F306199

General Info

Members Datasets Scaffolds Average Seq Length
199 120 398 86

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0000060|Ga0495608_0000060_23320_23625
Length 101
Sequence MPRRADPQIGLSQAIKQLRRELQLSQEALGFAADIHPTWISHVESGRVNPTWGNVRRIAVGLRVPLPVLAALAEDLEVKHGVDQLPHGADADADSRRFPRK

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 8.04
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0000060 3300046511 Bacteria 88189
2 Ga0058860_10023394 3300004801 Bacteria 878
3 Ga0070658_10865861 3300005327 Bacteria 785
4 Ga0070683_100000411 3300005329 Bacteria 29635
5 Ga0070683_100002781 3300005329 Bacteria 13987
6 Ga0070683_100003984 3300005329 Bacteria 12093
7 Ga0070683_100298777 3300005329 Bacteria 1532
8 Ga0070683_100953814 3300005329 Bacteria 823
9 Ga0070666_10016079 3300005335 Bacteria 4782
10 Ga0070682_100000011 3300005337 Bacteria 266253
11 Ga0068868_100003920 3300005338 Bacteria 10394
12 Ga0070660_100770858 3300005339 Bacteria 808
13 Ga0070689_100437859 3300005340 Unclassified 1110
14 Ga0070661_100000004 3300005344 Bacteria 243876
15 Ga0070661_100000226 3300005344 Bacteria 46716
16 Ga0070668_100026404 3300005347 Bacteria 4407
17 Ga0070668_100044660 3300005347 Bacteria 3399
18 Ga0070668_100195565 3300005347 Bacteria 1658
19 Ga0070675_100000027 3300005354 Bacteria 106172
20 Ga0070675_100000028 3300005354 Bacteria 103914
21 Ga0070673_101473701 3300005364 Unclassified 641
22 Ga0070688_100000251 3300005365 Bacteria 28262
23 Ga0070688_100000283 3300005365 Bacteria 26109
24 Ga0070688_100001665 3300005365 Bacteria 11120
25 Ga0070688_100042296 3300005365 Bacteria 2802
26 Ga0070688_100093254 3300005365 Unclassified 1971
27 Ga0070659_100051774 3300005366 Bacteria 3229
28 Ga0070714_100717133 3300005435 Bacteria 966
29 Ga0070714_101030617 3300005435 Bacteria 801
30 Ga0070713_100000058 3300005436 Bacteria 70009
31 Ga0070713_100000085 3300005436 Bacteria 58902
32 Ga0070713_100050223 3300005436 Bacteria 3444
33 Ga0070711_100163522 3300005439 Bacteria 1689
34 Ga0070663_100393604 3300005455 Unclassified 1131
35 Ga0070678_100015301 3300005456 Bacteria 4872
36 Ga0070685_10000053 3300005466 Bacteria 70868
37 Ga0070685_10000141 3300005466 Bacteria 46333
38 Ga0070685_10000431 3300005466 Bacteria 24526
39 Ga0070685_10121971 3300005466 Unclassified 1619
40 Ga0070685_10585976 3300005466 Unclassified 801
41 Ga0070684_100001485 3300005535 Bacteria 16922
42 Ga0070684_100035324 3300005535 Bacteria 4278
43 Ga0070684_100039519 3300005535 Bacteria 4058
44 Ga0070684_100298168 3300005535 Unclassified 1479
45 Ga0070672_100000567 3300005543 Bacteria 21663
46 Ga0070665_100004723 3300005548 Bacteria 14190
47 Ga0070665_100124491 3300005548 Unclassified 2580
48 Ga0068855_100064778 3300005563 Bacteria 4262
49 Ga0070664_100010607 3300005564 Bacteria 7467
50 Ga0070664_100068867 3300005564 Bacteria 3026
51 Ga0068857_100984701 3300005577 Bacteria 811
52 Ga0068854_100000249 3300005578 Bacteria 36592
53 Ga0068854_100294684 3300005578 Bacteria 1310
54 Ga0068856_100016501 3300005614 Bacteria 7149
55 Ga0068852_100457607 3300005616 Unclassified 1264
56 Ga0068861_100321877 3300005719 Bacteria 1347
57 Ga0068851_10000126 3300005834 Bacteria 41437
58 Ga0068851_10000183 3300005834 Bacteria 31166
59 Ga0068851_10012003 3300005834 Bacteria 4075
60 Ga0068862_101650818 3300005844 Bacteria 648
61 Ga0070715_10109707 3300006163 Bacteria 1300
62 Ga0070712_100002000 3300006175 Bacteria 12482
63 Ga0075430_100127711 3300006846 Unclassified 2119
64 Ga0075436_101005222 3300006914 Bacteria 626
65 Ga0105245_10000917 3300009098 Bacteria 26795
66 Ga0105245_10014323 3300009098 Bacteria 6909
67 Ga0105247_10023389 3300009101 Bacteria 3723
68 Ga0105247_10227041 3300009101 Bacteria 1266
69 Ga0105243_10013530 3300009148 Bacteria 6172
70 Ga0105243_10022068 3300009148 Bacteria 4837
71 Ga0105242_11113248 3300009176 Bacteria 804
72 Ga0105239_10103768 3300010375 Bacteria 3147
73 Ga0157371_10715329 3300013102 Unclassified 750
74 Ga0157370_10402633 3300013104 Bacteria 1260
75 Ga0157369_10000020 3300013105 Bacteria 241679
76 Ga0157378_10020160 3300013297 Bacteria 5864
77 Ga0157378_10102671 3300013297 Bacteria 2612
78 Ga0157378_11777498 3300013297 Unclassified 664
79 Ga0157372_10000210 3300013307 Bacteria 65290
80 Ga0157375_10190747 3300013308 Bacteria 2204
81 Ga0157375_12450987 3300013308 Bacteria 623
82 Ga0157380_10000323 3300014326 Bacteria 28968
83 Ga0157380_11493976 3300014326 Unclassified 728
84 Ga0157379_10913363 3300014968 Bacteria 833
85 Ga0157376_10037755 3300014969 Bacteria 3925
86 Ga0206353_10732273 3300020082 Bacteria 1342
87 Ga0154015_1443016 3300020610 Bacteria 802
88 Ga0207656_10000415 3300025321 Bacteria 14390
89 Ga0207656_10000784 3300025321 Bacteria 10384
90 Ga0207656_10078359 3300025321 Bacteria 1481
91 Ga0207680_10009452 3300025903 Bacteria 4837
92 Ga0207685_10086059 3300025905 Bacteria 1312
93 Ga0207643_10431218 3300025908 Bacteria 836
94 Ga0207693_10004030 3300025915 Bacteria 12483
95 Ga0207663_10056930 3300025916 Unclassified 2461
96 Ga0207663_11023652 3300025916 Unclassified 663
97 Ga0207657_10338043 3300025919 Bacteria 1189
98 Ga0207649_10000003 3300025920 Bacteria 388908
99 Ga0207649_10000009 3300025920 Bacteria 295544
100 Ga0207659_10000010 3300025926 Bacteria 286639
101 Ga0207659_10000018 3300025926 Bacteria 156920
102 Ga0207687_10000007 3300025927 Bacteria 604185
103 Ga0207687_10001054 3300025927 Bacteria 18684
104 Ga0207700_10000003 3300025928 Bacteria 500797
105 Ga0207700_10000027 3300025928 Bacteria 137708
106 Ga0207700_10009389 3300025928 Bacteria 6105
107 Ga0207664_10070614 3300025929 Bacteria 2811
108 Ga0207664_10489431 3300025929 Bacteria 1101
109 Ga0207690_10058909 3300025932 Bacteria 2600
110 Ga0207686_10714152 3300025934 Bacteria 798
111 Ga0207709_10003185 3300025935 Bacteria 9859
112 Ga0207709_10031537 3300025935 Bacteria 3096
113 Ga0207670_10365348 3300025936 Bacteria 1146
114 Ga0207691_10000002 3300025940 Bacteria 189785
115 Ga0207711_10697211 3300025941 Unclassified 947
116 Ga0207661_10000693 3300025944 Bacteria 21892
117 Ga0207661_10000774 3300025944 Bacteria 20762
118 Ga0207661_10009788 3300025944 Bacteria 6885
119 Ga0207661_10244231 3300025944 Bacteria 1594
120 Ga0207661_10857114 3300025944 Bacteria 836
121 Ga0207679_10050968 3300025945 Bacteria 3028
122 Ga0207679_10082316 3300025945 Bacteria 2464
123 Ga0207667_10043988 3300025949 Bacteria 4736
124 Ga0207668_10008365 3300025972 Bacteria 6163
125 Ga0207668_10032482 3300025972 Bacteria 3449
126 Ga0207668_10260410 3300025972 Unclassified 1413
127 Ga0207640_10000114 3300025981 Bacteria 60718
128 Ga0207677_10000361 3300026023 Bacteria 31898
129 Ga0207678_10192400 3300026067 Bacteria 1744
130 Ga0207702_10005634 3300026078 Bacteria 10921
131 Ga0207675_101035142 3300026118 Unclassified 840
132 Ga0207683_10005919 3300026121 Bacteria 10477
133 Ga0268266_10001210 3300028379 Bacteria 31835
134 Ga0268266_10091822 3300028379 Unclassified 2663
135 Ga0268265_11623437 3300028380 Bacteria 652
136 Ga0307415_100308830 3300032126 Bacteria 1313
137 Ga0451807_1617170 3300041486 Bacteria 632
138 Ga0466957_0001083 3300044842 Bacteria 14051
139 Ga0466957_0071939 3300044842 Bacteria 2140
140 Ga0466957_0075117 3300044842 Bacteria 2097
141 Ga0466958_0089768 3300045836 Bacteria 1900
142 Ga0495629_0000025 3300046459 Bacteria 135624
143 Ga0495629_0000264 3300046459 Bacteria 45511
144 Ga0495641_0272530 3300046461 Bacteria 761
145 Ga0495594_0000003 3300046499 Bacteria 199267
146 Ga0495606_0000017 3300046507 Bacteria 284549
147 Ga0495606_0000072 3300046507 Bacteria 173678
148 Ga0495608_0000035 3300046511 Bacteria 133011
149 Ga0495630_0000034 3300046517 Bacteria 126055
150 Ga0495622_0000180 3300046557 Bacteria 51095
151 Ga0495588_0000229 3300046674 Bacteria 50351
152 Ga0495657_0000004 3300046675 Bacteria 266465
153 Ga0495657_0000026 3300046675 Bacteria 133011
154 Ga0495647_0000049 3300046681 Bacteria 34446
155 Ga0495669_0359404 3300046684 Unclassified 704
156 Ga0495613_0000094 3300046689 Bacteria 86601
157 Ga0495624_0000831 3300046690 Bacteria 24421
158 Ga0495624_0117910 3300046690 Bacteria 1631
159 Ga0495624_0454639 3300046690 Unclassified 767
160 Ga0495600_0001722 3300046809 Bacteria 12241
161 Ga0495660_0081272 3300046810 Bacteria 1699
162 Ga0495604_0003648 3300047317 Bacteria 12274
163 Ga0495604_0019315 3300047317 Bacteria 5454
164 Ga0495676_0565373 3300047321 Bacteria 742
165 Ga0495675_0000015 3300047444 Bacteria 133004
166 Ga0495675_0000040 3300047444 Bacteria 86266
167 Ga0495602_0000041 3300048088 Bacteria 126954
168 Ga0495602_0166837 3300048088 Bacteria 1713
169 Ga0496108_0018524 3300048911 Bacteria 5702
170 Ga0496109_0000264 3300048912 Bacteria 50480
171 Ga0496110_0000021 3300048913 Bacteria 77064
172 Ga0496110_0004182 3300048913 Bacteria 11148
173 Ga0496110_0097512 3300048913 Bacteria 2634
174 Ga0496110_0323652 3300048913 Unclassified 1404
175 Ga0496110_1789565 3300048913 Unclassified 524
176 Ga0496111_0000009 3300048914 Bacteria 93943
177 Ga0496111_0000117 3300048914 Bacteria 34553
178 Ga0496111_0052165 3300048914 Bacteria 2953
179 Ga0496111_0083483 3300048914 Bacteria 2334
180 Ga0496111_0444812 3300048914 Unclassified 956
181 Ga0496113_1230057 3300048916 Bacteria 584
182 Ga0496114_0232732 3300048917 Bacteria 1619
183 Ga0496114_0320690 3300048917 Bacteria 1369
184 Ga0501068_0106000 3300049584 Bacteria 1745
185 nmdc:mga0qj67_143094_c1 3300050509 Unclassified 1939
186 nmdc:mga08x19_862352_c1 3300050514 Bacteria 643
187 Ga0495601_0000017 3300053077 Bacteria 204209
188 Ga0495601_0477434 3300053077 Bacteria 805
189 Ga0495612_0004401 3300053078 Bacteria 5842
190 Ga0495612_0007505 3300053078 Bacteria 4457
191 Ga0495655_0047881 3300053083 Bacteria 1120
192 Ga0495595_0000003 3300053084 Bacteria 266465
193 Ga0495595_0000017 3300053084 Bacteria 133011
194 Ga0495595_0014208 3300053084 Bacteria 3374
195 Ga0495619_0000116 3300053085 Bacteria 58748
196 Ga0495619_0000131 3300053085 Bacteria 55500
197 Ga0495619_0000144 3300053085 Bacteria 52554
198 Ga0495619_0000311 3300053085 Bacteria 34086
199 Ga0500641_0008613 3300053096 Bacteria 3646
200 Ga0495608_0000060
201 Ga0058860_10023394
202 Ga0070658_10865861
203 Ga0070683_100000411
204 Ga0070683_100002781
205 Ga0070683_100003984
206 Ga0070683_100298777
207 Ga0070683_100953814
208 Ga0070666_10016079
209 Ga0070682_100000011
210 Ga0068868_100003920
211 Ga0070660_100770858
212 Ga0070689_100437859
213 Ga0070661_100000004
214 Ga0070661_100000226
215 Ga0070668_100026404
216 Ga0070668_100044660
217 Ga0070668_100195565
218 Ga0070675_100000027
219 Ga0070675_100000028
220 Ga0070673_101473701
221 Ga0070688_100000251
222 Ga0070688_100000283
223 Ga0070688_100001665
224 Ga0070688_100042296
225 Ga0070688_100093254
226 Ga0070659_100051774
227 Ga0070714_100717133
228 Ga0070714_101030617
229 Ga0070713_100000058
230 Ga0070713_100000085
231 Ga0070713_100050223
232 Ga0070711_100163522
233 Ga0070663_100393604
234 Ga0070678_100015301
235 Ga0070685_10000053
236 Ga0070685_10000141
237 Ga0070685_10000431
238 Ga0070685_10121971
239 Ga0070685_10585976
240 Ga0070684_100001485
241 Ga0070684_100035324
242 Ga0070684_100039519
243 Ga0070684_100298168
244 Ga0070672_100000567
245 Ga0070665_100004723
246 Ga0070665_100124491
247 Ga0068855_100064778
248 Ga0070664_100010607
249 Ga0070664_100068867
250 Ga0068857_100984701
251 Ga0068854_100000249
252 Ga0068854_100294684
253 Ga0068856_100016501
254 Ga0068852_100457607
255 Ga0068861_100321877
256 Ga0068851_10000126
257 Ga0068851_10000183
258 Ga0068851_10012003
259 Ga0068862_101650818
260 Ga0070715_10109707
261 Ga0070712_100002000
262 Ga0075430_100127711
263 Ga0075436_101005222
264 Ga0105245_10000917
265 Ga0105245_10014323
266 Ga0105247_10023389
267 Ga0105247_10227041
268 Ga0105243_10013530
269 Ga0105243_10022068
270 Ga0105242_11113248
271 Ga0105239_10103768
272 Ga0157371_10715329
273 Ga0157370_10402633
274 Ga0157369_10000020
275 Ga0157378_10020160
276 Ga0157378_10102671
277 Ga0157378_11777498
278 Ga0157372_10000210
279 Ga0157375_10190747
280 Ga0157375_12450987
281 Ga0157380_10000323
282 Ga0157380_11493976
283 Ga0157379_10913363
284 Ga0157376_10037755
285 Ga0206353_10732273
286 Ga0154015_1443016
287 Ga0207656_10000415
288 Ga0207656_10000784
289 Ga0207656_10078359
290 Ga0207680_10009452
291 Ga0207685_10086059
292 Ga0207643_10431218
293 Ga0207693_10004030
294 Ga0207663_10056930
295 Ga0207663_11023652
296 Ga0207657_10338043
297 Ga0207649_10000003
298 Ga0207649_10000009
299 Ga0207659_10000010
300 Ga0207659_10000018
301 Ga0207687_10000007
302 Ga0207687_10001054
303 Ga0207700_10000003
304 Ga0207700_10000027
305 Ga0207700_10009389
306 Ga0207664_10070614
307 Ga0207664_10489431
308 Ga0207690_10058909
309 Ga0207686_10714152
310 Ga0207709_10003185
311 Ga0207709_10031537
312 Ga0207670_10365348
313 Ga0207691_10000002
314 Ga0207711_10697211
315 Ga0207661_10000693
316 Ga0207661_10000774
317 Ga0207661_10009788
318 Ga0207661_10244231
319 Ga0207661_10857114
320 Ga0207679_10050968
321 Ga0207679_10082316
322 Ga0207667_10043988
323 Ga0207668_10008365
324 Ga0207668_10032482
325 Ga0207668_10260410
326 Ga0207640_10000114
327 Ga0207677_10000361
328 Ga0207678_10192400
329 Ga0207702_10005634
330 Ga0207675_101035142
331 Ga0207683_10005919
332 Ga0268266_10001210
333 Ga0268266_10091822
334 Ga0268265_11623437
335 Ga0307415_100308830
336 Ga0451807_1617170
337 Ga0466957_0001083
338 Ga0466957_0071939
339 Ga0466957_0075117
340 Ga0466958_0089768
341 Ga0495629_0000025
342 Ga0495629_0000264
343 Ga0495641_0272530
344 Ga0495594_0000003
345 Ga0495606_0000017
346 Ga0495606_0000072
347 Ga0495608_0000035
348 Ga0495630_0000034
349 Ga0495622_0000180
350 Ga0495588_0000229
351 Ga0495657_0000004
352 Ga0495657_0000026
353 Ga0495647_0000049
354 Ga0495669_0359404
355 Ga0495613_0000094
356 Ga0495624_0000831
357 Ga0495624_0117910
358 Ga0495624_0454639
359 Ga0495600_0001722
360 Ga0495660_0081272
361 Ga0495604_0003648
362 Ga0495604_0019315
363 Ga0495676_0565373
364 Ga0495675_0000015
365 Ga0495675_0000040
366 Ga0495602_0000041
367 Ga0495602_0166837
368 Ga0496108_0018524
369 Ga0496109_0000264
370 Ga0496110_0000021
371 Ga0496110_0004182
372 Ga0496110_0097512
373 Ga0496110_0323652
374 Ga0496110_1789565
375 Ga0496111_0000009
376 Ga0496111_0000117
377 Ga0496111_0052165
378 Ga0496111_0083483
379 Ga0496111_0444812
380 Ga0496113_1230057
381 Ga0496114_0232732
382 Ga0496114_0320690
383 Ga0501068_0106000
384 nmdc:mga0qj67_143094_c1
385 nmdc:mga08x19_862352_c1
386 Ga0495601_0000017
387 Ga0495601_0477434
388 Ga0495612_0004401
389 Ga0495612_0007505
390 Ga0495655_0047881
391 Ga0495595_0000003
392 Ga0495595_0000017
393 Ga0495595_0014208
394 Ga0495619_0000116
395 Ga0495619_0000131
396 Ga0495619_0000144
397 Ga0495619_0000311
398 Ga0500641_0008613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

15

69

0.97

PF13560

HTH_31

Helix-turn-helix domain

11

73

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9687 8 69
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9674 8 69
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9597 12 63
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9523 8 75
6rmq-assembly2.cif.gz_B-3 crystal structure of a selenomethionine-substituted a70m i84m mutant of the essential repressor ddro from radiation resistant-deinococcus bacteria (deinococcus deserti) 0.9517 11 71
ID Description Score Start End Superfamily
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9687 8 69 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9674 8 69 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9598 8 74 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9597 12 63 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9551 8 74 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3S0FVJ3-F1-model_v4 XRE family transcriptional regulator 0.9924 8 80 GO:0003677
GO:0003700
GO:0005829
AF-A0A495WHU3-F1-model_v4 Helix-turn-helix protein 0.9862 8 81 GO:0003677
AF-A0A5B8D6E1-F1-model_v4 deleted 0.9833 8 75
AF-A0A679HWV2-F1-model_v4 Uncharacterized protein 0.9817 8 84 GO:0003677
GO:0003700
GO:0005829
AF-G2JB94-F1-model_v4 Putative transcriptional regulator, XRE family 0.9803 8 83 GO:0003677
GO:0003700
GO:0005829

Map