F304587

General Info

Members Datasets Scaffolds Average Seq Length
198 163 396 270

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10000042|Ga0265336_1000004220
Length 296
Sequence MSGDTAPLRARIGFGEVRHHRLAPVQHAFAYPTCFLMLPMRSLRRRADPVLARNRRAPFGFRDTDHGDGRADSLAWLEEMLAGAGIADADGEIWLHCIPRVFGFAFKPVSFWYAHRADGTLAAIVVEVNNTFGERHCYLLAGATLDFGRTLAATKVFHVSPFCQTRGEYAFRFMRTDLAARDDRGRTAVRVELHVDGVPLLLTSVSGRIEPLTPAAVRCALWTFPAMTAVIVARIHWHALKLWLKKLPIVRKPVPPATALTRGAQADGAAAASPNXXXSMRLSSTADDASTAQNPA

Samples

Sample ID Description Type Environment
1 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
142 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
145 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
146 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 2547132374 Acidovorax radicis N35 Isolate Unclassified
152 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
153 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
154 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
155 2643221570 Acidovorax sp. Root568 Isolate Unclassified
156 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
157 2643221596 Acidovorax sp. Root70 Isolate Unclassified
158 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
159 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
160 2643221652 Acidovorax sp. Root402 Isolate Unclassified
161 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
162 2643221717 Acidovorax sp. Root267 Isolate Unclassified
163 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.43
Metatranscriptomes 0
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.26
Nodule 1.01
Rhizoplane 3.54
Rhizosphere 53.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265336_10000042 3300028666 Bacteria 136760
2 JGI24740J21852_10005781 3300001979 Bacteria 5196
3 JGI25152J39213_1001279 3300002773 Bacteria 11316
4 JGI25153J46596_10002642 3300003215 Bacteria 10244
5 Ga0055535_1000125 3300003761 Bacteria 81678
6 Ga0055529_1000266 3300003763 Bacteria 62097
7 Ga0055526_1000867 3300003771 Bacteria 22551
8 Ga0055524_1000033 3300003775 Bacteria 180833
9 Ga0055530_10005855 3300003791 Bacteria 5688
10 Ga0055530_10012285 3300003791 Bacteria 2998
11 Ga0055540_1000371 3300003792 Bacteria 37810
12 Ga0055531_10005156 3300003794 Bacteria 7704
13 Ga0065165_1000910 3300005262 Bacteria 38170
14 Ga0070658_10252333 3300005327 Bacteria 1497
15 Ga0070676_10006653 3300005328 Bacteria 6188
16 Ga0070676_10313287 3300005328 Bacteria 1068
17 Ga0070670_100077634 3300005331 Bacteria 2853
18 Ga0068869_100105511 3300005334 Bacteria 2137
19 Ga0068869_100519084 3300005334 Bacteria 997
20 Ga0070660_100035812 3300005339 Bacteria 3757
21 Ga0070669_100015464 3300005353 Bacteria 5438
22 Ga0070675_100007240 3300005354 Bacteria 8557
23 Ga0070671_100063844 3300005355 Bacteria 3067
24 Ga0070674_100013055 3300005356 Bacteria 5122
25 Ga0070673_100023576 3300005364 Bacteria 4498
26 Ga0070673_100033393 3300005364 Bacteria 3885
27 Ga0070667_100063303 3300005367 Bacteria 3134
28 Ga0070663_100014467 3300005455 Bacteria 5065
29 Ga0068867_100000074 3300005459 Bacteria 61448
30 Ga0068867_100009306 3300005459 Bacteria 6929
31 Ga0068867_100010126 3300005459 Bacteria 6647
32 Ga0068853_100257251 3300005539 Bacteria 1604
33 Ga0070672_100010723 3300005543 Bacteria 6367
34 Ga0070665_100296403 3300005548 Bacteria 1620
35 Ga0068855_100168653 3300005563 Bacteria 2480
36 Ga0068854_100023183 3300005578 Bacteria 4238
37 Ga0068859_100363585 3300005617 Bacteria 1542
38 Ga0068864_100004658 3300005618 Bacteria 11252
39 Ga0068861_100178811 3300005719 Bacteria 1764
40 Ga0068870_10066201 3300005840 Bacteria 1956
41 Ga0068863_100165541 3300005841 Bacteria 2120
42 Ga0075365_10099283 3300006038 Bacteria 1992
43 Ga0075364_10324765 3300006051 Bacteria 1048
44 Ga0075367_10203654 3300006178 Bacteria 1237
45 Ga0097621_100165679 3300006237 Bacteria 1903
46 Ga0097620_100363563 3300006931 Bacteria 1542
47 Ga0079104_1000408 3300006946 Bacteria 49476
48 Ga0105240_10346241 3300009093 Bacteria 1687
49 Ga0105245_10276484 3300009098 Bacteria 1640
50 Ga0114129_10108906 3300009147 Bacteria 3824
51 Ga0105243_10000513 3300009148 Bacteria 39564
52 Ga0105243_10032404 3300009148 Bacteria 4038
53 Ga0157374_10002968 3300013296 Bacteria 14203
54 Ga0157374_10349094 3300013296 Bacteria 1470
55 Ga0157374_10539464 3300013296 Bacteria 1174
56 Ga0163162_10151039 3300013306 Bacteria 2440
57 Ga0157375_10070357 3300013308 Bacteria 3509
58 Ga0163163_10365547 3300014325 Bacteria 1499
59 Ga0157377_10000006 3300014745 Bacteria 419853
60 Ga0157379_10013872 3300014968 Bacteria 7064
61 Ga0157376_10014686 3300014969 Bacteria 5888
62 Ga0163161_10019905 3300017792 Bacteria 4707
63 Ga0209258_100071 3300025242 Bacteria 278319
64 Ga0209148_1005491 3300025254 Bacteria 2899
65 Ga0209759_1001912 3300025256 Bacteria 10216
66 Ga0209759_1004524 3300025256 Bacteria 5152
67 Ga0209759_1008883 3300025256 Bacteria 3092
68 Ga0209129_1000119 3300025258 Bacteria 138904
69 Ga0209129_1022669 3300025258 Bacteria 1132
70 Ga0209455_1000030 3300025272 Bacteria 533479
71 Ga0209673_1027521 3300025273 Bacteria 1848
72 Ga0209564_1000024 3300025295 Bacteria 535041
73 Ga0209758_1000194 3300025297 Bacteria 134196
74 Ga0209758_1000249 3300025297 Bacteria 110026
75 Ga0209050_1000799 3300025298 Bacteria 44543
76 Ga0209050_1001065 3300025298 Bacteria 33725
77 Ga0209256_1000019 3300025299 Bacteria 558627
78 Ga0209256_1020666 3300025299 Bacteria 2046
79 Ga0209051_1000133 3300025303 Bacteria 139014
80 Ga0209257_1000038 3300025304 Bacteria 609032
81 Ga0207656_10062692 3300025321 Bacteria 1635
82 Ga0207682_10008136 3300025893 Bacteria 4157
83 Ga0207645_10178964 3300025907 Bacteria 1391
84 Ga0207645_10183436 3300025907 Bacteria 1373
85 Ga0207705_10020141 3300025909 Bacteria 4772
86 Ga0207695_10543489 3300025913 Bacteria 1043
87 Ga0207657_10087748 3300025919 Bacteria 2602
88 Ga0207650_10002095 3300025925 Bacteria 13955
89 Ga0207644_10085764 3300025931 Bacteria 2336
90 Ga0207709_10000398 3300025935 Bacteria 42657
91 Ga0207669_10036312 3300025937 Bacteria 2814
92 Ga0207691_10001394 3300025940 Bacteria 24181
93 Ga0207691_10164376 3300025940 Bacteria 1945
94 Ga0207689_10120537 3300025942 Bacteria 2158
95 Ga0207651_10045686 3300025960 Bacteria 2939
96 Ga0207639_10264058 3300026041 Bacteria 1507
97 Ga0207678_10000462 3300026067 Bacteria 36849
98 Ga0207648_10000039 3300026089 Bacteria 118860
99 Ga0207648_10001726 3300026089 Bacteria 23928
100 Ga0207648_10026857 3300026089 Bacteria 5113
101 Ga0207683_10014138 3300026121 Bacteria 6801
102 Ga0209281_1000023 3300027111 Bacteria 519955
103 Ga0307515_10000109 3300028794 Bacteria 195895
104 Ga0307515_10003752 3300028794 Bacteria 31839
105 Ga0307515_10217640 3300028794 Bacteria 1737
106 Ga0265324_10000363 3300029957 Bacteria 32879
107 Ga0307511_10026220 3300030521 Bacteria 5351
108 Ga0307512_10024484 3300030522 Bacteria 5370
109 Ga0307513_10005597 3300031456 Bacteria 16570
110 Ga0307513_10065728 3300031456 Bacteria 3815
111 Ga0307509_10000139 3300031507 Bacteria 108589
112 Ga0307408_100000072 3300031548 Bacteria 115918
113 Ga0307508_10184609 3300031616 Bacteria 1688
114 Ga0307516_10002737 3300031730 Bacteria 23248
115 Ga0307516_10005938 3300031730 Bacteria 14442
116 Ga0307518_10210605 3300031838 Bacteria 1280
117 Ga0307406_10108141 3300031901 Bacteria 1908
118 Ga0307414_10174592 3300032004 Bacteria 1722
119 Ga0307510_10000600 3300033180 Bacteria 36430
120 Ga0307510_10014748 3300033180 Bacteria 9249
121 Ga0307510_10033066 3300033180 Bacteria 5816
122 Ga0373932_0005049 3300035112 Bacteria 3106
123 Ga0373931_0002295 3300035691 Bacteria 8451
124 Ga0373931_0005642 3300035691 Bacteria 5807
125 Ga0373925_0111392 3300037068 Bacteria 2115
126 Ga0451791_1125361 3300041451 Bacteria 941
127 Ga0451793_0895825 3300041452 Bacteria 1346
128 Ga0451807_1277053 3300041486 Bacteria 1586
129 Ga0451833_1288179 3300041491 Bacteria 2448
130 Ga0451577_0038236 3300042876 Bacteria 4317
131 Ga0466972_0035753 3300044658 Bacteria 2431
132 Ga0495592_0040283 3300046454 Bacteria 3506
133 Ga0495629_0048302 3300046459 Bacteria 2984
134 Ga0495650_0032700 3300046471 Bacteria 2323
135 Ga0495583_0000018 3300046506 Bacteria 306541
136 Ga0495606_0007222 3300046507 Bacteria 10015
137 Ga0495610_0027617 3300046512 Bacteria 3013
138 Ga0495620_0032944 3300046515 Bacteria 2357
139 Ga0495632_0008472 3300046519 Bacteria 6306
140 Ga0495632_0097661 3300046519 Bacteria 1386
141 Ga0495643_0111949 3300046522 Bacteria 1387
142 Ga0495652_0374567 3300046529 Bacteria 1014
143 Ga0495654_0000336 3300046530 Bacteria 41176
144 Ga0495625_0013922 3300046660 Bacteria 6440
145 Ga0495625_0042100 3300046660 Bacteria 3321
146 Ga0495669_0032315 3300046684 Bacteria 2300
147 Ga0495649_0024602 3300046694 Bacteria 3356
148 Ga0495589_0017515 3300046794 Bacteria 3676
149 Ga0495604_0095575 3300047317 Bacteria 2195
150 Ga0495676_0042369 3300047321 Bacteria 3738
151 Ga0495683_0123819 3300047323 Bacteria 1225
152 Ga0495686_0010243 3300047472 Bacteria 6676
153 Ga0495686_0089528 3300047472 Bacteria 1870
154 Ga0496102_0003021 3300048905 Bacteria 14248
155 Ga0496105_0299103 3300048908 Bacteria 1294
156 Ga0496105_0362391 3300048908 Bacteria 1156
157 Ga0496114_0020948 3300048917 Bacteria 5310
158 Ga0496121_0027593 3300048924 Bacteria 5310
159 Ga0496124_0000089 3300048927 Bacteria 192423
160 Ga0496125_0007669 3300048928 Bacteria 11438
161 nmdc:mga0yw44_78564_c1 3300050492 Bacteria 2064
162 nmdc:mga0k408_155007_c1 3300050493 Bacteria 1364
163 nmdc:mga0k408_65685_c2 3300050493 Bacteria 973
164 nmdc:mga0k408_67033_c1 3300050493 Bacteria 2091
165 nmdc:mga06z11_173065_c1 3300050494 Bacteria 1241
166 nmdc:mga05p37_62844_c1 3300050507 Bacteria 4569
167 Ga0500635_0000021 3300053080 Bacteria 110194
168 Ga0500578_0000406 3300053086 Bacteria 52894
169 Ga0500644_0000609 3300053088 Bacteria 13452
170 Ga0500651_0034728 3300053093 Bacteria 3179
171 Ga0500562_042732 3300053108 Bacteria 1206
172 Ga0500594_0001113 3300053118 Bacteria 5765
173 Ga0500608_058511 3300053122 Bacteria 1845
174 Ga0500642_0003244 3300053130 Bacteria 4888
175 Ga0500559_0000114 3300053136 Bacteria 63472
176 Ga0500564_066954 3300053138 Bacteria 1624
177 Ga0500590_002913 3300053148 Bacteria 7768
178 Ga0500619_000148 3300053154 Bacteria 17268
179 Ga0500619_039179 3300053154 Bacteria 1489
180 Ga0500622_0001923 3300053156 Bacteria 15660
181 Ga0500636_0059125 3300053177 Bacteria 2240
182 Ga0500636_0208920 3300053177 Bacteria 1026
183 Ga0500587_007439 3300053739 Bacteria 1425
184 Ga0500587_011138 3300053739 Bacteria 1137
185 Ga0590075_010089 3300059424 Bacteria 2271
186 2548500450 2547132374 Bacteria 5530232
187 2587729408 2585428057 Bacteria 6737412
188 2587757144 2585428062 Bacteria 6842168
189 2588290142 2588253510 Bacteria 6901809
190 2643864556 2643221570 Bacteria 5103772
191 2643967774 2643221592 Bacteria 6608788
192 2643992832 2643221596 Bacteria 5006805
193 2644140596 2643221625 Bacteria 6512927
194 2644273563 2643221648 Bacteria 6521465
195 2644291755 2643221652 Bacteria 5140275
196 2644303692 2643221654 Bacteria 5273570
197 2644647003 2643221717 Bacteria 5676132
198 2990715135 2990710928 Bacteria 5002431
199 Ga0265336_10000042
200 JGI24740J21852_10005781
201 JGI25152J39213_1001279
202 JGI25153J46596_10002642
203 Ga0055535_1000125
204 Ga0055529_1000266
205 Ga0055526_1000867
206 Ga0055524_1000033
207 Ga0055530_10005855
208 Ga0055530_10012285
209 Ga0055540_1000371
210 Ga0055531_10005156
211 Ga0065165_1000910
212 Ga0070658_10252333
213 Ga0070676_10006653
214 Ga0070676_10313287
215 Ga0070670_100077634
216 Ga0068869_100105511
217 Ga0068869_100519084
218 Ga0070660_100035812
219 Ga0070669_100015464
220 Ga0070675_100007240
221 Ga0070671_100063844
222 Ga0070674_100013055
223 Ga0070673_100023576
224 Ga0070673_100033393
225 Ga0070667_100063303
226 Ga0070663_100014467
227 Ga0068867_100000074
228 Ga0068867_100009306
229 Ga0068867_100010126
230 Ga0068853_100257251
231 Ga0070672_100010723
232 Ga0070665_100296403
233 Ga0068855_100168653
234 Ga0068854_100023183
235 Ga0068859_100363585
236 Ga0068864_100004658
237 Ga0068861_100178811
238 Ga0068870_10066201
239 Ga0068863_100165541
240 Ga0075365_10099283
241 Ga0075364_10324765
242 Ga0075367_10203654
243 Ga0097621_100165679
244 Ga0097620_100363563
245 Ga0079104_1000408
246 Ga0105240_10346241
247 Ga0105245_10276484
248 Ga0114129_10108906
249 Ga0105243_10000513
250 Ga0105243_10032404
251 Ga0157374_10002968
252 Ga0157374_10349094
253 Ga0157374_10539464
254 Ga0163162_10151039
255 Ga0157375_10070357
256 Ga0163163_10365547
257 Ga0157377_10000006
258 Ga0157379_10013872
259 Ga0157376_10014686
260 Ga0163161_10019905
261 Ga0209258_100071
262 Ga0209148_1005491
263 Ga0209759_1001912
264 Ga0209759_1004524
265 Ga0209759_1008883
266 Ga0209129_1000119
267 Ga0209129_1022669
268 Ga0209455_1000030
269 Ga0209673_1027521
270 Ga0209564_1000024
271 Ga0209758_1000194
272 Ga0209758_1000249
273 Ga0209050_1000799
274 Ga0209050_1001065
275 Ga0209256_1000019
276 Ga0209256_1020666
277 Ga0209051_1000133
278 Ga0209257_1000038
279 Ga0207656_10062692
280 Ga0207682_10008136
281 Ga0207645_10178964
282 Ga0207645_10183436
283 Ga0207705_10020141
284 Ga0207695_10543489
285 Ga0207657_10087748
286 Ga0207650_10002095
287 Ga0207644_10085764
288 Ga0207709_10000398
289 Ga0207669_10036312
290 Ga0207691_10001394
291 Ga0207691_10164376
292 Ga0207689_10120537
293 Ga0207651_10045686
294 Ga0207639_10264058
295 Ga0207678_10000462
296 Ga0207648_10000039
297 Ga0207648_10001726
298 Ga0207648_10026857
299 Ga0207683_10014138
300 Ga0209281_1000023
301 Ga0307515_10000109
302 Ga0307515_10003752
303 Ga0307515_10217640
304 Ga0265324_10000363
305 Ga0307511_10026220
306 Ga0307512_10024484
307 Ga0307513_10005597
308 Ga0307513_10065728
309 Ga0307509_10000139
310 Ga0307408_100000072
311 Ga0307508_10184609
312 Ga0307516_10002737
313 Ga0307516_10005938
314 Ga0307518_10210605
315 Ga0307406_10108141
316 Ga0307414_10174592
317 Ga0307510_10000600
318 Ga0307510_10014748
319 Ga0307510_10033066
320 Ga0373932_0005049
321 Ga0373931_0002295
322 Ga0373931_0005642
323 Ga0373925_0111392
324 Ga0451791_1125361
325 Ga0451793_0895825
326 Ga0451807_1277053
327 Ga0451833_1288179
328 Ga0451577_0038236
329 Ga0466972_0035753
330 Ga0495592_0040283
331 Ga0495629_0048302
332 Ga0495650_0032700
333 Ga0495583_0000018
334 Ga0495606_0007222
335 Ga0495610_0027617
336 Ga0495620_0032944
337 Ga0495632_0008472
338 Ga0495632_0097661
339 Ga0495643_0111949
340 Ga0495652_0374567
341 Ga0495654_0000336
342 Ga0495625_0013922
343 Ga0495625_0042100
344 Ga0495669_0032315
345 Ga0495649_0024602
346 Ga0495589_0017515
347 Ga0495604_0095575
348 Ga0495676_0042369
349 Ga0495683_0123819
350 Ga0495686_0010243
351 Ga0495686_0089528
352 Ga0496102_0003021
353 Ga0496105_0299103
354 Ga0496105_0362391
355 Ga0496114_0020948
356 Ga0496121_0027593
357 Ga0496124_0000089
358 Ga0496125_0007669
359 nmdc:mga0yw44_78564_c1
360 nmdc:mga0k408_155007_c1
361 nmdc:mga0k408_65685_c2
362 nmdc:mga0k408_67033_c1
363 nmdc:mga06z11_173065_c1
364 nmdc:mga05p37_62844_c1
365 Ga0500635_0000021
366 Ga0500578_0000406
367 Ga0500644_0000609
368 Ga0500651_0034728
369 Ga0500562_042732
370 Ga0500594_0001113
371 Ga0500608_058511
372 Ga0500642_0003244
373 Ga0500559_0000114
374 Ga0500564_066954
375 Ga0500590_002913
376 Ga0500619_000148
377 Ga0500619_039179
378 Ga0500622_0001923
379 Ga0500636_0059125
380 Ga0500636_0208920
381 Ga0500587_007439
382 Ga0500587_011138
383 Ga0590075_010089
384 2548500450
385 2587729408
386 2587757144
387 2588290142
388 2643864556
389 2643967774
390 2643992832
391 2644140596
392 2644273563
393 2644291755
394 2644303692
395 2644647003
396 2990715135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07103

DUF1365

Protein of unknown function (DUF1365)

12

255

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kh8-assembly1.cif.gz_A crystal structure of maoc-like dehydratase from phytophthora capsici 0.6651 180 223
3kh8-assembly1.cif.gz_B crystal structure of maoc-like dehydratase from phytophthora capsici 0.6623 180 223
3hm0-assembly1.cif.gz_D crystal structure of probable thioesterase from bartonella henselae 0.6033 180 223
5jtp-assembly1.cif.gz_D the structure of chaperone secb in complex with unstructured prophoa binding site e 0.5872 182 225
1yoc-assembly1.cif.gz_B crystal structure of genomics apc5556 0.5665 179 225
ID Description Score Start End Superfamily
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6693 180 223 3.10.129.10
1wznC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;S-adenosyl-L-methionine-dependent methyltransferases 0.6597 180 222 2.20.25.110
af_C6TGE4_8_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6392 179 222 3.10.129.10
1nbwA04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.614 135 155 3.30.420.40
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6033 180 223 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A257LNF7-F1-model_v4 DUF1365 domain-containing protein 0.9745 20 190
AF-A0A257LNF7-F1-model_v4 DUF1365 domain-containing protein 0.9526 20 190
AF-A0A4Q5W7N1-F1-model_v4 deleted 0.9514 16 190
AF-A0A3D1MRS9-F1-model_v4 deleted 0.9181 16 153
AF-A0A0P9AN79-F1-model_v4 deleted 0.8936 21 232

Map