F305259

General Info

Members Datasets Scaffolds Average Seq Length
199 137 398 843

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10005340|rootL2_100053404
Length 899
Sequence VPCVGKSVTAEKPGHYQFVLIGYNLILRDNLFQLMQFRHLILACGLLTGAVPPLHAQAPFDASRIKVSWEVVENNHQGKAEFLSAFTIVNKGKTAFPAKGWQLYFNFVRSIKEGVTTGGVTAAHVNGDLYKISPADDSKSIAPGDSLRIEMVAEAWAVNFTDAPDGLYLVWDKEPAKGYRLAPLEIRPSTQPKQYLRFPGDKTALTTPADVYAQNRNIKDIPAEQLPLVFPTPQEVVPGTGAYALQAGVQINAAPAFAKEASYLSDELGKLLGTKPATGSGSGIALEQDASLAPEAYSLQVTPQGVTIRAADGAGMFYGIQTLKSILPPASWAGVQKTIQVPVIQVKDAPRYGYRAFMLDVSRNFHSKQDVLRLLEVMSLYKLNVFHFHLTDDEGWRLEIPGLPELTQVGGRRGHGVDEKEHLLPSYGSGPDVTDTAGSGFYTKQDFLEILKYANDRHITVIPEIETPGHARAAVKAMEARYAKLQAEGKQAEATQYLLSDLDDKSVYHSVQNWNDNVINVALPSVYTFLDKVVAELQAYYKEAGAPLEYVHMGGDEVPAGVWTKSPVVQALMQQDKTVKNTDDLWXXXXSKVYTLLKARGLKQYGWEEMGMRKTSVDGKPHYIPNPDFSNNGFMVDVWNNVMGGGAEDLAYRLANANYKVVLSGVSNLYFDMAYMKSFEEPGFYWGGFVDIDKPFYFIPENYYKNSKVDALGNRLNPDIFKGKDPLTAYGAGNIMGVQGLLWSETVKNSARMEYMILPKLLGLAERAWAKNPEWATEKDSARSEELYNKAWNTFVNVAGKRELVRLDHYNGGYNYRIPTPGLQVSNGAVAANIQLPGFTIRYTTDGKEPDSKSKVYTGPVTEKGTIRFKAFDTRGRSSRTATIINPLRAQTLSKGGDL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
86 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
87 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
88 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
110 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
115 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
116 2738541283 Pedobacter sp. OK701 Isolate Unclassified
117 2738541284 Pedobacter sp. YR016 Isolate Unclassified
118 2738543023 Pedobacter sp. OK628 Isolate Unclassified
119 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
120 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
121 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
122 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
123 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
124 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
125 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
126 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
127 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
128 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
129 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
130 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
131 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
132 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
133 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
134 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
135 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
136 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
137 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.44
Metatranscriptomes 0
Isolates 12.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.06
Nodule 0
Rhizoplane 0
Rhizosphere 72.86
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10005340 3300003322 Bacteria 26567
2 SwRhRL2b_contig_901735 2162886007 Bacteria 8177
3 JGI25162J39368_1000158 3300002737 Bacteria 74916
4 JGI25165J46597_1001050 3300003214 Bacteria 17908
5 rootH1_10003659 3300003316 Bacteria 6554
6 rootH2_10002257 3300003320 Bacteria 28545
7 rootH2_10006870 3300003320 Bacteria 6481
8 rootH2_10056077 3300003320 Bacteria 10100
9 rootL2_10000133 3300003322 Bacteria 40358
10 rootL2_10169053 3300003322 Bacteria 3476
11 rootH1_10012599 3300003323 Bacteria 111210
12 rootH1_10025506 3300003323 Bacteria 18998
13 rootH1_10232674 3300003323 Bacteria 7007
14 Ga0055542_1003324 3300003762 Unclassified 4441
15 Ga0055531_10000018 3300003794 Bacteria 175214
16 Ga0055531_10000027 3300003794 Bacteria 160284
17 Ga0065165_1003398 3300005262 Bacteria 11245
18 Ga0065714_10002264 3300005288 Bacteria 49232
19 Ga0065714_10002521 3300005288 Bacteria 15194
20 Ga0065714_10069139 3300005288 Bacteria 4376
21 Ga0065704_10000196 3300005289 Bacteria 186428
22 Ga0065704_10072265 3300005289 Bacteria 8829
23 Ga0070658_10000041 3300005327 Bacteria 134208
24 Ga0070658_10033282 3300005327 Bacteria 4146
25 Ga0070676_10001693 3300005328 Bacteria 11209
26 Ga0070666_10000900 3300005335 Bacteria 18047
27 Ga0068868_100031701 3300005338 Bacteria 4063
28 Ga0070668_100002324 3300005347 Bacteria 13995
29 Ga0070669_100020222 3300005353 Bacteria 4755
30 Ga0070671_100021281 3300005355 Bacteria 5298
31 Ga0070673_100011407 3300005364 Bacteria 6062
32 Ga0070667_100007547 3300005367 Bacteria 9018
33 Ga0070667_100059203 3300005367 Bacteria 3240
34 Ga0070662_100003534 3300005457 Bacteria 9748
35 Ga0068867_100001244 3300005459 Bacteria 17537
36 Ga0068867_100007593 3300005459 Bacteria 7673
37 Ga0068853_100007264 3300005539 Bacteria 8872
38 Ga0070672_100000519 3300005543 Bacteria 22522
39 Ga0070665_100005630 3300005548 Bacteria 12885
40 Ga0068855_100000279 3300005563 Bacteria 63112
41 Ga0068855_100000426 3300005563 Bacteria 52084
42 Ga0068855_100106777 3300005563 Bacteria 3217
43 Ga0068856_100001917 3300005614 Bacteria 21679
44 Ga0068852_100004125 3300005616 Bacteria 10228
45 Ga0068864_100003411 3300005618 Bacteria 13142
46 Ga0068851_10014892 3300005834 Bacteria 3699
47 Ga0068863_100000393 3300005841 Bacteria 44410
48 Ga0068858_100005835 3300005842 Bacteria 12028
49 Ga0097621_100000330 3300006237 Bacteria 32160
50 Ga0097621_100001807 3300006237 Bacteria 14694
51 Ga0097621_100024524 3300006237 Bacteria 4711
52 Ga0068871_100000085 3300006358 Bacteria 53374
53 Ga0068871_100016303 3300006358 Bacteria 5592
54 Ga0068865_100000096 3300006881 Bacteria 46186
55 Ga0105240_10000083 3300009093 Bacteria 192934
56 Ga0105245_10071751 3300009098 Bacteria 3145
57 Ga0105243_10000016 3300009148 Bacteria 235629
58 Ga0105241_10001713 3300009174 Bacteria 16686
59 Ga0105241_10031348 3300009174 Bacteria 3981
60 Ga0105237_10000198 3300009545 Bacteria 85302
61 Ga0105237_10001131 3300009545 Bacteria 35787
62 Ga0105237_10002332 3300009545 Bacteria 23572
63 Ga0105237_10003401 3300009545 Bacteria 18925
64 Ga0105237_10003728 3300009545 Bacteria 17950
65 Ga0105237_10010969 3300009545 Bacteria 9615
66 Ga0105237_10021290 3300009545 Bacteria 6668
67 Ga0105237_10030723 3300009545 Bacteria 5453
68 Ga0105238_10001721 3300009551 Bacteria 22054
69 Ga0105239_10000278 3300010375 Bacteria 75485
70 Ga0105239_10000807 3300010375 Bacteria 44370
71 Ga0105239_10019739 3300010375 Bacteria 7439
72 Ga0105239_10021564 3300010375 Bacteria 7103
73 Ga0105239_10048276 3300010375 Bacteria 4668
74 Ga0157373_10000133 3300013100 Bacteria 58747
75 Ga0157373_10007235 3300013100 Bacteria 8277
76 Ga0157371_10000806 3300013102 Bacteria 35978
77 Ga0157371_10001828 3300013102 Bacteria 21446
78 Ga0157370_10002625 3300013104 Bacteria 21610
79 Ga0157370_10060416 3300013104 Bacteria 3598
80 Ga0157374_10000967 3300013296 Bacteria 24929
81 Ga0157374_10001149 3300013296 Bacteria 22532
82 Ga0157374_10010285 3300013296 Bacteria 8046
83 Ga0163162_10000755 3300013306 Bacteria 30104
84 Ga0163162_10003971 3300013306 Bacteria 14184
85 Ga0157375_10000662 3300013308 Bacteria 30442
86 Ga0163163_10002351 3300014325 Bacteria 16008
87 Ga0163163_10002673 3300014325 Bacteria 15073
88 Ga0182008_10000023 3300014497 Bacteria 201526
89 Ga0182008_10000053 3300014497 Bacteria 102934
90 Ga0182008_10000335 3300014497 Bacteria 36787
91 Ga0157376_10001019 3300014969 Bacteria 18288
92 Ga0157376_10030373 3300014969 Bacteria 4315
93 Ga0182006_1000749 3300015261 Bacteria 22227
94 Ga0182006_1001822 3300015261 Bacteria 12269
95 Ga0182006_1001927 3300015261 Bacteria 11784
96 Ga0163161_10000129 3300017792 Bacteria 70623
97 Ga0163161_10001132 3300017792 Bacteria 20100
98 Ga0163161_10005586 3300017792 Bacteria 8718
99 Ga0209436_100156 3300025208 Bacteria 32902
100 Ga0207427_100072 3300025231 Bacteria 158364
101 Ga0209437_100026 3300025233 Bacteria 542698
102 Ga0209437_100280 3300025233 Bacteria 74968
103 Ga0209258_100041 3300025242 Bacteria 381381
104 Ga0209148_1000090 3300025254 Bacteria 250982
105 Ga0209233_1000111 3300025261 Bacteria 260262
106 Ga0209130_1002450 3300025284 Bacteria 9293
107 Ga0207426_1000177 3300025302 Bacteria 159426
108 Ga0207426_1004772 3300025302 Bacteria 6450
109 Ga0209257_1000001 3300025304 Bacteria 2274655
110 Ga0209257_1000023 3300025304 Bacteria 753019
111 Ga0207645_10000479 3300025907 Bacteria 33041
112 Ga0207645_10001963 3300025907 Bacteria 16532
113 Ga0207705_10000068 3300025909 Bacteria 134316
114 Ga0207705_10016547 3300025909 Bacteria 5284
115 Ga0207695_10000127 3300025913 Bacteria 227338
116 Ga0207671_10000254 3300025914 Bacteria 79974
117 Ga0207671_10001334 3300025914 Bacteria 28837
118 Ga0207671_10002756 3300025914 Bacteria 18350
119 Ga0207671_10002928 3300025914 Bacteria 17594
120 Ga0207671_10003272 3300025914 Bacteria 16295
121 Ga0207671_10003356 3300025914 Bacteria 16059
122 Ga0207671_10008443 3300025914 Bacteria 8735
123 Ga0207694_10042192 3300025924 Bacteria 3518
124 Ga0207644_10023342 3300025931 Bacteria 4236
125 Ga0207706_10003680 3300025933 Bacteria 14640
126 Ga0207709_10000020 3300025935 Bacteria 392366
127 Ga0207691_10000010 3300025940 Bacteria 150194
128 Ga0207667_10000346 3300025949 Bacteria 63247
129 Ga0207667_10005055 3300025949 Bacteria 16112
130 Ga0207667_10087360 3300025949 Bacteria 3225
131 Ga0207651_10014848 3300025960 Bacteria 4509
132 Ga0207712_10029853 3300025961 Bacteria 3661
133 Ga0207668_10000365 3300025972 Bacteria 28873
134 Ga0207658_10002102 3300025986 Bacteria 14810
135 Ga0207677_10003407 3300026023 Bacteria 8426
136 Ga0207702_10001296 3300026078 Bacteria 25030
137 Ga0207641_10011160 3300026088 Bacteria 7369
138 Ga0207641_10033671 3300026088 Bacteria 4257
139 Ga0207648_10005388 3300026089 Bacteria 12900
140 Ga0207648_10009442 3300026089 Bacteria 9346
141 Ga0207676_10008132 3300026095 Bacteria 7456
142 Ga0268266_10007449 3300028379 Bacteria 9873
143 Ga0307511_10000891 3300030521 Bacteria 31463
144 Ga0316177_1139038 3300030731 Bacteria 2473
145 Ga0316176_1025003 3300030732 Bacteria 24453
146 Ga0316183_1079280 3300030742 Bacteria 54147
147 Ga0316181_1095075 3300030744 Bacteria 28853
148 Ga0307516_10055911 3300031730 Bacteria 3850
149 Ga0307412_10000004 3300031911 Bacteria 544053
150 Ga0307414_10003300 3300032004 Bacteria 8603
151 Ga0307414_10004258 3300032004 Bacteria 7762
152 Ga0307507_10000883 3300033179 Bacteria 66623
153 Ga0373937_0088198 3300036401 Bacteria 2872
154 Ga0395899_0000177 3300037312 Bacteria 94226
155 Ga0395900_0000139 3300037418 Bacteria 122708
156 Ga0395898_0028002 3300037466 Bacteria 5650
157 Ga0395905_0000169 3300037471 Bacteria 106579
158 Ga0395901_0031344 3300038443 Bacteria 5483
159 Ga0495638_0000113 3300046460 Bacteria 129331
160 Ga0495606_0018320 3300046507 Bacteria 5257
161 Ga0495633_0000175 3300046558 Bacteria 83653
162 Ga0495686_0000785 3300047472 Bacteria 41504
163 Ga0496116_0001296 3300048919 Bacteria 28588
164 Ga0496117_0002610 3300048920 Bacteria 22398
165 Ga0496121_0000030 3300048924 Bacteria 412079
166 Ga0496122_0000765 3300048925 Bacteria 62189
167 Ga0496123_0005845 3300048926 Bacteria 12189
168 Ga0496126_0030010 3300048929 Bacteria 5159
169 Ga0501241_001810 3300049758 Bacteria 4215
170 Ga0501284_00019 3300050005 Bacteria 92576
171 Ga0500644_0000099 3300053088 Bacteria 54817
172 Ga0500651_0000168 3300053093 Bacteria 42658
173 Ga0500569_000174 3300053109 Bacteria 10197
174 Ga0500622_0001639 3300053156 Bacteria 17526
175 2722725705 2721755487 Bacteria 6357185
176 2738756014 2738541283 Bacteria 7222293
177 2738759713 2738541283 Bacteria 7222293
178 2738763064 2738541284 Bacteria 5199923
179 2739300192 2738543023 Bacteria 6767879
180 2776614693 2775506987 Bacteria 5373360
181 2819573208 2818991442 Bacteria 8318214
182 2819681967 2818991460 Bacteria 7595395
183 2821136628 2821136567 Bacteria 8080116
184 2842906257 2842903701 Bacteria 6986368
185 2884796018 2884791551 Bacteria 8511252
186 2896345269 2896344016 Bacteria 3811746
187 2896347121 2896344016 Bacteria 3811746
188 2902051519 2902048731 Bacteria 4976191
189 2904468627 2904467357 Bacteria 8057758
190 2904782444 2904780799 Bacteria 5840761
191 2910245761 2910245624 Bacteria 6935613
192 2919178359 2919177583 Bacteria 5641607
193 2919187932 2919186247 Bacteria 6244071
194 2929178475 2929177148 Bacteria 7883697
195 2929240813 2929239360 Bacteria 7745570
196 2939664801 2939664404 Bacteria 6364494
197 2945980874 2945977869 Bacteria 7777518
198 2946019724 2946013367 Bacteria 7766675
199 8055591129 8055588893 Bacteria 3619545
200 rootL2_10005340
201 SwRhRL2b_contig_901735
202 JGI25162J39368_1000158
203 JGI25165J46597_1001050
204 rootH1_10003659
205 rootH2_10002257
206 rootH2_10006870
207 rootH2_10056077
208 rootL2_10000133
209 rootL2_10169053
210 rootH1_10012599
211 rootH1_10025506
212 rootH1_10232674
213 Ga0055542_1003324
214 Ga0055531_10000018
215 Ga0055531_10000027
216 Ga0065165_1003398
217 Ga0065714_10002264
218 Ga0065714_10002521
219 Ga0065714_10069139
220 Ga0065704_10000196
221 Ga0065704_10072265
222 Ga0070658_10000041
223 Ga0070658_10033282
224 Ga0070676_10001693
225 Ga0070666_10000900
226 Ga0068868_100031701
227 Ga0070668_100002324
228 Ga0070669_100020222
229 Ga0070671_100021281
230 Ga0070673_100011407
231 Ga0070667_100007547
232 Ga0070667_100059203
233 Ga0070662_100003534
234 Ga0068867_100001244
235 Ga0068867_100007593
236 Ga0068853_100007264
237 Ga0070672_100000519
238 Ga0070665_100005630
239 Ga0068855_100000279
240 Ga0068855_100000426
241 Ga0068855_100106777
242 Ga0068856_100001917
243 Ga0068852_100004125
244 Ga0068864_100003411
245 Ga0068851_10014892
246 Ga0068863_100000393
247 Ga0068858_100005835
248 Ga0097621_100000330
249 Ga0097621_100001807
250 Ga0097621_100024524
251 Ga0068871_100000085
252 Ga0068871_100016303
253 Ga0068865_100000096
254 Ga0105240_10000083
255 Ga0105245_10071751
256 Ga0105243_10000016
257 Ga0105241_10001713
258 Ga0105241_10031348
259 Ga0105237_10000198
260 Ga0105237_10001131
261 Ga0105237_10002332
262 Ga0105237_10003401
263 Ga0105237_10003728
264 Ga0105237_10010969
265 Ga0105237_10021290
266 Ga0105237_10030723
267 Ga0105238_10001721
268 Ga0105239_10000278
269 Ga0105239_10000807
270 Ga0105239_10019739
271 Ga0105239_10021564
272 Ga0105239_10048276
273 Ga0157373_10000133
274 Ga0157373_10007235
275 Ga0157371_10000806
276 Ga0157371_10001828
277 Ga0157370_10002625
278 Ga0157370_10060416
279 Ga0157374_10000967
280 Ga0157374_10001149
281 Ga0157374_10010285
282 Ga0163162_10000755
283 Ga0163162_10003971
284 Ga0157375_10000662
285 Ga0163163_10002351
286 Ga0163163_10002673
287 Ga0182008_10000023
288 Ga0182008_10000053
289 Ga0182008_10000335
290 Ga0157376_10001019
291 Ga0157376_10030373
292 Ga0182006_1000749
293 Ga0182006_1001822
294 Ga0182006_1001927
295 Ga0163161_10000129
296 Ga0163161_10001132
297 Ga0163161_10005586
298 Ga0209436_100156
299 Ga0207427_100072
300 Ga0209437_100026
301 Ga0209437_100280
302 Ga0209258_100041
303 Ga0209148_1000090
304 Ga0209233_1000111
305 Ga0209130_1002450
306 Ga0207426_1000177
307 Ga0207426_1004772
308 Ga0209257_1000001
309 Ga0209257_1000023
310 Ga0207645_10000479
311 Ga0207645_10001963
312 Ga0207705_10000068
313 Ga0207705_10016547
314 Ga0207695_10000127
315 Ga0207671_10000254
316 Ga0207671_10001334
317 Ga0207671_10002756
318 Ga0207671_10002928
319 Ga0207671_10003272
320 Ga0207671_10003356
321 Ga0207671_10008443
322 Ga0207694_10042192
323 Ga0207644_10023342
324 Ga0207706_10003680
325 Ga0207709_10000020
326 Ga0207691_10000010
327 Ga0207667_10000346
328 Ga0207667_10005055
329 Ga0207667_10087360
330 Ga0207651_10014848
331 Ga0207712_10029853
332 Ga0207668_10000365
333 Ga0207658_10002102
334 Ga0207677_10003407
335 Ga0207702_10001296
336 Ga0207641_10011160
337 Ga0207641_10033671
338 Ga0207648_10005388
339 Ga0207648_10009442
340 Ga0207676_10008132
341 Ga0268266_10007449
342 Ga0307511_10000891
343 Ga0316177_1139038
344 Ga0316176_1025003
345 Ga0316183_1079280
346 Ga0316181_1095075
347 Ga0307516_10055911
348 Ga0307412_10000004
349 Ga0307414_10003300
350 Ga0307414_10004258
351 Ga0307507_10000883
352 Ga0373937_0088198
353 Ga0395899_0000177
354 Ga0395900_0000139
355 Ga0395898_0028002
356 Ga0395905_0000169
357 Ga0395901_0031344
358 Ga0495638_0000113
359 Ga0495606_0018320
360 Ga0495633_0000175
361 Ga0495686_0000785
362 Ga0496116_0001296
363 Ga0496117_0002610
364 Ga0496121_0000030
365 Ga0496122_0000765
366 Ga0496123_0005845
367 Ga0496126_0030010
368 Ga0501241_001810
369 Ga0501284_00019
370 Ga0500644_0000099
371 Ga0500651_0000168
372 Ga0500569_000174
373 Ga0500622_0001639
374 2722725705
375 2738756014
376 2738759713
377 2738763064
378 2739300192
379 2776614693
380 2819573208
381 2819681967
382 2821136628
383 2842906257
384 2884796018
385 2896345269
386 2896347121
387 2902051519
388 2904468627
389 2904782444
390 2910245761
391 2919178359
392 2919187932
393 2929178475
394 2929240813
395 2939664801
396 2945980874
397 2946019724
398 8055591129

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03174

CHB_HEX_C

Chitobiase/beta-hexosaminidase C-terminal domain

803

881

0.96

PF00728

Glyco_hydro_20

Glycosyl hydrolase family 20, catalytic domain

352

772

0.9

PF02838

Glyco_hydro_20b

Glycosyl hydrolase family 20, domain 2

226

349

0.88

PF13290

CHB_HEX_C_1

Chitobiase/beta-hexosaminidase C-terminal domain

819

883

0.87

PF13287

Fn3_assoc

Fn3 associated

833

884

0.81

PF03173

CHB_HEX

Putative carbohydrate binding domain

64

209

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ezt-assembly2.cif.gz_B crystal structure of gh20 exo beta-n-acetylglucosaminidase d437a inactive mutant from vibrio harveyi 0.8754 30 772
6ezt-assembly2.cif.gz_B crystal structure of gh20 exo beta-n-acetylglucosaminidase d437a inactive mutant from vibrio harveyi 0.8678 30 772
1c7s-assembly1.cif.gz_A-2 beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl-beta-d-glucosamine (chitobiase) 0.8627 28 839
1c7t-assembly1.cif.gz_A-2 beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d-glucosamine (chitobiase) 0.8619 28 839
1qba-assembly1.cif.gz_A bacterial chitobiase, glycosyl hydrolase family 20 0.8602 28 839
ID Description Score Start End Superfamily
3rcnA01 Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like 0.8923 181 306 3.30.379.10
3gh7A02 Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like 0.8908 181 308 3.30.379.10
1qbbA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.887 307 773 3.20.20.80
1qbbA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8548 307 773 3.20.20.80
4pysB01 Alpha Beta;2-Layer Sandwich;Chitobiase; domain 2;Chitobiase/beta-hexosaminidase domain 2-like 0.8539 181 307 3.30.379.10
ID Description Score Start End GO Terms
AF-A0A4V1ZZ41-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9804 156 461 GO:0005975
GO:0016020
GO:0016231
GO:0030203
AF-A0A519XS57-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9769 453 841 GO:0005975
GO:0016020
GO:0016231
GO:0030203
AF-A0A1S9PAA5-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9759 18 838 GO:0005975
GO:0016020
GO:0016231
GO:0030203
GO:0030247
AF-A0A561IQR1-F1-model_v4 deleted 0.9722 20 841
AF-A0A2U2PL09-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9701 19 841 GO:0005975
GO:0016020
GO:0016231
GO:0030203
GO:0030247

Map