F307178

General Info

Members Datasets Scaffolds Average Seq Length
200 161 400 195

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10018276|Ga0157375_100182766
Length 205
Sequence VQRVTSMIFATANKHKLREMRELLPDLELESLPDGVELPPEEGASFAGIALEKARAAHAATGAAAIGDDSGIEAMGLGGRPGIHSARYGGDGATDEENLAKLLREVTAAGDDRRAAYHCALALVEADGSERVFEARCEGRLIEEARGEGGFGYDPAFVPDDTGGDDPRTMSELSQAEKNEISHRGHAARLLAAHLGASEATSRAR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.5
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10018276 3300013308 Bacteria 6355
2 JGI24746J21847_1000283 3300001977 Bacteria 7228
3 Ga0070683_100009930 3300005329 Bacteria 8160
4 Ga0070683_100016897 3300005329 Bacteria 6439
5 Ga0070677_10000028 3300005333 Bacteria 43011
6 Ga0070680_100060544 3300005336 Bacteria 3098
7 Ga0070682_100000023 3300005337 Bacteria 206016
8 Ga0068868_100001254 3300005338 Bacteria 17445
9 Ga0070661_100349866 3300005344 Bacteria 1159
10 Ga0070674_100000019 3300005356 Bacteria 89350
11 Ga0070674_100000327 3300005356 Bacteria 23475
12 Ga0070673_100349501 3300005364 Bacteria 1312
13 Ga0070703_10123421 3300005406 Bacteria 942
14 Ga0070714_100383704 3300005435 Bacteria 1325
15 Ga0070711_100002037 3300005439 Bacteria 11394
16 Ga0070700_100001694 3300005441 Bacteria 11065
17 Ga0070694_100396804 3300005444 Bacteria 1079
18 Ga0070678_101127177 3300005456 Unclassified 725
19 Ga0070662_100000001 3300005457 Bacteria 317995
20 Ga0068867_100002663 3300005459 Bacteria 12598
21 Ga0070679_100000088 3300005530 Bacteria 69314
22 Ga0070684_100009796 3300005535 Bacteria 7567
23 Ga0068853_100002786 3300005539 Bacteria 13216
24 Ga0070693_100024038 3300005547 Bacteria 3264
25 Ga0070665_100000022 3300005548 Bacteria 379286
26 Ga0070664_100011230 3300005564 Bacteria 7266
27 Ga0068854_100001995 3300005578 Bacteria 12493
28 Ga0068856_100010553 3300005614 Bacteria 8968
29 Ga0068856_100255022 3300005614 Bacteria 1769
30 Ga0068852_100123384 3300005616 Bacteria 2375
31 Ga0068866_10000005 3300005718 Bacteria 196339
32 Ga0068866_10001146 3300005718 Bacteria 11642
33 Ga0068863_100002309 3300005841 Bacteria 18966
34 Ga0068858_100004437 3300005842 Bacteria 13763
35 Ga0068860_100011791 3300005843 Bacteria 8614
36 Ga0081539_10019075 3300005985 Bacteria 4716
37 Ga0070715_10000008 3300006163 Bacteria 189899
38 Ga0070716_100108928 3300006173 Bacteria 1713
39 Ga0070712_100200119 3300006175 Bacteria 1568
40 Ga0068871_100264491 3300006358 Bacteria 1501
41 Ga0068871_100363685 3300006358 Bacteria 1282
42 Ga0075431_100198838 3300006847 Bacteria 2051
43 Ga0075433_10003730 3300006852 Bacteria 11786
44 Ga0075435_100335273 3300007076 Bacteria 1296
45 Ga0105245_10001424 3300009098 Bacteria 21694
46 Ga0105245_10017829 3300009098 Bacteria 6199
47 Ga0105238_10000033 3300009551 Bacteria 172981
48 Ga0105249_10000368 3300009553 Bacteria 44712
49 Ga0105239_11135473 3300010375 Bacteria 900
50 Ga0105246_10540164 3300011119 Bacteria 997
51 Ga0157374_10000785 3300013296 Bacteria 27837
52 Ga0157374_10976079 3300013296 Bacteria 866
53 Ga0163163_10202140 3300014325 Bacteria 2035
54 Ga0157380_10068512 3300014326 Bacteria 2860
55 Ga0157380_10248843 3300014326 Bacteria 1607
56 Ga0157379_10009082 3300014968 Bacteria 8664
57 Ga0163161_10000064 3300017792 Bacteria 108508
58 Ga0163161_10119303 3300017792 Bacteria 1980
59 Ga0207653_10115712 3300025885 Bacteria 961
60 Ga0207682_10000041 3300025893 Bacteria 52338
61 Ga0207642_10000005 3300025899 Bacteria 401934
62 Ga0207642_10000221 3300025899 Bacteria 16812
63 Ga0207685_10000012 3300025905 Bacteria 189900
64 Ga0207707_10226135 3300025912 Bacteria 1628
65 Ga0207693_10061084 3300025915 Bacteria 2952
66 Ga0207663_10000399 3300025916 Bacteria 18806
67 Ga0207660_10226298 3300025917 Bacteria 1469
68 Ga0207652_10000232 3300025921 Bacteria 58473
69 Ga0207694_10000012 3300025924 Bacteria 411218
70 Ga0207687_10000128 3300025927 Bacteria 50603
71 Ga0207687_10009959 3300025927 Bacteria 6220
72 Ga0207664_10015228 3300025929 Bacteria 5577
73 Ga0207706_10000003 3300025933 Bacteria 345011
74 Ga0207709_10012427 3300025935 Bacteria 4690
75 Ga0207670_10120254 3300025936 Bacteria 1908
76 Ga0207669_10000029 3300025937 Bacteria 88351
77 Ga0207669_10000140 3300025937 Bacteria 34667
78 Ga0207665_10146252 3300025939 Bacteria 1689
79 Ga0207661_10005065 3300025944 Bacteria 9252
80 Ga0207661_10006598 3300025944 Bacteria 8205
81 Ga0207651_10000840 3300025960 Bacteria 13360
82 Ga0207712_10000027 3300025961 Bacteria 263739
83 Ga0207640_10004505 3300025981 Bacteria 7558
84 Ga0207677_10001420 3300026023 Bacteria 12761
85 Ga0207703_10000020 3300026035 Bacteria 251603
86 Ga0207639_10003217 3300026041 Bacteria 10984
87 Ga0207708_10003318 3300026075 Bacteria 11848
88 Ga0207702_10003502 3300026078 Bacteria 14309
89 Ga0207702_10392931 3300026078 Bacteria 1336
90 Ga0207641_10000062 3300026088 Bacteria 159982
91 Ga0207648_10005599 3300026089 Bacteria 12631
92 Ga0207683_10015234 3300026121 Bacteria 6543
93 Ga0207698_10060810 3300026142 Bacteria 2939
94 Ga0268266_10000029 3300028379 Bacteria 424015
95 Ga0268264_10000725 3300028381 Bacteria 37821
96 Ga0265326_10000179 3300028558 Bacteria 32210
97 Ga0265322_10000005 3300028654 Bacteria 246112
98 Ga0265336_10030488 3300028666 Bacteria 1679
99 Ga0265328_10000563 3300031239 Bacteria 17200
100 Ga0265320_10000010 3300031240 Bacteria 250501
101 Ga0265331_10005825 3300031250 Bacteria 7384
102 Ga0265327_10000040 3300031251 Bacteria 291052
103 Ga0265316_10057449 3300031344 Bacteria 3034
104 Ga0373937_0022529 3300036401 Bacteria 5665
105 Ga0373937_1613089 3300036401 Unclassified 596
106 Ga0395901_1173017 3300038443 Bacteria 735
107 Ga0451833_1411990 3300041491 Bacteria 1674
108 Ga0451853_1174682 3300041512 Bacteria 5305
109 Ga0466963_0001315 3300044694 Bacteria 13214
110 Ga0466967_0022277 3300045976 Bacteria 5166
111 Ga0495592_0000423 3300046454 Bacteria 32094
112 Ga0495603_0000194 3300046455 Bacteria 31819
113 Ga0495603_0010008 3300046455 Bacteria 5737
114 Ga0495629_0163408 3300046459 Bacteria 1546
115 Ga0495641_0000004 3300046461 Bacteria 210501
116 Ga0495653_0230478 3300046463 Bacteria 1240
117 Ga0495582_0000002 3300046473 Bacteria 219909
118 Ga0495639_0003343 3300046475 Bacteria 6954
119 Ga0495662_0000681 3300046476 Bacteria 16074
120 Ga0495608_0000092 3300046511 Bacteria 64795
121 Ga0495608_0020753 3300046511 Bacteria 4513
122 Ga0495618_0000094 3300046514 Bacteria 64293
123 Ga0495620_0001737 3300046515 Bacteria 12862
124 Ga0495628_0014113 3300046516 Bacteria 6706
125 Ga0495628_0038288 3300046516 Bacteria 3839
126 Ga0495628_0239185 3300046516 Unclassified 1359
127 Ga0495630_0000519 3300046517 Bacteria 28420
128 Ga0495644_0005806 3300046523 Bacteria 4822
129 Ga0495652_0370888 3300046529 Bacteria 1020
130 Ga0495586_0001540 3300046535 Bacteria 12722
131 Ga0495586_0092506 3300046535 Bacteria 1672
132 Ga0495587_0094397 3300046536 Bacteria 1727
133 Ga0495621_0001277 3300046539 Bacteria 6503
134 Ga0495645_0031021 3300046543 Bacteria 3893
135 Ga0495645_0049365 3300046543 Bacteria 3065
136 Ga0495634_0000002 3300046642 Bacteria 247842
137 Ga0495634_0043852 3300046642 Bacteria 3030
138 Ga0495635_0000182 3300046663 Bacteria 39469
139 Ga0495657_0038722 3300046675 Bacteria 3279
140 Ga0495599_0058373 3300046678 Bacteria 2414
141 Ga0495599_0123708 3300046678 Bacteria 1608
142 Ga0495623_0163919 3300046679 Bacteria 1304
143 Ga0495647_0000005 3300046681 Bacteria 125996
144 Ga0495658_0000001 3300046683 Bacteria 385362
145 Ga0495669_0000248 3300046684 Bacteria 31659
146 Ga0495613_0000173 3300046689 Bacteria 62463
147 Ga0495624_0000600 3300046690 Bacteria 28092
148 Ga0495624_0202568 3300046690 Bacteria 1205
149 Ga0495649_0003329 3300046694 Bacteria 10917
150 Ga0495600_0007928 3300046809 Bacteria 6509
151 Ga0495600_0200146 3300046809 Bacteria 1283
152 Ga0495604_0000437 3300047317 Bacteria 37081
153 Ga0495604_0040502 3300047317 Bacteria 3658
154 Ga0495672_0234618 3300047320 Bacteria 899
155 Ga0495676_0000320 3300047321 Bacteria 38969
156 Ga0495676_0279816 3300047321 Bacteria 1130
157 Ga0495680_0000113 3300047322 Bacteria 76525
158 Ga0495680_0005581 3300047322 Bacteria 11797
159 Ga0495680_0259548 3300047322 Bacteria 1229
160 Ga0495679_004087 3300047446 Bacteria 6832
161 Ga0495593_0129876 3300047673 Bacteria 1279
162 Ga0495602_0038771 3300048088 Bacteria 4399
163 Ga0496100_0000234 3300048903 Bacteria 29327
164 Ga0496100_0904505 3300048903 Bacteria 693
165 Ga0496101_0000382 3300048904 Bacteria 29327
166 Ga0496104_0000008 3300048907 Bacteria 516976
167 Ga0496104_0007004 3300048907 Bacteria 9942
168 Ga0496105_0000003 3300048908 Bacteria 713251
169 Ga0496105_0000051 3300048908 Bacteria 90365
170 Ga0496106_0000042 3300048909 Bacteria 106662
171 Ga0496106_0000455 3300048909 Bacteria 29281
172 Ga0496107_0000234 3300048910 Bacteria 29310
173 Ga0496108_0000004 3300048911 Bacteria 545055
174 Ga0496109_0000013 3300048912 Bacteria 227469
175 Ga0496109_0416545 3300048912 Bacteria 1269
176 Ga0496110_0044686 3300048913 Bacteria 3869
177 Ga0496111_0120044 3300048914 Bacteria 1942
178 Ga0496112_0000026 3300048915 Bacteria 144758
179 Ga0496113_0020261 3300048916 Bacteria 4673
180 Ga0496113_0253626 3300048916 Bacteria 1405
181 Ga0496114_0007563 3300048917 Bacteria 8594
182 Ga0501031_0075272 3300049568 Bacteria 2198
183 Ga0501031_0613467 3300049568 Bacteria 700
184 Ga0501039_0098496 3300049575 Bacteria 2281
185 Ga0501040_0032011 3300049576 Bacteria 3557
186 Ga0501041_0357152 3300049577 Archaea 924
187 Ga0501072_0301192 3300049588 Bacteria 1274
188 Ga0501075_0068788 3300049591 Bacteria 2675
189 Ga0501045_0348855 3300049824 Bacteria 1102
190 nmdc:mga06r32_105878_c1 3300050510 Bacteria 2763
191 nmdc:mga0n895_883285_c1 3300050512 Bacteria 880
192 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
193 Ga0495601_0000444 3300053077 Bacteria 21636
194 Ga0495601_0135839 3300053077 Bacteria 1603
195 Ga0495601_0372845 3300053077 Bacteria 927
196 Ga0495612_0002922 3300053078 Bacteria 7083
197 Ga0495612_0041298 3300053078 Bacteria 1881
198 Ga0495595_0004468 3300053084 Bacteria 5631
199 Ga0495619_0014404 3300053085 Bacteria 4994
200 Ga0501082_0558252 3300060353 Bacteria 1002
201 Ga0157375_10018276
202 JGI24746J21847_1000283
203 Ga0070683_100009930
204 Ga0070683_100016897
205 Ga0070677_10000028
206 Ga0070680_100060544
207 Ga0070682_100000023
208 Ga0068868_100001254
209 Ga0070661_100349866
210 Ga0070674_100000019
211 Ga0070674_100000327
212 Ga0070673_100349501
213 Ga0070703_10123421
214 Ga0070714_100383704
215 Ga0070711_100002037
216 Ga0070700_100001694
217 Ga0070694_100396804
218 Ga0070678_101127177
219 Ga0070662_100000001
220 Ga0068867_100002663
221 Ga0070679_100000088
222 Ga0070684_100009796
223 Ga0068853_100002786
224 Ga0070693_100024038
225 Ga0070665_100000022
226 Ga0070664_100011230
227 Ga0068854_100001995
228 Ga0068856_100010553
229 Ga0068856_100255022
230 Ga0068852_100123384
231 Ga0068866_10000005
232 Ga0068866_10001146
233 Ga0068863_100002309
234 Ga0068858_100004437
235 Ga0068860_100011791
236 Ga0081539_10019075
237 Ga0070715_10000008
238 Ga0070716_100108928
239 Ga0070712_100200119
240 Ga0068871_100264491
241 Ga0068871_100363685
242 Ga0075431_100198838
243 Ga0075433_10003730
244 Ga0075435_100335273
245 Ga0105245_10001424
246 Ga0105245_10017829
247 Ga0105238_10000033
248 Ga0105249_10000368
249 Ga0105239_11135473
250 Ga0105246_10540164
251 Ga0157374_10000785
252 Ga0157374_10976079
253 Ga0163163_10202140
254 Ga0157380_10068512
255 Ga0157380_10248843
256 Ga0157379_10009082
257 Ga0163161_10000064
258 Ga0163161_10119303
259 Ga0207653_10115712
260 Ga0207682_10000041
261 Ga0207642_10000005
262 Ga0207642_10000221
263 Ga0207685_10000012
264 Ga0207707_10226135
265 Ga0207693_10061084
266 Ga0207663_10000399
267 Ga0207660_10226298
268 Ga0207652_10000232
269 Ga0207694_10000012
270 Ga0207687_10000128
271 Ga0207687_10009959
272 Ga0207664_10015228
273 Ga0207706_10000003
274 Ga0207709_10012427
275 Ga0207670_10120254
276 Ga0207669_10000029
277 Ga0207669_10000140
278 Ga0207665_10146252
279 Ga0207661_10005065
280 Ga0207661_10006598
281 Ga0207651_10000840
282 Ga0207712_10000027
283 Ga0207640_10004505
284 Ga0207677_10001420
285 Ga0207703_10000020
286 Ga0207639_10003217
287 Ga0207708_10003318
288 Ga0207702_10003502
289 Ga0207702_10392931
290 Ga0207641_10000062
291 Ga0207648_10005599
292 Ga0207683_10015234
293 Ga0207698_10060810
294 Ga0268266_10000029
295 Ga0268264_10000725
296 Ga0265326_10000179
297 Ga0265322_10000005
298 Ga0265336_10030488
299 Ga0265328_10000563
300 Ga0265320_10000010
301 Ga0265331_10005825
302 Ga0265327_10000040
303 Ga0265316_10057449
304 Ga0373937_0022529
305 Ga0373937_1613089
306 Ga0395901_1173017
307 Ga0451833_1411990
308 Ga0451853_1174682
309 Ga0466963_0001315
310 Ga0466967_0022277
311 Ga0495592_0000423
312 Ga0495603_0000194
313 Ga0495603_0010008
314 Ga0495629_0163408
315 Ga0495641_0000004
316 Ga0495653_0230478
317 Ga0495582_0000002
318 Ga0495639_0003343
319 Ga0495662_0000681
320 Ga0495608_0000092
321 Ga0495608_0020753
322 Ga0495618_0000094
323 Ga0495620_0001737
324 Ga0495628_0014113
325 Ga0495628_0038288
326 Ga0495628_0239185
327 Ga0495630_0000519
328 Ga0495644_0005806
329 Ga0495652_0370888
330 Ga0495586_0001540
331 Ga0495586_0092506
332 Ga0495587_0094397
333 Ga0495621_0001277
334 Ga0495645_0031021
335 Ga0495645_0049365
336 Ga0495634_0000002
337 Ga0495634_0043852
338 Ga0495635_0000182
339 Ga0495657_0038722
340 Ga0495599_0058373
341 Ga0495599_0123708
342 Ga0495623_0163919
343 Ga0495647_0000005
344 Ga0495658_0000001
345 Ga0495669_0000248
346 Ga0495613_0000173
347 Ga0495624_0000600
348 Ga0495624_0202568
349 Ga0495649_0003329
350 Ga0495600_0007928
351 Ga0495600_0200146
352 Ga0495604_0000437
353 Ga0495604_0040502
354 Ga0495672_0234618
355 Ga0495676_0000320
356 Ga0495676_0279816
357 Ga0495680_0000113
358 Ga0495680_0005581
359 Ga0495680_0259548
360 Ga0495679_004087
361 Ga0495593_0129876
362 Ga0495602_0038771
363 Ga0496100_0000234
364 Ga0496100_0904505
365 Ga0496101_0000382
366 Ga0496104_0000008
367 Ga0496104_0007004
368 Ga0496105_0000003
369 Ga0496105_0000051
370 Ga0496106_0000042
371 Ga0496106_0000455
372 Ga0496107_0000234
373 Ga0496108_0000004
374 Ga0496109_0000013
375 Ga0496109_0416545
376 Ga0496110_0044686
377 Ga0496111_0120044
378 Ga0496112_0000026
379 Ga0496113_0020261
380 Ga0496113_0253626
381 Ga0496114_0007563
382 Ga0501031_0075272
383 Ga0501031_0613467
384 Ga0501039_0098496
385 Ga0501040_0032011
386 Ga0501041_0357152
387 Ga0501072_0301192
388 Ga0501075_0068788
389 Ga0501045_0348855
390 nmdc:mga06r32_105878_c1
391 nmdc:mga0n895_883285_c1
392 nmdc:mga0a205_4_c1
393 Ga0495601_0000444
394 Ga0495601_0135839
395 Ga0495601_0372845
396 Ga0495612_0002922
397 Ga0495612_0041298
398 Ga0495595_0004468
399 Ga0495619_0014404
400 Ga0501082_0558252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

7

194

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.8741 2 171
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.8632 1 173
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.8502 2 173
2mjp-assembly1.cif.gz_B structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226 0.8415 2 171
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.8385 2 173
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8868 2 173 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8632 1 173 3.90.950.10
af_P47119_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.859 2 173 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8578 2 172 3.90.950.10
af_Q4DRX4_9_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8554 1 170 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A838V3Y1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9169 15 176 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A1M3B816-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.916 15 171 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7W0U9L5-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9146 1 174 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A6I3FT66-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9133 2 171 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A6J6Q8A2-F1-model_v4 Unannotated protein 0.9129 1 173 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429

Map