F306392

General Info

Members Datasets Scaffolds Average Seq Length
199 132 188 165

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_004200|Ga0501241_004200_246_755
Length 169
Sequence MENEIIIRPIYNNYCKQVQELILPIQQIEFNVPVTLEGQPDLLDIETNYHKGGGGFWGALDKAKPDGEELTGTIGLINVGEHIGVIRKMFVKKEYRGKEFGIGQNLLDTLISYCNAHEINDLYLGTVEILKAAHRFYEKNGFGEINVDELPAIFPRMMADNKFYHLKLQ

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
4 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
5 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
68 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
83 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
123 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
132 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 2.51
Rhizoplane 2.01
Rhizosphere 64.82
Stem 0
Stem Tuber 0
Unclassified 15.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10049528 3300001979 Bacteria 1213
2 JGI24739J22299_10011148 3300001989 Bacteria 3322
3 JGI24737J22298_10000116 3300001990 Bacteria 24197
4 JGI24737J22298_10018284 3300001990 Bacteria 2250
5 JGI24735J21928_10000015 3300002067 Bacteria 167231
6 JGI25162J39368_1000016 3300002737 Bacteria 288734
7 JGI25162J39368_1000866 3300002737 Bacteria 19829
8 JGI25164J39214_1001979 3300002772 Bacteria 3689
9 JGI25150J39212_1000002 3300002774 Bacteria 537631
10 JGI25165J46597_1001674 3300003214 Bacteria 10067
11 rootH1_10034433 3300003316 Bacteria 16075
12 rootH2_10002774 3300003320 Bacteria 18398
13 rootL2_10060856 3300003322 Bacteria 1286
14 rootL2_10179523 3300003322 Bacteria 5475
15 rootH1_10045308 3300003316 Bacteria 1669
16 rootH1_10045308 3300003323 Bacteria 7684
17 rootH1_10052179 3300003323 Bacteria 38243
18 rootH1_10196814 3300003323 Unclassified 3638
19 rootH1_10288310 3300003323 Bacteria 1853
20 Ga0065165_1001218 3300005262 Bacteria 29602
21 Ga0065714_10079493 3300005288 Bacteria 2510
22 Ga0065714_10107469 3300005288 Bacteria 1531
23 Ga0070658_10281859 3300005327 Bacteria 1415
24 Ga0070682_100054480 3300005337 Bacteria 2510
25 Ga0070659_100005000 3300005366 Bacteria 9499
26 Ga0070681_10029310 3300005458 Bacteria 5526
27 Ga0068853_100622294 3300005539 Bacteria 1026
28 Ga0068855_100204667 3300005563 Bacteria 2221
29 Ga0068855_101304727 3300005563 Bacteria 751
30 Ga0068857_100118292 3300005577 Bacteria 2385
31 Ga0068857_100449999 3300005577 Bacteria 1204
32 Ga0068854_100066525 3300005578 Bacteria 2623
33 Ga0075369_10209794 3300006186 Bacteria 900
34 Ga0075366_10000261 3300006195 Bacteria 23266
35 Ga0075366_10150012 3300006195 Bacteria 1411
36 Ga0079104_1000005 3300006946 Bacteria 407099
37 Ga0099826_10064639 3300006948 Bacteria 2357
38 Ga0105240_10270730 3300009093 Bacteria 1956
39 Ga0105237_10000220 3300009545 Bacteria 80336
40 Ga0105237_10002729 3300009545 Bacteria 21530
41 Ga0105237_10003434 3300009545 Bacteria 18811
42 Ga0105237_10186182 3300009545 Bacteria 2076
43 Ga0105239_10008608 3300010375 Bacteria 11568
44 Ga0105239_10028319 3300010375 Bacteria 6163
45 Ga0105239_11959270 3300010375 Bacteria 680
46 Ga0157373_10000036 3300013100 Bacteria 122723
47 Ga0157373_10003820 3300013100 Bacteria 11390
48 Ga0157373_10008118 3300013100 Bacteria 7805
49 Ga0157371_10002946 3300013102 Bacteria 15852
50 Ga0157371_10040503 3300013102 Bacteria 3327
51 Ga0157371_10043428 3300013102 Bacteria 3202
52 Ga0157370_10000399 3300013104 Bacteria 54642
53 Ga0157370_10198825 3300013104 Bacteria 1860
54 Ga0157370_10199497 3300013104 Bacteria 1856
55 Ga0157370_11261730 3300013104 Bacteria 666
56 Ga0157369_10010263 3300013105 Bacteria 10686
57 Ga0157369_10044949 3300013105 Bacteria 4805
58 Ga0157369_10221609 3300013105 Bacteria 1980
59 Ga0157369_11249031 3300013105 Bacteria 758
60 Ga0163162_10002529 3300013306 Bacteria 17304
61 Ga0157372_10000173 3300013307 Bacteria 71416
62 Ga0157372_10001390 3300013307 Bacteria 26087
63 Ga0157372_12053323 3300013307 Bacteria 657
64 Ga0182008_10000011 3300014497 Bacteria 297770
65 Ga0182006_1054700 3300015261 Bacteria 1526
66 Ga0182006_1075021 3300015261 Bacteria 1245
67 Ga0163161_10000168 3300017792 Bacteria 60064
68 Ga0163161_10001157 3300017792 Bacteria 19859
69 Ga0163161_10050013 3300017792 Bacteria 3023
70 Ga0207427_100122 3300025231 Bacteria 99064
71 Ga0207427_106393 3300025231 Bacteria 1498
72 Ga0209437_100048 3300025233 Bacteria 405107
73 Ga0209437_100119 3300025233 Bacteria 206549
74 Ga0207425_1000004 3300025245 Bacteria 1092421
75 Ga0209129_1000005 3300025258 Bacteria 777812
76 Ga0209129_1010646 3300025258 Bacteria 2275
77 Ga0209233_1000029 3300025261 Bacteria 641642
78 Ga0209233_1001847 3300025261 Bacteria 8130
79 Ga0209025_1000009 3300025294 Bacteria 1092561
80 Ga0209758_1000010 3300025297 Bacteria 1092782
81 Ga0207655_1000381 3300025728 Bacteria 61849
82 Ga0207647_10002110 3300025904 Bacteria 15216
83 Ga0207707_10038435 3300025912 Bacteria 4182
84 Ga0207671_10001993 3300025914 Bacteria 22502
85 Ga0207671_10007421 3300025914 Bacteria 9515
86 Ga0207671_10012842 3300025914 Bacteria 6709
87 Ga0207690_10067555 3300025932 Bacteria 2452
88 Ga0207667_10527497 3300025949 Bacteria 1196
89 Ga0207667_10576728 3300025949 Bacteria 1136
90 Ga0207640_10009382 3300025981 Bacteria 5478
91 Ga0207674_10033219 3300026116 Bacteria 5402
92 Ga0207674_10248299 3300026116 Bacteria 1726
93 Ga0209281_1000566 3300027111 Bacteria 44512
94 Ga0209489_117438 3300027361 Bacteria 3264
95 Ga0209282_1052071 3300027666 Bacteria 2341
96 Ga0307515_10001710 3300028794 Bacteria 48899
97 Ga0307515_10001900 3300028794 Bacteria 46488
98 Ga0316181_1019090 3300030744 Bacteria 2913
99 Ga0307516_10332405 3300031730 Unclassified 1188
100 Ga0307516_10460108 3300031730 Bacteria 928
101 Ga0307410_10000089 3300031852 Bacteria 30766
102 Ga0307406_10000037 3300031901 Bacteria 80899
103 Ga0307407_10005460 3300031903 Bacteria 5519
104 Ga0307412_10684386 3300031911 Bacteria 878
105 Ga0307414_10000012 3300032004 Bacteria 322675
106 Ga0307414_10007370 3300032004 Bacteria 6180
107 Ga0307414_10045487 3300032004 Bacteria 3006
108 Ga0307414_10100319 3300032004 Unclassified 2177
109 Ga0307507_10000309 3300033179 Bacteria 98028
110 Ga0307510_10000671 3300033180 Bacteria 34905
111 Ga0373946_0439707 3300035171 Bacteria 663
112 Ga0395900_0372718 3300037418 Bacteria 1397
113 Ga0439466_0002630 3300041411 Bacteria 7029
114 Ga0451804_0383802 3300041463 Bacteria 884
115 Ga0451841_0526097 3300041498 Bacteria 679
116 Ga0466972_0000159 3300044658 Bacteria 54274
117 Ga0466970_0001499 3300044765 Bacteria 11236
118 Ga0495638_0114009 3300046460 Bacteria 1603
119 Ga0495650_0000144 3300046471 Bacteria 165957
120 Ga0495585_0000091 3300046492 Bacteria 95620
121 Ga0495585_0000241 3300046492 Bacteria 56727
122 Ga0495585_0170418 3300046492 Bacteria 1125
123 Ga0495606_0009540 3300046507 Bacteria 8195
124 Ga0495606_0021269 3300046507 Bacteria 4755
125 Ga0495606_0166956 3300046507 Bacteria 1280
126 Ga0495606_0220509 3300046507 Bacteria 1069
127 Ga0495606_0251495 3300046507 Bacteria 980
128 Ga0495610_0008174 3300046512 Bacteria 6824
129 Ga0495610_0175887 3300046512 Bacteria 894
130 Ga0495616_0011104 3300046513 Bacteria 5175
131 Ga0495616_0011972 3300046513 Bacteria 4939
132 Ga0495616_0198102 3300046513 Bacteria 884
133 Ga0495648_0004406 3300046524 Bacteria 12040
134 Ga0495648_0005249 3300046524 Bacteria 10824
135 Ga0495648_0087712 3300046524 Unclassified 1751
136 Ga0495663_0000151 3300046525 Bacteria 28138
137 Ga0495652_0216762 3300046529 Bacteria 1441
138 Ga0495609_0048637 3300046538 Bacteria 1895
139 Ga0495609_0084056 3300046538 Bacteria 1389
140 Ga0495622_0043496 3300046557 Bacteria 2088
141 Ga0495633_0000006 3300046558 Bacteria 326774
142 Ga0495633_0007299 3300046558 Bacteria 6381
143 Ga0495668_0000054 3300046616 Bacteria 203960
144 Ga0495668_0166329 3300046616 Bacteria 1208
145 Ga0495625_0000059 3300046660 Bacteria 180330
146 Ga0495625_0000355 3300046660 Bacteria 69806
147 Ga0495625_0000548 3300046660 Bacteria 55064
148 Ga0495625_0260091 3300046660 Bacteria 1123
149 Ga0495661_0057199 3300046665 Bacteria 2329
150 Ga0495588_0219320 3300046674 Bacteria 1004
151 Ga0495658_0020053 3300046683 Bacteria 3501
152 Ga0495670_0298134 3300046691 Bacteria 864
153 Ga0495671_0068767 3300046692 Bacteria 1741
154 Ga0495649_0000031 3300046694 Bacteria 151547
155 Ga0495600_0544270 3300046809 Bacteria 710
156 Ga0495660_0113604 3300046810 Bacteria 1379
157 Ga0495660_0346065 3300046810 Bacteria 662
158 Ga0495683_0071605 3300047323 Bacteria 1701
159 Ga0495687_037873 3300047443 Bacteria 2144
160 Ga0495673_0050763 3300047469 Bacteria 1819
161 Ga0495686_0000066 3300047472 Bacteria 225023
162 Ga0495614_0004728 3300048089 Bacteria 6140
163 Ga0496114_0370695 3300048917 Bacteria 1267
164 Ga0496115_0026826 3300048918 Bacteria 4501
165 Ga0496116_0000030 3300048919 Bacteria 420761
166 Ga0496117_0160796 3300048920 Bacteria 1316
167 Ga0496121_0033430 3300048924 Bacteria 4653
168 Ga0496121_0152902 3300048924 Bacteria 1696
169 Ga0496124_0015286 3300048927 Bacteria 7366
170 Ga0496124_0878574 3300048927 Bacteria 546
171 Ga0496125_0000035 3300048928 Bacteria 339737
172 Ga0496125_0459270 3300048928 Bacteria 727
173 Ga0496126_0012027 3300048929 Bacteria 8893
174 Ga0495678_008057 3300049459 Bacteria 5372
175 Ga0495682_0011476 3300049460 Bacteria 3409
176 Ga0501238_000032 3300049671 Bacteria 24802
177 Ga0501241_004200 3300049758 Unclassified 2704
178 Ga0501280_000125 3300049776 Bacteria 19989
179 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
180 nmdc:mga0k408_245_c1 3300050493 Bacteria 29347
181 nmdc:mga0k408_762610_c1 3300050493 Bacteria 565
182 nmdc:mga07m45_206109_c1 3300050496 Bacteria 1144
183 Ga0500583_0416995 3300053092 Unclassified 642
184 Ga0500614_010285 3300053123 Bacteria 2007
185 Ga0500618_000018 3300053125 Bacteria 163272
186 Ga0500618_020719 3300053125 Bacteria 1609
187 Ga0500652_168863 3300053131 Bacteria 901
188 Ga0500658_0000024 3300053134 Bacteria 117952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_11261730 Ga0157370_112617302 157
2 iso_pu_bacteria 2738541279 2738736530 159
3 iso_pu_bacteria 2738541285 2738766831 159
4 iso_pu_bacteria 2738543007 2739218112 159
5 3300048917 Ga0496114_0370695 Ga0496114_0370695_280_765 160
6 3300048924 Ga0496121_0033430 Ga0496121_0033430_1578_2060 160
7 3300048927 Ga0496124_0878574 Ga0496124_0878574_13_495 160
8 3300005288 Ga0065714_10079493 Ga0065714_100794933 161
9 3300006946 Ga0079104_1000005 Ga0079104_1000005341 161
10 3300006948 Ga0099826_10064639 Ga0099826_100646393 161
11 3300013104 Ga0157370_10000399 Ga0157370_1000039931 161
12 3300015261 Ga0182006_1054700 Ga0182006_10547002 161
13 3300027111 Ga0209281_1000566 Ga0209281_100056626 161
14 3300027361 Ga0209489_117438 Ga0209489_1174383 161
15 3300027666 Ga0209282_1052071 Ga0209282_10520712 161
16 3300031852 Ga0307410_10000089 Ga0307410_100000893 161
17 3300031901 Ga0307406_10000037 Ga0307406_1000003713 161
18 3300031903 Ga0307407_10005460 Ga0307407_100054605 161
19 3300031911 Ga0307412_10684386 Ga0307412_106843862 161
20 3300032004 Ga0307414_10000012 Ga0307414_1000001231 161
21 3300041411 Ga0439466_0002630 Ga0439466_0002630_955_1446 161
22 3300041463 Ga0451804_0383802 Ga0451804_0383802_350_835 161
23 3300048918 Ga0496115_0026826 Ga0496115_0026826_3219_3707 161
24 3300049671 Ga0501238_000032 Ga0501238_000032_23330_23821 161
25 3300049776 Ga0501280_000125 Ga0501280_000125_17775_18266 161
26 3300053134 Ga0500658_0000024 Ga0500658_0000024_50036_50524 161
27 iso_pu_bacteria 2513020052 2513234806 161
28 iso_pu_bacteria 2599185184 2599481991 161
29 iso_pu_bacteria 2896085136 2896089822 161
30 iso_pu_bacteria 2928078545 2928082099 161
31 iso_pu_bacteria 2928147474 2928149323 161
32 iso_pu_bacteria 2929177148 2929180799 161
33 iso_pu_bacteria 2932082852 2932087941 161
34 3300002737 JGI25162J39368_1000866 JGI25162J39368_100086612 162
35 3300002772 JGI25164J39214_1001979 JGI25164J39214_10019791 162
36 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002143 162
37 3300003214 JGI25165J46597_1001674 JGI25165J46597_10016744 162
38 3300005262 Ga0065165_1001218 Ga0065165_100121833 162
39 3300005337 Ga0070682_100054480 Ga0070682_1000544803 162
40 3300013100 Ga0157373_10000036 Ga0157373_1000003698 162
41 3300013102 Ga0157371_10043428 Ga0157371_100434285 162
42 3300013104 Ga0157370_10198825 Ga0157370_101988252 162
43 3300013104 Ga0157370_10199497 Ga0157370_101994972 162
44 3300013105 Ga0157369_10010263 Ga0157369_100102635 162
45 3300013105 Ga0157369_11249031 Ga0157369_112490311 162
46 3300014497 Ga0182008_10000011 Ga0182008_100000112 162
47 3300015261 Ga0182006_1075021 Ga0182006_10750212 162
48 3300017792 Ga0163161_10001157 Ga0163161_100011578 162
49 3300025231 Ga0207427_100122 Ga0207427_10012279 162
50 3300025233 Ga0209437_100048 Ga0209437_100048217 162
51 3300025245 Ga0207425_1000004 Ga0207425_1000004799 162
52 3300025258 Ga0209129_1000005 Ga0209129_1000005142 162
53 3300025261 Ga0209233_1000029 Ga0209233_1000029159 162
54 3300025294 Ga0209025_1000009 Ga0209025_1000009799 162
55 3300025297 Ga0209758_1000010 Ga0209758_1000010800 162
56 3300025728 Ga0207655_1000381 Ga0207655_100038134 162
57 3300032004 Ga0307414_10007370 Ga0307414_100073702 162
58 3300046512 Ga0495610_0175887 Ga0495610_0175887_157_648 162
59 3300046525 Ga0495663_0000151 Ga0495663_0000151_10406_10894 162
60 3300046660 Ga0495625_0260091 Ga0495625_0260091_34_543 162
61 3300046810 Ga0495660_0346065 Ga0495660_0346065_147_641 162
62 3300048919 Ga0496116_0000030 Ga0496116_0000030_99730_100221 162
63 3300048920 Ga0496117_0160796 Ga0496117_0160796_187_678 162
64 3300048924 Ga0496121_0152902 Ga0496121_0152902_233_724 162
65 3300048927 Ga0496124_0015286 Ga0496124_0015286_4426_4917 162
66 3300048928 Ga0496125_0000035 Ga0496125_0000035_322376_322867 162
67 3300048928 Ga0496125_0459270 Ga0496125_0459270_188_679 162
68 3300048929 Ga0496126_0012027 Ga0496126_0012027_7194_7685 162
69 3300005578 Ga0068854_100066525 Ga0068854_1000665252 164
70 3300009093 Ga0105240_10270730 Ga0105240_102707302 164
71 3300009545 Ga0105237_10002729 Ga0105237_1000272918 164
72 3300009545 Ga0105237_10003434 Ga0105237_1000343416 164
73 3300010375 Ga0105239_10028319 Ga0105239_100283194 164
74 3300017792 Ga0163161_10050013 Ga0163161_100500132 164
75 3300025914 Ga0207671_10001993 Ga0207671_100019935 164
76 3300025914 Ga0207671_10012842 Ga0207671_100128424 164
77 3300025981 Ga0207640_10009382 Ga0207640_100093824 164
78 3300030744 Ga0316181_1019090 Ga0316181_10190902 164
79 3300032004 Ga0307414_10045487 Ga0307414_100454871 164
80 3300033180 Ga0307510_10000671 Ga0307510_1000067117 164
81 3300046507 Ga0495606_0009540 Ga0495606_0009540_5156_5656 164
82 3300049758 Ga0501241_004200 Ga0501241_004200_246_755 164
83 3300001979 JGI24740J21852_10049528 JGI24740J21852_100495282 165
84 3300001989 JGI24739J22299_10011148 JGI24739J22299_100111483 165
85 3300001990 JGI24737J22298_10000116 JGI24737J22298_1000011617 165
86 3300001990 JGI24737J22298_10018284 JGI24737J22298_100182844 165
87 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001514 165
88 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016180 165
89 3300003316 rootH1_10034433 rootH1_1003443310 165
90 3300003320 rootH2_10002774 rootH2_1000277410 165
91 3300003322 rootL2_10060856 rootL2_100608562 165
92 3300003322 rootL2_10179523 rootL2_101795235 165
93 3300003323 rootH1_10045308 rootH1_100453083 165
94 3300003323 rootH1_10052179 rootH1_1005217919 165
95 3300003323 rootH1_10196814 rootH1_101968143 165
96 3300003323 rootH1_10288310 rootH1_102883102 165
97 3300005288 Ga0065714_10107469 Ga0065714_101074692 165
98 3300005327 Ga0070658_10281859 Ga0070658_102818593 165
99 3300005366 Ga0070659_100005000 Ga0070659_1000050008 165
100 3300005458 Ga0070681_10029310 Ga0070681_100293106 165
101 3300005539 Ga0068853_100622294 Ga0068853_1006222941 165
102 3300005563 Ga0068855_100204667 Ga0068855_1002046673 165
103 3300005563 Ga0068855_101304727 Ga0068855_1013047271 165
104 3300005577 Ga0068857_100118292 Ga0068857_1001182922 165
105 3300005577 Ga0068857_100449999 Ga0068857_1004499992 165
106 3300006186 Ga0075369_10209794 Ga0075369_102097942 165
107 3300006195 Ga0075366_10000261 Ga0075366_1000026122 165
108 3300006195 Ga0075366_10150012 Ga0075366_101500122 165
109 3300009545 Ga0105237_10000220 Ga0105237_1000022020 165
110 3300009545 Ga0105237_10186182 Ga0105237_101861822 165
111 3300010375 Ga0105239_10008608 Ga0105239_100086085 165
112 3300010375 Ga0105239_11959270 Ga0105239_119592702 165
113 3300013100 Ga0157373_10003820 Ga0157373_100038209 165
114 3300013100 Ga0157373_10008118 Ga0157373_100081185 165
115 3300013102 Ga0157371_10002946 Ga0157371_1000294611 165
116 3300013102 Ga0157371_10040503 Ga0157371_100405034 165
117 3300013105 Ga0157369_10044949 Ga0157369_100449492 165
118 3300013105 Ga0157369_10221609 Ga0157369_102216093 165
119 3300013306 Ga0163162_10002529 Ga0163162_1000252914 165
120 3300013307 Ga0157372_10000173 Ga0157372_1000017327 165
121 3300013307 Ga0157372_10001390 Ga0157372_1000139023 165
122 3300013307 Ga0157372_12053323 Ga0157372_120533231 165
123 3300017792 Ga0163161_10000168 Ga0163161_1000016845 165
124 3300025231 Ga0207427_106393 Ga0207427_1063932 165
125 3300025233 Ga0209437_100119 Ga0209437_10011997 165
126 3300025258 Ga0209129_1010646 Ga0209129_10106464 165
127 3300025261 Ga0209233_1001847 Ga0209233_10018471 165
128 3300025904 Ga0207647_10002110 Ga0207647_100021103 165
129 3300025912 Ga0207707_10038435 Ga0207707_100384353 165
130 3300025914 Ga0207671_10007421 Ga0207671_100074217 165
131 3300025932 Ga0207690_10067555 Ga0207690_100675552 165
132 3300025949 Ga0207667_10527497 Ga0207667_105274972 165
133 3300025949 Ga0207667_10576728 Ga0207667_105767281 165
134 3300026116 Ga0207674_10033219 Ga0207674_100332195 165
135 3300026116 Ga0207674_10248299 Ga0207674_102482993 165
136 3300028794 Ga0307515_10001710 Ga0307515_1000171031 165
137 3300028794 Ga0307515_10001900 Ga0307515_1000190015 165
138 3300031730 Ga0307516_10332405 Ga0307516_103324052 165
139 3300031730 Ga0307516_10460108 Ga0307516_104601081 165
140 3300032004 Ga0307414_10100319 Ga0307414_101003193 165
141 3300033179 Ga0307507_10000309 Ga0307507_1000030948 165
142 3300035171 Ga0373946_0439707 Ga0373946_0439707_60_557 165
143 3300037418 Ga0395900_0372718 Ga0395900_0372718_643_1140 165
144 3300041498 Ga0451841_0526097 Ga0451841_0526097_112_609 165
145 3300044658 Ga0466972_0000159 Ga0466972_0000159_52017_52517 165
146 3300044765 Ga0466970_0001499 Ga0466970_0001499_7931_8431 165
147 3300046460 Ga0495638_0114009 Ga0495638_0114009_402_899 165
148 3300046471 Ga0495650_0000144 Ga0495650_0000144_113489_113986 165
149 3300046492 Ga0495585_0000091 Ga0495585_0000091_54442_54939 165
150 3300046492 Ga0495585_0000241 Ga0495585_0000241_28253_28750 165
151 3300046492 Ga0495585_0170418 Ga0495585_0170418_330_827 165
152 3300046507 Ga0495606_0021269 Ga0495606_0021269_2929_3426 165
153 3300046507 Ga0495606_0166956 Ga0495606_0166956_707_1231 165
154 3300046507 Ga0495606_0220509 Ga0495606_0220509_119_616 165
155 3300046507 Ga0495606_0251495 Ga0495606_0251495_450_947 165
156 3300046512 Ga0495610_0008174 Ga0495610_0008174_2408_2905 165
157 3300046513 Ga0495616_0011104 Ga0495616_0011104_3377_3874 165
158 3300046513 Ga0495616_0011972 Ga0495616_0011972_456_953 165
159 3300046513 Ga0495616_0198102 Ga0495616_0198102_291_788 165
160 3300046524 Ga0495648_0004406 Ga0495648_0004406_596_1093 165
161 3300046524 Ga0495648_0005249 Ga0495648_0005249_8420_8917 165
162 3300046524 Ga0495648_0087712 Ga0495648_0087712_172_669 165
163 3300046529 Ga0495652_0216762 Ga0495652_0216762_91_588 165
164 3300046538 Ga0495609_0048637 Ga0495609_0048637_896_1393 165
165 3300046538 Ga0495609_0084056 Ga0495609_0084056_774_1271 165
166 3300046557 Ga0495622_0043496 Ga0495622_0043496_943_1440 165
167 3300046558 Ga0495633_0000006 Ga0495633_0000006_6309_6806 165
168 3300046558 Ga0495633_0007299 Ga0495633_0007299_1363_1860 165
169 3300046616 Ga0495668_0000054 Ga0495668_0000054_174664_175161 165
170 3300046616 Ga0495668_0166329 Ga0495668_0166329_170_667 165
171 3300046660 Ga0495625_0000059 Ga0495625_0000059_64238_64735 165
172 3300046660 Ga0495625_0000355 Ga0495625_0000355_27978_28475 165
173 3300046660 Ga0495625_0000548 Ga0495625_0000548_31148_31645 165
174 3300046665 Ga0495661_0057199 Ga0495661_0057199_874_1371 165
175 3300046674 Ga0495588_0219320 Ga0495588_0219320_280_777 165
176 3300046683 Ga0495658_0020053 Ga0495658_0020053_610_1107 165
177 3300046691 Ga0495670_0298134 Ga0495670_0298134_260_757 165
178 3300046692 Ga0495671_0068767 Ga0495671_0068767_807_1304 165
179 3300046694 Ga0495649_0000031 Ga0495649_0000031_35456_35953 165
180 3300046809 Ga0495600_0544270 Ga0495600_0544270_41_538 165
181 3300046810 Ga0495660_0113604 Ga0495660_0113604_165_662 165
182 3300047323 Ga0495683_0071605 Ga0495683_0071605_605_1102 165
183 3300047443 Ga0495687_037873 Ga0495687_037873_992_1495 165
184 3300047469 Ga0495673_0050763 Ga0495673_0050763_836_1333 165
185 3300047472 Ga0495686_0000066 Ga0495686_0000066_86919_87473 165
186 3300048089 Ga0495614_0004728 Ga0495614_0004728_3670_4167 165
187 3300049459 Ga0495678_008057 Ga0495678_008057_3139_3636 165
188 3300049460 Ga0495682_0011476 Ga0495682_0011476_2360_2857 165
189 3300050493 nmdc:mga0k408_1202_c1 nmdc:mga0k408_1202_c1_13453_13950 165
190 3300050493 nmdc:mga0k408_245_c1 nmdc:mga0k408_245_c1_200_697 165
191 3300050493 nmdc:mga0k408_762610_c1 nmdc:mga0k408_762610_c1_57_554 165
192 3300050496 nmdc:mga07m45_206109_c1 nmdc:mga07m45_206109_c1_92_589 165
193 3300053092 Ga0500583_0416995 Ga0500583_0416995_47_544 165
194 3300053123 Ga0500614_010285 Ga0500614_010285_304_801 165
195 3300053125 Ga0500618_000018 Ga0500618_000018_95317_95814 165
196 3300053125 Ga0500618_020719 Ga0500618_020719_872_1369 165
197 3300053131 Ga0500652_168863 Ga0500652_168863_157_654 165
198 iso_pu_bacteria 2945977869 2945983196 165
199 iso_pu_bacteria 2946013367 2946017413 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

46

150

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

142

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

144

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9657 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9645 4 163
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.954 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9526 4 163
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9435 1 163
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9551 4 162 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9372 4 162 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9134 1 163 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.908 1 163 3.40.630.30
af_Q5A798_297_388_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8898 54 70 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A443YL61-F1-model_v4 GNAT family N-acetyltransferase 0.9952 4 163 GO:0008080
AF-A0A2T7BNZ0-F1-model_v4 GNAT family N-acetyltransferase 0.993 6 163 GO:0008080
AF-A0A316XKD0-F1-model_v4 GNAT family N-acetyltransferase 0.9922 4 163 GO:0008080
AF-A0A1I3VVI8-F1-model_v4 deleted 0.9917 4 163
AF-A0A4S5J0A2-F1-model_v4 deleted 0.9908 4 122

Feature Viewer

pLDDT pTM Quality
94.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map