F307017

General Info

Members Datasets Scaffolds Average Seq Length
200 112 200 342

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100043158|Ga0075436_1000431584
Length 333
Sequence MPHKVVTFGEIMLRLSPPGFERFFQSPVLSATFGGGEANVAISLAHFGLHSCYVTRLPSHAIGDGAMRTLRGEGVDASYVVRGGDRVGIYFAETGASQRASTVIYDRAHSAISEMAADAVDWSAVMRGAAWFHVTGITPALGDTAAAAAGARVSVDLNFRKKLWSESRAQQTMKPLMRDVDVVIANEEDLQSVLGVAVAGADVTSGTLDVSGYRAAAERVTRDFGPPIVAVTLRESLSASDNGWSAVLWDGARGTLHHSQRYVVRLVDRIGGGDSFAAGLIYAVLSGRPLDAALRFAVAASALKQTIYGDFNRVTAAEVEALARGDASGRVQR

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
60 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
61 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
62 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
65 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
68 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
69 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 3
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100209268 3300005340 Bacteria 1596
2 Ga0070669_100013339 3300005353 Bacteria 5841
3 Ga0070675_100059389 3300005354 Bacteria 3155
4 Ga0070674_100087097 3300005356 Bacteria 2245
5 Ga0070713_100001546 3300005436 Bacteria 14708
6 Ga0070700_100170898 3300005441 Bacteria 1505
7 Ga0070694_100018812 3300005444 Bacteria 4389
8 Ga0070694_100036596 3300005444 Unclassified 3252
9 Ga0070678_100225703 3300005456 Bacteria 1559
10 Ga0070681_10338229 3300005458 Bacteria 1415
11 Ga0070707_100089541 3300005468 Bacteria 2978
12 Ga0070698_100242203 3300005471 Bacteria 1737
13 Ga0070699_100001648 3300005518 Bacteria 20384
14 Ga0068853_100155434 3300005539 Bacteria 2061
15 Ga0070686_100258523 3300005544 Bacteria 1275
16 Ga0070695_100008040 3300005545 Bacteria 6251
17 Ga0070695_100202932 3300005545 Bacteria 1418
18 Ga0070704_100027720 3300005549 Bacteria 3761
19 Ga0070704_100042730 3300005549 Bacteria 3137
20 Ga0068859_100063440 3300005617 Bacteria 3726
21 Ga0075365_10095538 3300006038 Bacteria 2030
22 Ga0075368_10009662 3300006042 Bacteria 3473
23 Ga0075362_10004107 3300006177 Bacteria 5191
24 Ga0075367_10056262 3300006178 Bacteria 2336
25 Ga0075366_10002924 3300006195 Bacteria 8879
26 Ga0075366_10004560 3300006195 Bacteria 7441
27 Ga0097621_100026176 3300006237 Bacteria 4573
28 Ga0097621_100352482 3300006237 Bacteria 1309
29 Ga0068871_100000630 3300006358 Bacteria 24200
30 Ga0075428_100000017 3300006844 Bacteria 147833
31 Ga0075428_100009688 3300006844 Bacteria 10699
32 Ga0075428_100014905 3300006844 Bacteria 8636
33 Ga0075428_100015760 3300006844 Bacteria 8373
34 Ga0075428_100272052 3300006844 Bacteria 1822
35 Ga0075430_100021191 3300006846 Bacteria 5526
36 Ga0075430_100023822 3300006846 Bacteria 5213
37 Ga0075430_100042498 3300006846 Bacteria 3843
38 Ga0075430_100348239 3300006846 Bacteria 1224
39 Ga0075431_100011072 3300006847 Bacteria 9076
40 Ga0075431_100052291 3300006847 Bacteria 4212
41 Ga0075433_10031902 3300006852 Bacteria 4508
42 Ga0075434_100001479 3300006871 Bacteria 19804
43 Ga0075434_100018859 3300006871 Bacteria 6668
44 Ga0075429_100042679 3300006880 Bacteria 3946
45 Ga0075429_100201685 3300006880 Bacteria 1743
46 Ga0068865_100073821 3300006881 Bacteria 2427
47 Ga0075436_100043158 3300006914 Bacteria 3109
48 Ga0097620_100063438 3300006931 Bacteria 3726
49 Ga0075435_100001844 3300007076 Bacteria 13753
50 Ga0075435_100041376 3300007076 Bacteria 3683
51 Ga0111539_10000002 3300009094 Bacteria 983359
52 Ga0111539_10000982 3300009094 Bacteria 37391
53 Ga0111539_10004513 3300009094 Bacteria 18204
54 Ga0111539_10020358 3300009094 Bacteria 8171
55 Ga0111539_10475256 3300009094 Bacteria 1456
56 Ga0114129_10001283 3300009147 Bacteria 33466
57 Ga0114129_10001441 3300009147 Bacteria 32078
58 Ga0114129_10008091 3300009147 Bacteria 14982
59 Ga0114129_10013107 3300009147 Bacteria 11807
60 Ga0114129_10023315 3300009147 Bacteria 8780
61 Ga0114129_10071065 3300009147 Bacteria 4853
62 Ga0114129_10080876 3300009147 Unclassified 4517
63 Ga0114129_10253112 3300009147 Bacteria 2363
64 Ga0114129_10271834 3300009147 Bacteria 2267
65 Ga0114129_10274247 3300009147 Bacteria 2256
66 Ga0114129_10478648 3300009147 Bacteria 1629
67 Ga0157380_10069270 3300014326 Bacteria 2846
68 Ga0157380_10108078 3300014326 Bacteria 2331
69 Ga0157380_10172057 3300014326 Bacteria 1893
70 Ga0157380_10194499 3300014326 Bacteria 1794
71 Ga0207681_10164105 3300025923 Bacteria 1678
72 Ga0207700_10002781 3300025928 Bacteria 10079
73 Ga0207670_10203456 3300025936 Bacteria 1506
74 Ga0207670_10302415 3300025936 Unclassified 1253
75 Ga0207669_10238069 3300025937 Bacteria 1347
76 Ga0207691_10118925 3300025940 Bacteria 2343
77 Ga0207711_10314360 3300025941 Bacteria 1446
78 Ga0207689_10043087 3300025942 Bacteria 3731
79 Ga0207703_10284219 3300026035 Unclassified 1504
80 Ga0207708_10003402 3300026075 Bacteria 11723
81 Ga0207708_10037527 3300026075 Bacteria 3691
82 Ga0207708_10170388 3300026075 Bacteria 1724
83 Ga0207675_100013972 3300026118 Bacteria 7486
84 Ga0207675_100520741 3300026118 Unclassified 1185
85 Ga0207683_10133943 3300026121 Bacteria 2230
86 Ga0209813_10034107 3300027866 Bacteria 1517
87 Ga0207428_10000004 3300027907 Bacteria 727800
88 Ga0207428_10010104 3300027907 Bacteria 8442
89 Ga0207428_10024473 3300027907 Bacteria 5069
90 Ga0207428_10025028 3300027907 Bacteria 5002
91 Ga0207428_10126443 3300027907 Bacteria 1957
92 Ga0268265_10005404 3300028380 Bacteria 8745
93 Ga0268264_10083722 3300028381 Bacteria 2733
94 Ga0307408_100111677 3300031548 Bacteria 2100
95 Ga0307405_10024883 3300031731 Bacteria 3428
96 Ga0307412_10114905 3300031911 Bacteria 1928
97 Ga0307409_100113334 3300031995 Bacteria 2279
98 Ga0307416_100032405 3300032002 Bacteria 3948
99 Ga0307411_10067997 3300032005 Bacteria 2400
100 Ga0373948_0000913 3300034817 Bacteria 3952
101 Ga0373950_0002385 3300034818 Bacteria 2580
102 Ga0373959_0002038 3300034820 Bacteria 3219
103 Ga0373938_0002534 3300034957 Bacteria 2951
104 Ga0373928_0004645 3300035084 Bacteria 2617
105 Ga0373929_0000956 3300035085 Bacteria 5609
106 Ga0373952_0001096 3300035092 Bacteria 4940
107 Ga0373932_0000599 3300035112 Bacteria 10963
108 Ga0373941_0000435 3300035115 Bacteria 8296
109 Ga0373960_0000110 3300035121 Bacteria 13143
110 Ga0373961_0008002 3300035241 Bacteria 2568
111 Ga0373962_0003358 3300035242 Bacteria 3846
112 Ga0373931_0005383 3300035691 Bacteria 5911
113 Ga0373935_0048877 3300035692 Bacteria 2680
114 Ga0373937_0030055 3300036401 Bacteria 4921
115 Ga0373937_0358227 3300036401 Bacteria 1382
116 Ga0395905_0081729 3300037471 Unclassified 3028
117 Ga0436361_1219863 3300039447 Bacteria 1802
118 Ga0439453_0012554 3300041408 Bacteria 1428
119 Ga0439435_0010030 3300042436 Bacteria 2237
120 Ga0439435_0020850 3300042436 Bacteria 1694
121 Ga0450893_0018852 3300042532 Bacteria 1178
122 Ga0495669_0028563 3300046684 Bacteria 2444
123 Ga0495672_0011250 3300047320 Bacteria 6324
124 Ga0496102_0019306 3300048905 Bacteria 6005
125 Ga0496106_0190121 3300048909 Bacteria 1632
126 Ga0496112_0061580 3300048915 Bacteria 3700
127 Ga0496112_0111384 3300048915 Bacteria 2707
128 Ga0496112_0165744 3300048915 Bacteria 2176
129 Ga0496114_0180808 3300048917 Bacteria 1842
130 Ga0501038_0288204 3300049574 Bacteria 1291
131 Ga0501042_0059123 3300049578 Bacteria 2737
132 Ga0501048_0207845 3300049582 Bacteria 1388
133 Ga0501071_0025978 3300049587 Bacteria 4106
134 Ga0501071_0132456 3300049587 Bacteria 1853
135 Ga0501072_0247262 3300049588 Bacteria 1420
136 Ga0501073_0047349 3300049589 Bacteria 3022
137 Ga0501075_0110488 3300049591 Bacteria 2090
138 Ga0501075_0133502 3300049591 Bacteria 1891
139 Ga0501076_0065790 3300049592 Bacteria 2892
140 Ga0501076_0111923 3300049592 Bacteria 2207
141 Ga0501076_0112060 3300049592 Bacteria 2206
142 Ga0501077_0034023 3300049593 Bacteria 3243
143 Ga0501077_0110355 3300049593 Bacteria 1743
144 Ga0501079_0057294 3300049741 Bacteria 3007
145 Ga0501079_0098928 3300049741 Bacteria 2261
146 Ga0501080_0366787 3300049742 Bacteria 1299
147 nmdc:mga0k408_19472_c1 3300050493 Bacteria 3794
148 nmdc:mga0k408_30731_c1 3300050493 Bacteria 3064
149 nmdc:mga06z11_46226_c1 3300050494 Bacteria 2205
150 nmdc:mga05p37_19834_c1 3300050507 Bacteria 8136
151 nmdc:mga05p37_322545_c1 3300050507 Bacteria 1828
152 nmdc:mga05p37_426_c1 3300050507 Bacteria 45626
153 nmdc:mga05p37_63258_c1 3300050507 Bacteria 4553
154 nmdc:mga05p37_70526_c1 3300050507 Bacteria 4298
155 nmdc:mga05p37_73924_c1 3300050507 Bacteria 4195
156 nmdc:mga05p37_749600_c1 3300050507 Bacteria 1076
157 nmdc:mga05p37_93203_c1 3300050507 Bacteria 3711
158 nmdc:mga05p37_9537_c1 3300050507 Bacteria 11495
159 nmdc:mga05p37_96478_c1 3300050507 Unclassified 3643
160 nmdc:mga09592_104492_c1 3300050508 Bacteria 2427
161 nmdc:mga09592_14672_c1 3300050508 Bacteria 6392
162 nmdc:mga0qj67_27509_c1 3300050509 Bacteria 4409
163 nmdc:mga0qj67_42954_c1 3300050509 Unclassified 3560
164 nmdc:mga06r32_14231_c1 3300050510 Bacteria 7215
165 nmdc:mga06r32_163405_c1 3300050510 Bacteria 2209
166 nmdc:mga06r32_259982_c1 3300050510 Bacteria 1724
167 nmdc:mga06r32_71694_c1 3300050510 Unclassified 3353
168 nmdc:mga06r32_75465_c1 3300050510 Bacteria 3271
169 nmdc:mga06r32_81499_c1 3300050510 Bacteria 3151
170 nmdc:mga06r32_82319_c1 3300050510 Bacteria 3135
171 nmdc:mga08y16_118330_c1 3300050511 Bacteria 2757
172 nmdc:mga08y16_13795_c1 3300050511 Bacteria 8504
173 nmdc:mga08y16_257_c1 3300050511 Bacteria 47826
174 nmdc:mga08y16_27510_c1 3300050511 Bacteria 5992
175 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
176 nmdc:mga08y16_39348_c1 3300050511 Bacteria 4962
177 nmdc:mga08y16_88263_c1 3300050511 Bacteria 3231
178 nmdc:mga0n895_110802_c1 3300050512 Unclassified 2761
179 nmdc:mga0n895_123706_c1 3300050512 Bacteria 2609
180 nmdc:mga0n895_31497_c1 3300050512 Bacteria 5079
181 nmdc:mga0n895_431312_c1 3300050512 Bacteria 1332
182 nmdc:mga0n895_46587_c1 3300050512 Bacteria 4236
183 nmdc:mga0n895_51803_c1 3300050512 Bacteria 4028
184 nmdc:mga0rr50_1165_c1 3300050513 Bacteria 14309
185 nmdc:mga0rr50_54663_c1 3300050513 Unclassified 2976
186 nmdc:mga0a205_103109_c1 3300050515 Bacteria 2751
187 nmdc:mga0a205_2059_c1 3300050515 Bacteria 17585
188 nmdc:mga0a205_322660_c1 3300050515 Bacteria 1415
189 nmdc:mga0a205_328_c2 3300050515 Bacteria 20447
190 nmdc:mga0a205_46472_c1 3300050515 Bacteria 4187
191 nmdc:mga0a205_64663_c1 3300050515 Bacteria 3534
192 Ga0495601_0220949 3300053077 Bacteria 1237
193 Ga0500555_001440 3300053103 Bacteria 7292
194 Ga0500616_0000100 3300053153 Bacteria 173477
195 Ga0500645_001475 3300053730 Bacteria 11815
196 Ga0590071_000455 3300059421 Bacteria 11888
197 Ga0590071_017081 3300059421 Bacteria 1703
198 Ga0590075_001994 3300059424 Bacteria 4922
199 Ga0590075_025839 3300059424 Bacteria 1477
200 Ga0590077_001037 3300059426 Bacteria 6927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005544 Ga0070686_100258523 Ga0070686_1002585231 309
2 3300026075 Ga0207708_10003402 Ga0207708_100034024 328
3 3300005356 Ga0070674_100087097 Ga0070674_1000870973 332
4 3300005456 Ga0070678_100225703 Ga0070678_1002257032 332
5 3300006914 Ga0075436_100043158 Ga0075436_1000431584 332
6 3300007076 Ga0075435_100001844 Ga0075435_10000184414 332
7 3300026121 Ga0207683_10133943 Ga0207683_101339431 332
8 3300042532 Ga0450893_0018852 Ga0450893_0018852_150_1163 337
9 3300050512 nmdc:mga0n895_110802_c1 nmdc:mga0n895_110802_c1_1236_2252 338
10 3300050515 nmdc:mga0a205_2059_c1 nmdc:mga0a205_2059_c1_5184_6200 338
11 3300006237 Ga0097621_100026176 Ga0097621_1000261763 341
12 3300006358 Ga0068871_100000630 Ga0068871_10000063022 341
13 3300014326 Ga0157380_10108078 Ga0157380_101080781 341
14 3300028381 Ga0268264_10083722 Ga0268264_100837223 341
15 3300036401 Ga0373937_0358227 Ga0373937_0358227_51_1076 341
16 3300049574 Ga0501038_0288204 Ga0501038_0288204_86_1111 341
17 3300049582 Ga0501048_0207845 Ga0501048_0207845_253_1278 341
18 3300049587 Ga0501071_0025978 Ga0501071_0025978_2109_3134 341
19 3300049591 Ga0501075_0133502 Ga0501075_0133502_825_1850 341
20 3300049741 Ga0501079_0057294 Ga0501079_0057294_272_1297 341
21 3300005340 Ga0070689_100209268 Ga0070689_1002092682 342
22 3300005353 Ga0070669_100013339 Ga0070669_1000133392 342
23 3300005354 Ga0070675_100059389 Ga0070675_1000593893 342
24 3300005436 Ga0070713_100001546 Ga0070713_1000015464 342
25 3300005441 Ga0070700_100170898 Ga0070700_1001708981 342
26 3300005444 Ga0070694_100018812 Ga0070694_1000188123 342
27 3300005444 Ga0070694_100036596 Ga0070694_1000365962 342
28 3300005458 Ga0070681_10338229 Ga0070681_103382292 342
29 3300005468 Ga0070707_100089541 Ga0070707_1000895412 342
30 3300005471 Ga0070698_100242203 Ga0070698_1002422032 342
31 3300005518 Ga0070699_100001648 Ga0070699_1000016485 342
32 3300005539 Ga0068853_100155434 Ga0068853_1001554342 342
33 3300005545 Ga0070695_100008040 Ga0070695_1000080403 342
34 3300005545 Ga0070695_100202932 Ga0070695_1002029321 342
35 3300005549 Ga0070704_100027720 Ga0070704_1000277203 342
36 3300005549 Ga0070704_100042730 Ga0070704_1000427302 342
37 3300005617 Ga0068859_100063440 Ga0068859_1000634403 342
38 3300006038 Ga0075365_10095538 Ga0075365_100955382 342
39 3300006042 Ga0075368_10009662 Ga0075368_100096623 342
40 3300006177 Ga0075362_10004107 Ga0075362_100041074 342
41 3300006178 Ga0075367_10056262 Ga0075367_100562622 342
42 3300006195 Ga0075366_10002924 Ga0075366_100029248 342
43 3300006195 Ga0075366_10004560 Ga0075366_100045606 342
44 3300006237 Ga0097621_100352482 Ga0097621_1003524822 342
45 3300006844 Ga0075428_100000017 Ga0075428_10000001795 342
46 3300006844 Ga0075428_100009688 Ga0075428_1000096885 342
47 3300006844 Ga0075428_100014905 Ga0075428_1000149054 342
48 3300006844 Ga0075428_100015760 Ga0075428_1000157602 342
49 3300006844 Ga0075428_100272052 Ga0075428_1002720522 342
50 3300006846 Ga0075430_100021191 Ga0075430_1000211912 342
51 3300006846 Ga0075430_100023822 Ga0075430_1000238226 342
52 3300006846 Ga0075430_100042498 Ga0075430_1000424981 342
53 3300006846 Ga0075430_100348239 Ga0075430_1003482392 342
54 3300006847 Ga0075431_100011072 Ga0075431_1000110725 342
55 3300006847 Ga0075431_100052291 Ga0075431_1000522913 342
56 3300006852 Ga0075433_10031902 Ga0075433_100319025 342
57 3300006871 Ga0075434_100001479 Ga0075434_1000014795 342
58 3300006871 Ga0075434_100018859 Ga0075434_1000188594 342
59 3300006880 Ga0075429_100042679 Ga0075429_1000426792 342
60 3300006880 Ga0075429_100201685 Ga0075429_1002016852 342
61 3300006881 Ga0068865_100073821 Ga0068865_1000738213 342
62 3300006931 Ga0097620_100063438 Ga0097620_1000634382 342
63 3300007076 Ga0075435_100041376 Ga0075435_1000413763 342
64 3300009094 Ga0111539_10000002 Ga0111539_10000002343 342
65 3300009094 Ga0111539_10000982 Ga0111539_1000098210 342
66 3300009094 Ga0111539_10004513 Ga0111539_100045135 342
67 3300009094 Ga0111539_10020358 Ga0111539_100203584 342
68 3300009094 Ga0111539_10475256 Ga0111539_104752561 342
69 3300009147 Ga0114129_10001283 Ga0114129_100012832 342
70 3300009147 Ga0114129_10001441 Ga0114129_1000144127 342
71 3300009147 Ga0114129_10008091 Ga0114129_100080915 342
72 3300009147 Ga0114129_10013107 Ga0114129_100131079 342
73 3300009147 Ga0114129_10023315 Ga0114129_1002331510 342
74 3300009147 Ga0114129_10071065 Ga0114129_100710655 342
75 3300009147 Ga0114129_10080876 Ga0114129_100808765 342
76 3300009147 Ga0114129_10253112 Ga0114129_102531122 342
77 3300009147 Ga0114129_10271834 Ga0114129_102718343 342
78 3300009147 Ga0114129_10274247 Ga0114129_102742472 342
79 3300009147 Ga0114129_10478648 Ga0114129_104786482 342
80 3300014326 Ga0157380_10069270 Ga0157380_100692702 342
81 3300014326 Ga0157380_10172057 Ga0157380_101720572 342
82 3300014326 Ga0157380_10194499 Ga0157380_101944991 342
83 3300025923 Ga0207681_10164105 Ga0207681_101641052 342
84 3300025928 Ga0207700_10002781 Ga0207700_100027814 342
85 3300025936 Ga0207670_10203456 Ga0207670_102034561 342
86 3300025936 Ga0207670_10302415 Ga0207670_103024151 342
87 3300025937 Ga0207669_10238069 Ga0207669_102380692 342
88 3300025940 Ga0207691_10118925 Ga0207691_101189252 342
89 3300025941 Ga0207711_10314360 Ga0207711_103143602 342
90 3300025942 Ga0207689_10043087 Ga0207689_100430874 342
91 3300026035 Ga0207703_10284219 Ga0207703_102842192 342
92 3300026075 Ga0207708_10037527 Ga0207708_100375271 342
93 3300026075 Ga0207708_10170388 Ga0207708_101703882 342
94 3300026118 Ga0207675_100013972 Ga0207675_1000139723 342
95 3300026118 Ga0207675_100520741 Ga0207675_1005207411 342
96 3300027866 Ga0209813_10034107 Ga0209813_100341072 342
97 3300027907 Ga0207428_10000004 Ga0207428_10000004313 342
98 3300027907 Ga0207428_10010104 Ga0207428_100101045 342
99 3300027907 Ga0207428_10024473 Ga0207428_100244733 342
100 3300027907 Ga0207428_10025028 Ga0207428_100250282 342
101 3300027907 Ga0207428_10126443 Ga0207428_101264432 342
102 3300028380 Ga0268265_10005404 Ga0268265_100054045 342
103 3300031548 Ga0307408_100111677 Ga0307408_1001116772 342
104 3300031731 Ga0307405_10024883 Ga0307405_100248832 342
105 3300031911 Ga0307412_10114905 Ga0307412_101149051 342
106 3300031995 Ga0307409_100113334 Ga0307409_1001133343 342
107 3300032002 Ga0307416_100032405 Ga0307416_1000324051 342
108 3300032005 Ga0307411_10067997 Ga0307411_100679972 342
109 3300034817 Ga0373948_0000913 Ga0373948_0000913_735_1766 342
110 3300034818 Ga0373950_0002385 Ga0373950_0002385_403_1434 342
111 3300034820 Ga0373959_0002038 Ga0373959_0002038_83_1114 342
112 3300034957 Ga0373938_0002534 Ga0373938_0002534_1064_2095 342
113 3300035084 Ga0373928_0004645 Ga0373928_0004645_601_1632 342
114 3300035085 Ga0373929_0000956 Ga0373929_0000956_229_1260 342
115 3300035092 Ga0373952_0001096 Ga0373952_0001096_2539_3570 342
116 3300035112 Ga0373932_0000599 Ga0373932_0000599_4577_5608 342
117 3300035115 Ga0373941_0000435 Ga0373941_0000435_2844_3875 342
118 3300035121 Ga0373960_0000110 Ga0373960_0000110_8134_9165 342
119 3300035241 Ga0373961_0008002 Ga0373961_0008002_277_1308 342
120 3300035242 Ga0373962_0003358 Ga0373962_0003358_1709_2740 342
121 3300035691 Ga0373931_0005383 Ga0373931_0005383_2207_3238 342
122 3300035692 Ga0373935_0048877 Ga0373935_0048877_137_1168 342
123 3300036401 Ga0373937_0030055 Ga0373937_0030055_1961_2992 342
124 3300037471 Ga0395905_0081729 Ga0395905_0081729_414_1445 342
125 3300039447 Ga0436361_1219863 Ga0436361_1219863_615_1649 342
126 3300041408 Ga0439453_0012554 Ga0439453_0012554_49_1077 342
127 3300042436 Ga0439435_0010030 Ga0439435_0010030_1052_2080 342
128 3300042436 Ga0439435_0020850 Ga0439435_0020850_655_1683 342
129 3300046684 Ga0495669_0028563 Ga0495669_0028563_85_1116 342
130 3300047320 Ga0495672_0011250 Ga0495672_0011250_5256_6284 342
131 3300048905 Ga0496102_0019306 Ga0496102_0019306_3621_4649 342
132 3300048909 Ga0496106_0190121 Ga0496106_0190121_498_1526 342
133 3300048915 Ga0496112_0061580 Ga0496112_0061580_802_1875 342
134 3300048915 Ga0496112_0111384 Ga0496112_0111384_1259_2287 342
135 3300048915 Ga0496112_0165744 Ga0496112_0165744_478_1509 342
136 3300048917 Ga0496114_0180808 Ga0496114_0180808_648_1676 342
137 3300049578 Ga0501042_0059123 Ga0501042_0059123_71_1099 342
138 3300049587 Ga0501071_0132456 Ga0501071_0132456_480_1508 342
139 3300049588 Ga0501072_0247262 Ga0501072_0247262_60_1088 342
140 3300049589 Ga0501073_0047349 Ga0501073_0047349_1429_2457 342
141 3300049591 Ga0501075_0110488 Ga0501075_0110488_15_1043 342
142 3300049592 Ga0501076_0065790 Ga0501076_0065790_1018_2070 342
143 3300049592 Ga0501076_0111923 Ga0501076_0111923_128_1156 342
144 3300049592 Ga0501076_0112060 Ga0501076_0112060_585_1613 342
145 3300049593 Ga0501077_0034023 Ga0501077_0034023_593_1621 342
146 3300049593 Ga0501077_0110355 Ga0501077_0110355_256_1284 342
147 3300049741 Ga0501079_0098928 Ga0501079_0098928_974_2002 342
148 3300049742 Ga0501080_0366787 Ga0501080_0366787_200_1228 342
149 3300050493 nmdc:mga0k408_19472_c1 nmdc:mga0k408_19472_c1_2054_3082 342
150 3300050493 nmdc:mga0k408_30731_c1 nmdc:mga0k408_30731_c1_1949_2977 342
151 3300050494 nmdc:mga06z11_46226_c1 nmdc:mga06z11_46226_c1_979_2007 342
152 3300050507 nmdc:mga05p37_19834_c1 nmdc:mga05p37_19834_c1_51_1082 342
153 3300050507 nmdc:mga05p37_322545_c1 nmdc:mga05p37_322545_c1_782_1810 342
154 3300050507 nmdc:mga05p37_426_c1 nmdc:mga05p37_426_c1_32748_33776 342
155 3300050507 nmdc:mga05p37_63258_c1 nmdc:mga05p37_63258_c1_349_1380 342
156 3300050507 nmdc:mga05p37_70526_c1 nmdc:mga05p37_70526_c1_1935_2966 342
157 3300050507 nmdc:mga05p37_73924_c1 nmdc:mga05p37_73924_c1_1421_2449 342
158 3300050507 nmdc:mga05p37_749600_c1 nmdc:mga05p37_749600_c1_36_1064 342
159 3300050507 nmdc:mga05p37_93203_c1 nmdc:mga05p37_93203_c1_739_1770 342
160 3300050507 nmdc:mga05p37_9537_c1 nmdc:mga05p37_9537_c1_315_1346 342
161 3300050507 nmdc:mga05p37_96478_c1 nmdc:mga05p37_96478_c1_1911_2939 342
162 3300050508 nmdc:mga09592_104492_c1 nmdc:mga09592_104492_c1_217_1245 342
163 3300050508 nmdc:mga09592_14672_c1 nmdc:mga09592_14672_c1_2398_3426 342
164 3300050509 nmdc:mga0qj67_27509_c1 nmdc:mga0qj67_27509_c1_2945_3973 342
165 3300050509 nmdc:mga0qj67_42954_c1 nmdc:mga0qj67_42954_c1_1550_2578 342
166 3300050510 nmdc:mga06r32_14231_c1 nmdc:mga06r32_14231_c1_2675_3703 342
167 3300050510 nmdc:mga06r32_163405_c1 nmdc:mga06r32_163405_c1_216_1244 342
168 3300050510 nmdc:mga06r32_259982_c1 nmdc:mga06r32_259982_c1_511_1539 342
169 3300050510 nmdc:mga06r32_71694_c1 nmdc:mga06r32_71694_c1_2031_3059 342
170 3300050510 nmdc:mga06r32_75465_c1 nmdc:mga06r32_75465_c1_1432_2463 342
171 3300050510 nmdc:mga06r32_81499_c1 nmdc:mga06r32_81499_c1_436_1464 342
172 3300050510 nmdc:mga06r32_82319_c1 nmdc:mga06r32_82319_c1_613_1641 342
173 3300050511 nmdc:mga08y16_118330_c1 nmdc:mga08y16_118330_c1_1600_2628 342
174 3300050511 nmdc:mga08y16_13795_c1 nmdc:mga08y16_13795_c1_4728_5756 342
175 3300050511 nmdc:mga08y16_257_c1 nmdc:mga08y16_257_c1_34026_35054 342
176 3300050511 nmdc:mga08y16_27510_c1 nmdc:mga08y16_27510_c1_1026_2054 342
177 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_570471_571499 342
178 3300050511 nmdc:mga08y16_39348_c1 nmdc:mga08y16_39348_c1_3208_4239 342
179 3300050511 nmdc:mga08y16_88263_c1 nmdc:mga08y16_88263_c1_65_1096 342
180 3300050512 nmdc:mga0n895_123706_c1 nmdc:mga0n895_123706_c1_1400_2431 342
181 3300050512 nmdc:mga0n895_31497_c1 nmdc:mga0n895_31497_c1_3268_4299 342
182 3300050512 nmdc:mga0n895_431312_c1 nmdc:mga0n895_431312_c1_56_1087 342
183 3300050512 nmdc:mga0n895_46587_c1 nmdc:mga0n895_46587_c1_193_1221 342
184 3300050512 nmdc:mga0n895_51803_c1 nmdc:mga0n895_51803_c1_505_1545 342
185 3300050513 nmdc:mga0rr50_1165_c1 nmdc:mga0rr50_1165_c1_11764_12795 342
186 3300050513 nmdc:mga0rr50_54663_c1 nmdc:mga0rr50_54663_c1_1611_2651 342
187 3300050515 nmdc:mga0a205_103109_c1 nmdc:mga0a205_103109_c1_998_2029 342
188 3300050515 nmdc:mga0a205_322660_c1 nmdc:mga0a205_322660_c1_93_1169 342
189 3300050515 nmdc:mga0a205_328_c2 nmdc:mga0a205_328_c2_14917_15957 342
190 3300050515 nmdc:mga0a205_46472_c1 nmdc:mga0a205_46472_c1_1200_2228 342
191 3300050515 nmdc:mga0a205_64663_c1 nmdc:mga0a205_64663_c1_379_1407 342
192 3300053077 Ga0495601_0220949 Ga0495601_0220949_120_1151 342
193 3300053103 Ga0500555_001440 Ga0500555_001440_4151_5179 342
194 3300053153 Ga0500616_0000100 Ga0500616_0000100_75564_76592 342
195 3300053730 Ga0500645_001475 Ga0500645_001475_1259_2287 342
196 3300059421 Ga0590071_000455 Ga0590071_000455_4816_5847 342
197 3300059421 Ga0590071_017081 Ga0590071_017081_531_1559 342
198 3300059424 Ga0590075_001994 Ga0590075_001994_2940_3971 342
199 3300059424 Ga0590075_025839 Ga0590075_025839_211_1239 342
200 3300059426 Ga0590077_001037 Ga0590077_001037_4235_5266 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

2

313

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2afb-assembly1.cif.gz_B crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9456 1 334
2afb-assembly1.cif.gz_A crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9448 2 334
2afb-assembly1.cif.gz_B crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9428 1 334
2afb-assembly1.cif.gz_A crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9281 2 334
4gm6-assembly1.cif.gz_F crystal structure of pfkb family carbohydrate kinase(target efi-502146 from listeria grayi dsm 20601 0.913 2 333
ID Description Score Start End Superfamily
1j5vB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.94 3 332 3.40.1190.20
1j5vB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9313 3 332 3.40.1190.20
4gm6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9152 2 333 3.40.1190.20
4gm6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9097 2 333 3.40.1190.20
3ktnA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9042 1 333 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A3D6A9M7-F1-model_v4 deleted 0.9763 117 205
AF-A0A1F1JT66-F1-model_v4 deleted 0.9593 114 335
AF-A0A3D6A9M7-F1-model_v4 deleted 0.9553 117 205
AF-A0A3N5PY70-F1-model_v4 Sugar kinase 0.9512 130 342 GO:0016301
AF-K1SFL7-F1-model_v4 KHG/KDPG family aldolase/carbohydrate kinase, PfkB family 0.9498 175 315 GO:0016301

Feature Viewer

pLDDT pTM Quality
90.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map