597 Ga0105245_101195972 167
101 3300009098 Ga0105245_10191229 Ga0105245_101912292 167
102 3300009098 Ga0105245_10967274 Ga0105245_109672742 167
103 3300009177 Ga0105248_10043660 Ga0105248_100436602 167
104 3300009177 Ga0105248_10122467 Ga0105248_101224672 167
105 3300010159 Ga0099796_10395506 Ga0099796_103955061 167
106 3300010375 Ga0105239_10456521 Ga0105239_104565211 167
107 3300011119 Ga0105246_10002517 Ga0105246_100025172 167
108 3300011119 Ga0105246_10071283 Ga0105246_100712832 167
109 3300013102 Ga0157371_10286677 Ga0157371_102866772 167
110 3300013296 Ga0157374_10155376 Ga0157374_101553762 167
111 3300013297 Ga0157378_10000226 Ga0157378_100002267 167
112 3300013297 Ga0157378_10083423 Ga0157378_100834232 167
113 3300013306 Ga0163162_10043702 Ga0163162_100437022 167
114 3300014325 Ga0163163_10003458 Ga0163163_100034584 167
115 3300014968 Ga0157379_10039121 Ga0157379_100391212 167
116 3300014969 Ga0157376_10000021 Ga0157376_100000212 167
117 3300025898 Ga0207692_11018843 Ga0207692_110188431 167
118 3300025906 Ga0207699_10000020 Ga0207699_10000020135 167
119 3300025906 Ga0207699_10288405 Ga0207699_102884052 167
120 3300025910 Ga0207684_10010404 Ga0207684_100104046 167
121 3300025913 Ga0207695_10010850 Ga0207695_100108502 167
122 3300025915 Ga0207693_10110900 Ga0207693_101109002 167
123 3300025918 Ga0207662_10408145 Ga0207662_104081451 167
124 3300025922 Ga0207646_10009596 Ga0207646_100095961 167
125 3300025922 Ga0207646_10087209 Ga0207646_100872092 167
126 3300025922 Ga0207646_10683847 Ga0207646_106838472 167
127 3300025927 Ga0207687_10145415 Ga0207687_101454152 167
128 3300025927 Ga0207687_10424010 Ga0207687_104240102 167
129 3300025939 Ga0207665_10102280 Ga0207665_101022802 167
130 3300025939 Ga0207665_11059424 Ga0207665_110594241 167
131 3300025941 Ga0207711_10071535 Ga0207711_100715352 167
132 3300025941 Ga0207711_11065527 Ga0207711_110655272 167
133 3300025942 Ga0207689_10011112 Ga0207689_100111124 167
134 3300025981 Ga0207640_10201376 Ga0207640_102013762 167
135 3300026035 Ga0207703_10454391 Ga0207703_104543911 167
136 3300026078 Ga0207702_10030748 Ga0207702_100307485 167
137 3300026088 Ga0207641_10069315 Ga0207641_100693152 167
138 3300026088 Ga0207641_10099476 Ga0207641_100994761 167
139 3300026095 Ga0207676_10028710 Ga0207676_100287102 167
140 3300026142 Ga0207698_10451681 Ga0207698_104516812 167
141 3300031616 Ga0307508_10132059 Ga0307508_101320592 167
142 3300031730 Ga0307516_10055818 Ga0307516_100558184 167
143 3300035241 Ga0373961_0005491 Ga0373961_0005491_1932_2435 167
144 3300035692 Ga0373935_0036975 Ga0373935_0036975_2366_2869 167
145 3300044673 Ga0453683_0065998 Ga0453683_0065998_1486_1989 167
146 3300044694 Ga0466963_0140965 Ga0466963_0140965_60_566 167
147 3300045976 Ga0466967_0049229 Ga0466967_0049229_1721_2227 167
148 3300047446 Ga0495679_010380 Ga0495679_010380_851_1354 167
149 3300048913 Ga0496110_0008976 Ga0496110_0008976_4158_4661 167
150 3300048917 Ga0496114_0000040 Ga0496114_0000040_79001_79504 167
151 3300050512 nmdc:mga0n895_36897_c1 nmdc:mga0n895_36897_c1_2366_2869 167
152 3300050512 nmdc:mga0n895_7983_c1 nmdc:mga0n895_7983_c1_5701_6204 167
153 3300050513 nmdc:mga0rr50_145584_c1 nmdc:mga0rr50_145584_c1_193_696 167
154 3300050513 nmdc:mga0rr50_8787_c1 nmdc:mga0rr50_8787_c1_1867_2391 167
155 3300050514 nmdc:mga08x19_17_c1 nmdc:mga08x19_17_c1_224574_225080 167
156 3300050514 nmdc:mga08x19_44515_c1 nmdc:mga08x19_44515_c1_322_846 167
157 3300059641 Ga0587068_002067 Ga0587068_002067_1746_2252 167
158 3300059647 Ga0587079_003962 Ga0587079_003962_220_726 167
159 3300005330 Ga0070690_100282037 Ga0070690_1002820372 168
160 3300005335 Ga0070666_10050046 Ga0070666_100500463 168
161 3300005367 Ga0070667_100225713 Ga0070667_1002257132 168
162 3300005445 Ga0070708_100129163 Ga0070708_1001291631 168
163 3300005455 Ga0070663_100036080 Ga0070663_1000360807 168
164 3300005466 Ga0070685_10002224 Ga0070685_100022242 168
165 3300005539 Ga0068853_100011726 Ga0068853_1000117266 168
166 3300005616 Ga0068852_100072822 Ga0068852_1000728223 168
167 3300005842 Ga0068858_100015521 Ga0068858_1000155218 168
168 3300005842 Ga0068858_100746905 Ga0068858_1007469051 168
169 3300009093 Ga0105240_10000239 Ga0105240_1000023968 168
170 3300009093 Ga0105240_10050241 Ga0105240_100502412 168
171 3300009176 Ga0105242_10810231 Ga0105242_108102312 168
172 3300009177 Ga0105248_11082700 Ga0105248_110827002 168
173 3300009545 Ga0105237_10016724 Ga0105237_100167248 168
174 3300009551 Ga0105238_10001918 Ga0105238_1000191813 168
175 3300010375 Ga0105239_10153345 Ga0105239_101533452 168
176 3300010375 Ga0105239_10508491 Ga0105239_105084912 168
177 3300013307 Ga0157372_10521863 Ga0157372_105218632 168
178 3300013307 Ga0157372_11536442 Ga0157372_115364422 168
179 3300017792 Ga0163161_10561430 Ga0163161_105614302 168
180 3300025903 Ga0207680_10030716 Ga0207680_100307164 168
181 3300025913 Ga0207695_10000082 Ga0207695_10000082215 168
182 3300025913 Ga0207695_10026988 Ga0207695_100269886 168
183 3300025924 Ga0207694_10001472 Ga0207694_1000147211 168
184 3300025934 Ga0207686_10630621 Ga0207686_106306211 168
185 3300026035 Ga0207703_10010566 Ga0207703_100105662 168
186 3300026035 Ga0207703_10459206 Ga0207703_104592061 168
187 3300026041 Ga0207639_10000008 Ga0207639_1000000831 168
188 3300026067 Ga0207678_10041035 Ga0207678_100410352 168
189 3300026142 Ga0207698_10072501 Ga0207698_100725012 168
190 3300035088 Ga0373940_0153880 Ga0373940_0153880_29_544 168
191 3300035241 Ga0373961_0000245 Ga0373961_0000245_21872_22378 168
192 3300039437 Ga0436365_1564440 Ga0436365_1564440_2137_2643 168
193 3300041486 Ga0451807_2633531 Ga0451807_2633531_778_1284 168
194 3300048915 Ga0496112_0129858 Ga0496112_0129858_24_542 168
195 3300048921 Ga0496118_0066258 Ga0496118_0066258_1688_2194 168
196 3300053083 Ga0495655_0000072 Ga0495655_0000072_6157_6663 168
197 3300053093 Ga0500651_0002859 Ga0500651_0002859_2405_2911 168
198 3300059624 Ga0587109_070543 Ga0587109_070543_100_645 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Feature Viewer

pLDDT pTM Quality
43.46 0.2 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map