F305259
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 137 | 398 | 843 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10005340|rootL2_100053404 |
| Length | 899 |
| Sequence | VPCVGKSVTAEKPGHYQFVLIGYNLILRDNLFQLMQFRHLILACGLLTGAVPPLHAQAPFDASRIKVSWEVVENNHQGKAEFLSAFTIVNKGKTAFPAKGWQLYFNFVRSIKEGVTTGGVTAAHVNGDLYKISPADDSKSIAPGDSLRIEMVAEAWAVNFTDAPDGLYLVWDKEPAKGYRLAPLEIRPSTQPKQYLRFPGDKTALTTPADVYAQNRNIKDIPAEQLPLVFPTPQEVVPGTGAYALQAGVQINAAPAFAKEASYLSDELGKLLGTKPATGSGSGIALEQDASLAPEAYSLQVTPQGVTIRAADGAGMFYGIQTLKSILPPASWAGVQKTIQVPVIQVKDAPRYGYRAFMLDVSRNFHSKQDVLRLLEVMSLYKLNVFHFHLTDDEGWRLEIPGLPELTQVGGRRGHGVDEKEHLLPSYGSGPDVTDTAGSGFYTKQDFLEILKYANDRHITVIPEIETPGHARAAVKAMEARYAKLQAEGKQAEATQYLLSDLDDKSVYHSVQNWNDNVINVALPSVYTFLDKVVAELQAYYKEAGAPLEYVHMGGDEVPAGVWTKSPVVQALMQQDKTVKNTDDLWXXXXSKVYTLLKARGLKQYGWEEMGMRKTSVDGKPHYIPNPDFSNNGFMVDVWNNVMGGGAEDLAYRLANANYKVVLSGVSNLYFDMAYMKSFEEPGFYWGGFVDIDKPFYFIPENYYKNSKVDALGNRLNPDIFKGKDPLTAYGAGNIMGVQGLLWSETVKNSARMEYMILPKLLGLAERAWAKNPEWATEKDSARSEELYNKAWNTFVNVAGKRELVRLDHYNGGYNYRIPTPGLQVSNGAVAANIQLPGFTIRYTTDGKEPDSKSKVYTGPVTEKGTIRFKAFDTRGRSSRTATIINPLRAQTLSKGGDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 85 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 86 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 87 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 88 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 89 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 90 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 91 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 92 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 93 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 96 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 104 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 105 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 106 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 107 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 108 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 109 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 110 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 111 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 112 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 113 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 114 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 115 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 116 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 117 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 118 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 119 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 120 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 121 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 122 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 123 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 124 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 125 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 126 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 127 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 128 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 129 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 130 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 131 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 132 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 133 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 134 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 135 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 136 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 137 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.44 |
| Metatranscriptomes | 0 |
| Isolates | 12.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.06 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 72.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10005340 | 3300003322 | Bacteria | 26567 |
| 2 | SwRhRL2b_contig_901735 | 2162886007 | Bacteria | 8177 |
| 3 | JGI25162J39368_1000158 | 3300002737 | Bacteria | 74916 |
| 4 | JGI25165J46597_1001050 | 3300003214 | Bacteria | 17908 |
| 5 | rootH1_10003659 | 3300003316 | Bacteria | 6554 |
| 6 | rootH2_10002257 | 3300003320 | Bacteria | 28545 |
| 7 | rootH2_10006870 | 3300003320 | Bacteria | 6481 |
| 8 | rootH2_10056077 | 3300003320 | Bacteria | 10100 |
| 9 | rootL2_10000133 | 3300003322 | Bacteria | 40358 |
| 10 | rootL2_10169053 | 3300003322 | Bacteria | 3476 |
| 11 | rootH1_10012599 | 3300003323 | Bacteria | 111210 |
| 12 | rootH1_10025506 | 3300003323 | Bacteria | 18998 |
| 13 | rootH1_10232674 | 3300003323 | Bacteria | 7007 |
| 14 | Ga0055542_1003324 | 3300003762 | Unclassified | 4441 |
| 15 | Ga0055531_10000018 | 3300003794 | Bacteria | 175214 |
| 16 | Ga0055531_10000027 | 3300003794 | Bacteria | 160284 |
| 17 | Ga0065165_1003398 | 3300005262 | Bacteria | 11245 |
| 18 | Ga0065714_10002264 | 3300005288 | Bacteria | 49232 |
| 19 | Ga0065714_10002521 | 3300005288 | Bacteria | 15194 |
| 20 | Ga0065714_10069139 | 3300005288 | Bacteria | 4376 |
| 21 | Ga0065704_10000196 | 3300005289 | Bacteria | 186428 |
| 22 | Ga0065704_10072265 | 3300005289 | Bacteria | 8829 |
| 23 | Ga0070658_10000041 | 3300005327 | Bacteria | 134208 |
| 24 | Ga0070658_10033282 | 3300005327 | Bacteria | 4146 |
| 25 | Ga0070676_10001693 | 3300005328 | Bacteria | 11209 |
| 26 | Ga0070666_10000900 | 3300005335 | Bacteria | 18047 |
| 27 | Ga0068868_100031701 | 3300005338 | Bacteria | 4063 |
| 28 | Ga0070668_100002324 | 3300005347 | Bacteria | 13995 |
| 29 | Ga0070669_100020222 | 3300005353 | Bacteria | 4755 |
| 30 | Ga0070671_100021281 | 3300005355 | Bacteria | 5298 |
| 31 | Ga0070673_100011407 | 3300005364 | Bacteria | 6062 |
| 32 | Ga0070667_100007547 | 3300005367 | Bacteria | 9018 |
| 33 | Ga0070667_100059203 | 3300005367 | Bacteria | 3240 |
| 34 | Ga0070662_100003534 | 3300005457 | Bacteria | 9748 |
| 35 | Ga0068867_100001244 | 3300005459 | Bacteria | 17537 |
| 36 | Ga0068867_100007593 | 3300005459 | Bacteria | 7673 |
| 37 | Ga0068853_100007264 | 3300005539 | Bacteria | 8872 |
| 38 | Ga0070672_100000519 | 3300005543 | Bacteria | 22522 |
| 39 | Ga0070665_100005630 | 3300005548 | Bacteria | 12885 |
| 40 | Ga0068855_100000279 | 3300005563 | Bacteria | 63112 |
| 41 | Ga0068855_100000426 | 3300005563 | Bacteria | 52084 |
| 42 | Ga0068855_100106777 | 3300005563 | Bacteria | 3217 |
| 43 | Ga0068856_100001917 | 3300005614 | Bacteria | 21679 |
| 44 | Ga0068852_100004125 | 3300005616 | Bacteria | 10228 |
| 45 | Ga0068864_100003411 | 3300005618 | Bacteria | 13142 |
| 46 | Ga0068851_10014892 | 3300005834 | Bacteria | 3699 |
| 47 | Ga0068863_100000393 | 3300005841 | Bacteria | 44410 |
| 48 | Ga0068858_100005835 | 3300005842 | Bacteria | 12028 |
| 49 | Ga0097621_100000330 | 3300006237 | Bacteria | 32160 |
| 50 | Ga0097621_100001807 | 3300006237 | Bacteria | 14694 |
| 51 | Ga0097621_100024524 | 3300006237 | Bacteria | 4711 |
| 52 | Ga0068871_100000085 | 3300006358 | Bacteria | 53374 |
| 53 | Ga0068871_100016303 | 3300006358 | Bacteria | 5592 |
| 54 | Ga0068865_100000096 | 3300006881 | Bacteria | 46186 |
| 55 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 56 | Ga0105245_10071751 | 3300009098 | Bacteria | 3145 |
| 57 | Ga0105243_10000016 | 3300009148 | Bacteria | 235629 |
| 58 | Ga0105241_10001713 | 3300009174 | Bacteria | 16686 |
| 59 | Ga0105241_10031348 | 3300009174 | Bacteria | 3981 |
| 60 | Ga0105237_10000198 | 3300009545 | Bacteria | 85302 |
| 61 | Ga0105237_10001131 | 3300009545 | Bacteria | 35787 |
| 62 | Ga0105237_10002332 | 3300009545 | Bacteria | 23572 |
| 63 | Ga0105237_10003401 | 3300009545 | Bacteria | 18925 |
| 64 | Ga0105237_10003728 | 3300009545 | Bacteria | 17950 |
| 65 | Ga0105237_10010969 | 3300009545 | Bacteria | 9615 |
| 66 | Ga0105237_10021290 | 3300009545 | Bacteria | 6668 |
| 67 | Ga0105237_10030723 | 3300009545 | Bacteria | 5453 |
| 68 | Ga0105238_10001721 | 3300009551 | Bacteria | 22054 |
| 69 | Ga0105239_10000278 | 3300010375 | Bacteria | 75485 |
| 70 | Ga0105239_10000807 | 3300010375 | Bacteria | 44370 |
| 71 | Ga0105239_10019739 | 3300010375 | Bacteria | 7439 |
| 72 | Ga0105239_10021564 | 3300010375 | Bacteria | 7103 |
| 73 | Ga0105239_10048276 | 3300010375 | Bacteria | 4668 |
| 74 | Ga0157373_10000133 | 3300013100 | Bacteria | 58747 |
| 75 | Ga0157373_10007235 | 3300013100 | Bacteria | 8277 |
| 76 | Ga0157371_10000806 | 3300013102 | Bacteria | 35978 |
| 77 | Ga0157371_10001828 | 3300013102 | Bacteria | 21446 |
| 78 | Ga0157370_10002625 | 3300013104 | Bacteria | 21610 |
| 79 | Ga0157370_10060416 | 3300013104 | Bacteria | 3598 |
| 80 | Ga0157374_10000967 | 3300013296 | Bacteria | 24929 |
| 81 | Ga0157374_10001149 | 3300013296 | Bacteria | 22532 |
| 82 | Ga0157374_10010285 | 3300013296 | Bacteria | 8046 |
| 83 | Ga0163162_10000755 | 3300013306 | Bacteria | 30104 |
| 84 | Ga0163162_10003971 | 3300013306 | Bacteria | 14184 |
| 85 | Ga0157375_10000662 | 3300013308 | Bacteria | 30442 |
| 86 | Ga0163163_10002351 | 3300014325 | Bacteria | 16008 |
| 87 | Ga0163163_10002673 | 3300014325 | Bacteria | 15073 |
| 88 | Ga0182008_10000023 | 3300014497 | Bacteria | 201526 |
| 89 | Ga0182008_10000053 | 3300014497 | Bacteria | 102934 |
| 90 | Ga0182008_10000335 | 3300014497 | Bacteria | 36787 |
| 91 | Ga0157376_10001019 | 3300014969 | Bacteria | 18288 |
| 92 | Ga0157376_10030373 | 3300014969 | Bacteria | 4315 |
| 93 | Ga0182006_1000749 | 3300015261 | Bacteria | 22227 |
| 94 | Ga0182006_1001822 | 3300015261 | Bacteria | 12269 |
| 95 | Ga0182006_1001927 | 3300015261 | Bacteria | 11784 |
| 96 | Ga0163161_10000129 | 3300017792 | Bacteria | 70623 |
| 97 | Ga0163161_10001132 | 3300017792 | Bacteria | 20100 |
| 98 | Ga0163161_10005586 | 3300017792 | Bacteria | 8718 |
| 99 | Ga0209436_100156 | 3300025208 | Bacteria | 32902 |
| 100 | Ga0207427_100072 | 3300025231 | Bacteria | 158364 |
| 101 | Ga0209437_100026 | 3300025233 | Bacteria | 542698 |
| 102 | Ga0209437_100280 | 3300025233 | Bacteria | 74968 |
| 103 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 104 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 105 | Ga0209233_1000111 | 3300025261 | Bacteria | 260262 |
| 106 | Ga0209130_1002450 | 3300025284 | Bacteria | 9293 |
| 107 | Ga0207426_1000177 | 3300025302 | Bacteria | 159426 |
| 108 | Ga0207426_1004772 | 3300025302 | Bacteria | 6450 |
| 109 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 110 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 111 | Ga0207645_10000479 | 3300025907 | Bacteria | 33041 |
| 112 | Ga0207645_10001963 | 3300025907 | Bacteria | 16532 |
| 113 | Ga0207705_10000068 | 3300025909 | Bacteria | 134316 |
| 114 | Ga0207705_10016547 | 3300025909 | Bacteria | 5284 |
| 115 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 116 | Ga0207671_10000254 | 3300025914 | Bacteria | 79974 |
| 117 | Ga0207671_10001334 | 3300025914 | Bacteria | 28837 |
| 118 | Ga0207671_10002756 | 3300025914 | Bacteria | 18350 |
| 119 | Ga0207671_10002928 | 3300025914 | Bacteria | 17594 |
| 120 | Ga0207671_10003272 | 3300025914 | Bacteria | 16295 |
| 121 | Ga0207671_10003356 | 3300025914 | Bacteria | 16059 |
| 122 | Ga0207671_10008443 | 3300025914 | Bacteria | 8735 |
| 123 | Ga0207694_10042192 | 3300025924 | Bacteria | 3518 |
| 124 | Ga0207644_10023342 | 3300025931 | Bacteria | 4236 |
| 125 | Ga0207706_10003680 | 3300025933 | Bacteria | 14640 |
| 126 | Ga0207709_10000020 | 3300025935 | Bacteria | 392366 |
| 127 | Ga0207691_10000010 | 3300025940 | Bacteria | 150194 |
| 128 | Ga0207667_10000346 | 3300025949 | Bacteria | 63247 |
| 129 | Ga0207667_10005055 | 3300025949 | Bacteria | 16112 |
| 130 | Ga0207667_10087360 | 3300025949 | Bacteria | 3225 |
| 131 | Ga0207651_10014848 | 3300025960 | Bacteria | 4509 |
| 132 | Ga0207712_10029853 | 3300025961 | Bacteria | 3661 |
| 133 | Ga0207668_10000365 | 3300025972 | Bacteria | 28873 |
| 134 | Ga0207658_10002102 | 3300025986 | Bacteria | 14810 |
| 135 | Ga0207677_10003407 | 3300026023 | Bacteria | 8426 |
| 136 | Ga0207702_10001296 | 3300026078 | Bacteria | 25030 |
| 137 | Ga0207641_10011160 | 3300026088 | Bacteria | 7369 |
| 138 | Ga0207641_10033671 | 3300026088 | Bacteria | 4257 |
| 139 | Ga0207648_10005388 | 3300026089 | Bacteria | 12900 |
| 140 | Ga0207648_10009442 | 3300026089 | Bacteria | 9346 |
| 141 | Ga0207676_10008132 | 3300026095 | Bacteria | 7456 |
| 142 | Ga0268266_10007449 | 3300028379 | Bacteria | 9873 |
| 143 | Ga0307511_10000891 | 3300030521 | Bacteria | 31463 |
| 144 | Ga0316177_1139038 | 3300030731 | Bacteria | 2473 |
| 145 | Ga0316176_1025003 | 3300030732 | Bacteria | 24453 |
| 146 | Ga0316183_1079280 | 3300030742 | Bacteria | 54147 |
| 147 | Ga0316181_1095075 | 3300030744 | Bacteria | 28853 |
| 148 | Ga0307516_10055911 | 3300031730 | Bacteria | 3850 |
| 149 | Ga0307412_10000004 | 3300031911 | Bacteria | 544053 |
| 150 | Ga0307414_10003300 | 3300032004 | Bacteria | 8603 |
| 151 | Ga0307414_10004258 | 3300032004 | Bacteria | 7762 |
| 152 | Ga0307507_10000883 | 3300033179 | Bacteria | 66623 |
| 153 | Ga0373937_0088198 | 3300036401 | Bacteria | 2872 |
| 154 | Ga0395899_0000177 | 3300037312 | Bacteria | 94226 |
| 155 | Ga0395900_0000139 | 3300037418 | Bacteria | 122708 |
| 156 | Ga0395898_0028002 | 3300037466 | Bacteria | 5650 |
| 157 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 158 | Ga0395901_0031344 | 3300038443 | Bacteria | 5483 |
| 159 | Ga0495638_0000113 | 3300046460 | Bacteria | 129331 |
| 160 | Ga0495606_0018320 | 3300046507 | Bacteria | 5257 |
| 161 | Ga0495633_0000175 | 3300046558 | Bacteria | 83653 |
| 162 | Ga0495686_0000785 | 3300047472 | Bacteria | 41504 |
| 163 | Ga0496116_0001296 | 3300048919 | Bacteria | 28588 |
| 164 | Ga0496117_0002610 | 3300048920 | Bacteria | 22398 |
| 165 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 166 | Ga0496122_0000765 | 3300048925 | Bacteria | 62189 |
| 167 | Ga0496123_0005845 | 3300048926 | Bacteria | 12189 |
| 168 | Ga0496126_0030010 | 3300048929 | Bacteria | 5159 |
| 169 | Ga0501241_001810 | 3300049758 | Bacteria | 4215 |
| 170 | Ga0501284_00019 | 3300050005 | Bacteria | 92576 |
| 171 | Ga0500644_0000099 | 3300053088 | Bacteria | 54817 |
| 172 | Ga0500651_0000168 | 3300053093 | Bacteria | 42658 |
| 173 | Ga0500569_000174 | 3300053109 | Bacteria | 10197 |
| 174 | Ga0500622_0001639 | 3300053156 | Bacteria | 17526 |
| 175 | 2722725705 | 2721755487 | Bacteria | 6357185 |
| 176 | 2738756014 | 2738541283 | Bacteria | 7222293 |
| 177 | 2738759713 | 2738541283 | Bacteria | 7222293 |
| 178 | 2738763064 | 2738541284 | Bacteria | 5199923 |
| 179 | 2739300192 | 2738543023 | Bacteria | 6767879 |
| 180 | 2776614693 | 2775506987 | Bacteria | 5373360 |
| 181 | 2819573208 | 2818991442 | Bacteria | 8318214 |
| 182 | 2819681967 | 2818991460 | Bacteria | 7595395 |
| 183 | 2821136628 | 2821136567 | Bacteria | 8080116 |
| 184 | 2842906257 | 2842903701 | Bacteria | 6986368 |
| 185 | 2884796018 | 2884791551 | Bacteria | 8511252 |
| 186 | 2896345269 | 2896344016 | Bacteria | 3811746 |
| 187 | 2896347121 | 2896344016 | Bacteria | 3811746 |
| 188 | 2902051519 | 2902048731 | Bacteria | 4976191 |
| 189 | 2904468627 | 2904467357 | Bacteria | 8057758 |
| 190 | 2904782444 | 2904780799 | Bacteria | 5840761 |
| 191 | 2910245761 | 2910245624 | Bacteria | 6935613 |
| 192 | 2919178359 | 2919177583 | Bacteria | 5641607 |
| 193 | 2919187932 | 2919186247 | Bacteria | 6244071 |
| 194 | 2929178475 | 2929177148 | Bacteria | 7883697 |
| 195 | 2929240813 | 2929239360 | Bacteria | 7745570 |
| 196 | 2939664801 | 2939664404 | Bacteria | 6364494 |
| 197 | 2945980874 | 2945977869 | Bacteria | 7777518 |
| 198 | 2946019724 | 2946013367 | Bacteria | 7766675 |
| 199 | 8055591129 | 8055588893 | Bacteria | 3619545 |
| 200 | rootL2_10005340 | |||
| 201 | SwRhRL2b_contig_901735 | |||
| 202 | JGI25162J39368_1000158 | |||
| 203 | JGI25165J46597_1001050 | |||
| 204 | rootH1_10003659 | |||
| 205 | rootH2_10002257 | |||
| 206 | rootH2_10006870 | |||
| 207 | rootH2_10056077 | |||
| 208 | rootL2_10000133 | |||
| 209 | rootL2_10169053 | |||
| 210 | rootH1_10012599 | |||
| 211 | rootH1_10025506 | |||
| 212 | rootH1_10232674 | |||
| 213 | Ga0055542_1003324 | |||
| 214 | Ga0055531_10000018 | |||
| 215 | Ga0055531_10000027 | |||
| 216 | Ga0065165_1003398 | |||
| 217 | Ga0065714_10002264 | |||
| 218 | Ga0065714_10002521 | |||
| 219 | Ga0065714_10069139 | |||
| 220 | Ga0065704_10000196 | |||
| 221 | Ga0065704_10072265 | |||
| 222 | Ga0070658_10000041 | |||
| 223 | Ga0070658_10033282 | |||
| 224 | Ga0070676_10001693 | |||
| 225 | Ga0070666_10000900 | |||
| 226 | Ga0068868_100031701 | |||
| 227 | Ga0070668_100002324 | |||
| 228 | Ga0070669_100020222 | |||
| 229 | Ga0070671_100021281 | |||
| 230 | Ga0070673_100011407 | |||
| 231 | Ga0070667_100007547 | |||
| 232 | Ga0070667_100059203 | |||
| 233 | Ga0070662_100003534 | |||
| 234 | Ga0068867_100001244 | |||
| 235 | Ga0068867_100007593 | |||
| 236 | Ga0068853_100007264 | |||
| 237 | Ga0070672_100000519 | |||
| 238 | Ga0070665_100005630 | |||
| 239 | Ga0068855_100000279 | |||
| 240 | Ga0068855_100000426 | |||
| 241 | Ga0068855_100106777 | |||
| 242 | Ga0068856_100001917 | |||
| 243 | Ga0068852_100004125 | |||
| 244 | Ga0068864_100003411 | |||
| 245 | Ga0068851_10014892 | |||
| 246 | Ga0068863_100000393 | |||
| 247 | Ga0068858_100005835 | |||
| 248 | Ga0097621_100000330 | |||
| 249 | Ga0097621_100001807 | |||
| 250 | Ga0097621_100024524 | |||
| 251 | Ga0068871_100000085 | |||
| 252 | Ga0068871_100016303 | |||
| 253 | Ga0068865_100000096 | |||
| 254 | Ga0105240_10000083 | |||
| 255 | Ga0105245_10071751 | |||
| 256 | Ga0105243_10000016 | |||
| 257 | Ga0105241_10001713 | |||
| 258 | Ga0105241_10031348 | |||
| 259 | Ga0105237_10000198 | |||
| 260 | Ga0105237_10001131 | |||
| 261 | Ga0105237_10002332 | |||
| 262 | Ga0105237_10003401 | |||
| 263 | Ga0105237_10003728 | |||
| 264 | Ga0105237_10010969 | |||
| 265 | Ga0105237_10021290 | |||
| 266 | Ga0105237_10030723 | |||
| 267 | Ga0105238_10001721 | |||
| 268 | Ga0105239_10000278 | |||
| 269 | Ga0105239_10000807 | |||
| 270 | Ga0105239_10019739 | |||
| 271 | Ga0105239_10021564 | |||
| 272 | Ga0105239_10048276 | |||
| 273 | Ga0157373_10000133 | |||
| 274 | Ga0157373_10007235 | |||
| 275 | Ga0157371_10000806 | |||
| 276 | Ga0157371_10001828 | |||
| 277 | Ga0157370_10002625 | |||
| 278 | Ga0157370_10060416 | |||
| 279 | Ga0157374_10000967 | |||
| 280 | Ga0157374_10001149 | |||
| 281 | Ga0157374_10010285 | |||
| 282 | Ga0163162_10000755 | |||
| 283 | Ga0163162_10003971 | |||
| 284 | Ga0157375_10000662 | |||
| 285 | Ga0163163_10002351 | |||
| 286 | Ga0163163_10002673 | |||
| 287 | Ga0182008_10000023 | |||
| 288 | Ga0182008_10000053 | |||
| 289 | Ga0182008_10000335 | |||
| 290 | Ga0157376_10001019 | |||
| 291 | Ga0157376_10030373 | |||
| 292 | Ga0182006_1000749 | |||
| 293 | Ga0182006_1001822 | |||
| 294 | Ga0182006_1001927 | |||
| 295 | Ga0163161_10000129 | |||
| 296 | Ga0163161_10001132 | |||
| 297 | Ga0163161_10005586 | |||
| 298 | Ga0209436_100156 | |||
| 299 | Ga0207427_100072 | |||
| 300 | Ga0209437_100026 | |||
| 301 | Ga0209437_100280 | |||
| 302 | Ga0209258_100041 | |||
| 303 | Ga0209148_1000090 | |||
| 304 | Ga0209233_1000111 | |||
| 305 | Ga0209130_1002450 | |||
| 306 | Ga0207426_1000177 | |||
| 307 | Ga0207426_1004772 | |||
| 308 | Ga0209257_1000001 | |||
| 309 | Ga0209257_1000023 | |||
| 310 | Ga0207645_10000479 | |||
| 311 | Ga0207645_10001963 | |||
| 312 | Ga0207705_10000068 | |||
| 313 | Ga0207705_10016547 | |||
| 314 | Ga0207695_10000127 | |||
| 315 | Ga0207671_10000254 | |||
| 316 | Ga0207671_10001334 | |||
| 317 | Ga0207671_10002756 | |||
| 318 | Ga0207671_10002928 | |||
| 319 | Ga0207671_10003272 | |||
| 320 | Ga0207671_10003356 | |||
| 321 | Ga0207671_10008443 | |||
| 322 | Ga0207694_10042192 | |||
| 323 | Ga0207644_10023342 | |||
| 324 | Ga0207706_10003680 | |||
| 325 | Ga0207709_10000020 | |||
| 326 | Ga0207691_10000010 | |||
| 327 | Ga0207667_10000346 | |||
| 328 | Ga0207667_10005055 | |||
| 329 | Ga0207667_10087360 | |||
| 330 | Ga0207651_10014848 | |||
| 331 | Ga0207712_10029853 | |||
| 332 | Ga0207668_10000365 | |||
| 333 | Ga0207658_10002102 | |||
| 334 | Ga0207677_10003407 | |||
| 335 | Ga0207702_10001296 | |||
| 336 | Ga0207641_10011160 | |||
| 337 | Ga0207641_10033671 | |||
| 338 | Ga0207648_10005388 | |||
| 339 | Ga0207648_10009442 | |||
| 340 | Ga0207676_10008132 | |||
| 341 | Ga0268266_10007449 | |||
| 342 | Ga0307511_10000891 | |||
| 343 | Ga0316177_1139038 | |||
| 344 | Ga0316176_1025003 | |||
| 345 | Ga0316183_1079280 | |||
| 346 | Ga0316181_1095075 | |||
| 347 | Ga0307516_10055911 | |||
| 348 | Ga0307412_10000004 | |||
| 349 | Ga0307414_10003300 | |||
| 350 | Ga0307414_10004258 | |||
| 351 | Ga0307507_10000883 | |||
| 352 | Ga0373937_0088198 | |||
| 353 | Ga0395899_0000177 | |||
| 354 | Ga0395900_0000139 | |||
| 355 | Ga0395898_0028002 | |||
| 356 | Ga0395905_0000169 | |||
| 357 | Ga0395901_0031344 | |||
| 358 | Ga0495638_0000113 | |||
| 359 | Ga0495606_0018320 | |||
| 360 | Ga0495633_0000175 | |||
| 361 | Ga0495686_0000785 | |||
| 362 | Ga0496116_0001296 | |||
| 363 | Ga0496117_0002610 | |||
| 364 | Ga0496121_0000030 | |||
| 365 | Ga0496122_0000765 | |||
| 366 | Ga0496123_0005845 | |||
| 367 | Ga0496126_0030010 | |||
| 368 | Ga0501241_001810 | |||
| 369 | Ga0501284_00019 | |||
| 370 | Ga0500644_0000099 | |||
| 371 | Ga0500651_0000168 | |||
| 372 | Ga0500569_000174 | |||
| 373 | Ga0500622_0001639 | |||
| 374 | 2722725705 | |||
| 375 | 2738756014 | |||
| 376 | 2738759713 | |||
| 377 | 2738763064 | |||
| 378 | 2739300192 | |||
| 379 | 2776614693 | |||
| 380 | 2819573208 | |||
| 381 | 2819681967 | |||
| 382 | 2821136628 | |||
| 383 | 2842906257 | |||
| 384 | 2884796018 | |||
| 385 | 2896345269 | |||
| 386 | 2896347121 | |||
| 387 | 2902051519 | |||
| 388 | 2904468627 | |||
| 389 | 2904782444 | |||
| 390 | 2910245761 | |||
| 391 | 2919178359 | |||
| 392 | 2919187932 | |||
| 393 | 2929178475 | |||
| 394 | 2929240813 | |||
| 395 | 2939664801 | |||
| 396 | 2945980874 | |||
| 397 | 2946019724 | |||
| 398 | 8055591129 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ezt-assembly2.cif.gz_B | crystal structure of gh20 exo beta-n-acetylglucosaminidase d437a inactive mutant from vibrio harveyi | 0.8754 | 30 | 772 |
| 6ezt-assembly2.cif.gz_B | crystal structure of gh20 exo beta-n-acetylglucosaminidase d437a inactive mutant from vibrio harveyi | 0.8678 | 30 | 772 |
| 1c7s-assembly1.cif.gz_A-2 | beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl-beta-d-glucosamine (chitobiase) | 0.8627 | 28 | 839 |
| 1c7t-assembly1.cif.gz_A-2 | beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d-glucosamine (chitobiase) | 0.8619 | 28 | 839 |
| 1qba-assembly1.cif.gz_A | bacterial chitobiase, glycosyl hydrolase family 20 | 0.8602 | 28 | 839 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rcnA01 | Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like | 0.8923 | 181 | 306 | 3.30.379.10 |
| 3gh7A02 | Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like | 0.8908 | 181 | 308 | 3.30.379.10 |
| 1qbbA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.887 | 307 | 773 | 3.20.20.80 |
| 1qbbA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8548 | 307 | 773 | 3.20.20.80 |
| 4pysB01 | Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like | 0.8539 | 181 | 307 | 3.30.379.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1ZZ41-F1-model_v4 | beta-N-acetylhexosaminidase (EC 3.2.1.52) | 0.9804 | 156 | 461 |
GO:0005975
GO:0016020 GO:0016231 GO:0030203 |
| AF-A0A519XS57-F1-model_v4 | beta-N-acetylhexosaminidase (EC 3.2.1.52) | 0.9769 | 453 | 841 |
GO:0005975
GO:0016020 GO:0016231 GO:0030203 |
| AF-A0A1S9PAA5-F1-model_v4 | beta-N-acetylhexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) | 0.9759 | 18 | 838 |
GO:0005975
GO:0016020 GO:0016231 GO:0030203 GO:0030247 |
| AF-A0A561IQR1-F1-model_v4 | deleted | 0.9722 | 20 | 841 |
|
| AF-A0A2U2PL09-F1-model_v4 | beta-N-acetylhexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) | 0.9701 | 19 | 841 |
GO:0005975
GO:0016020 GO:0016231 GO:0030203 GO:0030247 |