F307340

General Info

Members Datasets Scaffolds Average Seq Length
200 106 195 253

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10004882|Ga0265338_100048824
Length 270
Sequence LRYHNQLKNEMKRLIVFDLDGTLAESKSSLDAEMSKLLHNLLGIIKVAVISGGNWPQFEKQLLSNLPHDENLENLFLLPTCGTKFYKYADGNWEKIYSEDFTDIEKKKIVDSLKKAIDETGFKVKKVWGELIEDRGSQITYSALGQQAPLEEKKKWDADFAKRKKIKAILGKLIPEFSVRLGGTTSVDITKPGIDKAYGIKKLQDSLGIAIEDMIFIGDALFPGGNDYPAKEAGVLSIKVRDPNESKRIIEAIVACLTNVYETSLKQGGN

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
3 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
4 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
5 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 0.5
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10009584 3300003320 Bacteria 21327
2 rootH1_10017554 3300003323 Bacteria 10290
3 Ga0070683_100046198 3300005329 Bacteria 4022
4 Ga0070680_100035588 3300005336 Bacteria 4020
5 Ga0070691_10088230 3300005341 Unclassified 1526
6 Ga0070709_10273902 3300005434 Bacteria 1224
7 Ga0070708_100600326 3300005445 Bacteria 1038
8 Ga0070681_10043999 3300005458 Bacteria 4469
9 Ga0070707_100402041 3300005468 Unclassified 1330
10 Ga0070698_100037707 3300005471 Bacteria 4983
11 Ga0070699_100248941 3300005518 Bacteria 1587
12 Ga0070679_100031274 3300005530 Bacteria 5257
13 Ga0070684_100154302 3300005535 Bacteria 2081
14 Ga0070684_100239048 3300005535 Bacteria 1659
15 Ga0070684_100549192 3300005535 Unclassified 1072
16 Ga0070697_100054308 3300005536 Bacteria 3256
17 Ga0070695_100249648 3300005545 Bacteria 1291
18 Ga0070695_100349981 3300005545 Bacteria 1107
19 Ga0068855_100011128 3300005563 Bacteria 10861
20 Ga0068855_100049763 3300005563 Bacteria 4942
21 Ga0068856_100003603 3300005614 Bacteria 15588
22 Ga0068856_100259748 3300005614 Unclassified 1752
23 Ga0068856_100761626 3300005614 Bacteria 988
24 Ga0068852_100418648 3300005616 Unclassified 1321
25 Ga0068864_100678401 3300005618 Bacteria 1005
26 Ga0068858_100015576 3300005842 Bacteria 7152
27 Ga0075428_100317588 3300006844 Bacteria 1674
28 Ga0105240_10032987 3300009093 Bacteria 6695
29 Ga0105240_10047745 3300009093 Bacteria 5416
30 Ga0105240_10082729 3300009093 Bacteria 3942
31 Ga0105240_10146375 3300009093 Bacteria 2818
32 Ga0105240_10157115 3300009093 Bacteria 2703
33 Ga0111539_10268841 3300009094 Bacteria 1985
34 Ga0105241_10083540 3300009174 Bacteria 2505
35 Ga0105248_10031811 3300009177 Bacteria 5896
36 Ga0105237_10010586 3300009545 Bacteria 9797
37 Ga0105237_10039683 3300009545 Bacteria 4752
38 Ga0105237_10423845 3300009545 Bacteria 1336
39 Ga0105238_10008964 3300009551 Bacteria 10012
40 Ga0105238_10186633 3300009551 Unclassified 2050
41 Ga0105238_10219613 3300009551 Unclassified 1877
42 Ga0105249_10045496 3300009553 Bacteria 3992
43 Ga0105239_10041336 3300010375 Bacteria 5053
44 Ga0105239_10188471 3300010375 Unclassified 2309
45 Ga0105239_10318608 3300010375 Unclassified 1753
46 Ga0105246_10110727 3300011119 Bacteria 2017
47 Ga0157370_10003738 3300013104 Bacteria 17793
48 Ga0157370_10004698 3300013104 Bacteria 15573
49 Ga0157369_10026226 3300013105 Bacteria 6467
50 Ga0157369_10046815 3300013105 Bacteria 4700
51 Ga0157369_10055609 3300013105 Bacteria 4272
52 Ga0157374_10062813 3300013296 Bacteria 3482
53 Ga0157372_10078169 3300013307 Bacteria 3738
54 Ga0157372_10113733 3300013307 Bacteria 3102
55 Ga0157375_10004423 3300013308 Bacteria 12204
56 Ga0163163_10388166 3300014325 Unclassified 1454
57 Ga0157379_10146675 3300014968 Unclassified 2128
58 Ga0157376_10052410 3300014969 Bacteria 3392
59 Ga0213873_10001469 3300021358 Bacteria 3920
60 Ga0213871_10016432 3300021441 Bacteria 1784
61 Ga0228598_1014757 3300024227 Unclassified 1545
62 Ga0209436_102232 3300025208 Bacteria 6013
63 Ga0209130_1003671 3300025284 Bacteria 6345
64 Ga0207654_10026509 3300025911 Bacteria 3139
65 Ga0207707_10004127 3300025912 Bacteria 12873
66 Ga0207707_10020503 3300025912 Bacteria 5772
67 Ga0207695_10012991 3300025913 Bacteria 9949
68 Ga0207695_10025900 3300025913 Bacteria 6555
69 Ga0207695_10160684 3300025913 Bacteria 2178
70 Ga0207695_10305387 3300025913 Unclassified 1482
71 Ga0207671_10019612 3300025914 Bacteria 5168
72 Ga0207671_10032960 3300025914 Bacteria 3856
73 Ga0207671_10490444 3300025914 Unclassified 979
74 Ga0207652_10023105 3300025921 Bacteria 5149
75 Ga0207652_10144863 3300025921 Bacteria 2125
76 Ga0207694_10006084 3300025924 Bacteria 9225
77 Ga0207694_10204258 3300025924 Bacteria 1608
78 Ga0207687_10011924 3300025927 Bacteria 5684
79 Ga0207711_10000655 3300025941 Bacteria 34545
80 Ga0207711_10001410 3300025941 Bacteria 22505
81 Ga0207711_10100471 3300025941 Bacteria 2559
82 Ga0207661_10020669 3300025944 Bacteria 4925
83 Ga0207667_10010858 3300025949 Bacteria 10621
84 Ga0207667_10057497 3300025949 Bacteria 4082
85 Ga0207712_10182602 3300025961 Bacteria 1649
86 Ga0207703_10020898 3300026035 Bacteria 5121
87 Ga0207674_10386577 3300026116 Bacteria 1353
88 Ga0265337_1068380 3300028556 Bacteria 978
89 Ga0265326_10009331 3300028558 Unclassified 2933
90 Ga0265319_1036242 3300028563 Bacteria 1688
91 Ga0265334_10013001 3300028573 Bacteria 3491
92 Ga0265318_10002014 3300028577 Bacteria 11247
93 Ga0265323_10001081 3300028653 Bacteria 14096
94 Ga0265338_10004571 3300028800 Bacteria 18621
95 Ga0265338_10004882 3300028800 Bacteria 17862
96 Ga0265338_10016075 3300028800 Bacteria 8169
97 Ga0265338_10039359 3300028800 Bacteria 4461
98 Ga0265338_10040442 3300028800 Bacteria 4379
99 Ga0265338_10052951 3300028800 Bacteria 3636
100 Ga0265338_10064823 3300028800 Bacteria 3174
101 Ga0265338_10067896 3300028800 Bacteria 3075
102 Ga0265338_10087796 3300028800 Bacteria 2582
103 Ga0265338_10198345 3300028800 Bacteria 1515
104 Ga0265338_10329031 3300028800 Bacteria 1104
105 Ga0265338_10420286 3300028800 Unclassified 950
106 Ga0265324_10000060 3300029957 Bacteria 92715
107 Ga0265330_10000224 3300031235 Bacteria 43333
108 Ga0265330_10001560 3300031235 Bacteria 13151
109 Ga0265330_10006933 3300031235 Bacteria 5565
110 Ga0265330_10080124 3300031235 Bacteria 1407
111 Ga0265330_10105224 3300031235 Bacteria 1207
112 Ga0265332_10000232 3300031238 Bacteria 44688
113 Ga0265332_10004468 3300031238 Bacteria 6557
114 Ga0265328_10009388 3300031239 Bacteria 3988
115 Ga0265320_10003482 3300031240 Bacteria 10555
116 Ga0265320_10160147 3300031240 Bacteria 1013
117 Ga0265325_10029948 3300031241 Unclassified 2922
118 Ga0265325_10039128 3300031241 Bacteria 2499
119 Ga0265325_10072533 3300031241 Bacteria 1725
120 Ga0265325_10083347 3300031241 Unclassified 1586
121 Ga0265329_10000018 3300031242 Bacteria 66794
122 Ga0265329_10028588 3300031242 Bacteria 1827
123 Ga0265340_10002958 3300031247 Bacteria 9672
124 Ga0265340_10025345 3300031247 Unclassified 3004
125 Ga0265340_10028650 3300031247 Bacteria 2800
126 Ga0265340_10046742 3300031247 Bacteria 2110
127 Ga0265340_10079871 3300031247 Bacteria 1541
128 Ga0265339_10000063 3300031249 Bacteria 93016
129 Ga0265339_10001719 3300031249 Bacteria 16122
130 Ga0265339_10004229 3300031249 Bacteria 9838
131 Ga0265339_10005475 3300031249 Bacteria 8456
132 Ga0265339_10012255 3300031249 Bacteria 5242
133 Ga0265339_10017231 3300031249 Unclassified 4283
134 Ga0265339_10099593 3300031249 Unclassified 1515
135 Ga0265331_10039950 3300031250 Bacteria 2284
136 Ga0265331_10059878 3300031250 Bacteria 1800
137 Ga0265331_10067090 3300031250 Unclassified 1684
138 Ga0265331_10219372 3300031250 Bacteria 855
139 Ga0265331_10237417 3300031250 Bacteria 818
140 Ga0265316_10000002 3300031344 Bacteria 387521
141 Ga0265316_10000524 3300031344 Bacteria 43341
142 Ga0265316_10000905 3300031344 Bacteria 32395
143 Ga0265316_10002858 3300031344 Bacteria 17674
144 Ga0265316_10010205 3300031344 Bacteria 8574
145 Ga0265316_10056393 3300031344 Bacteria 3069
146 Ga0265316_10057627 3300031344 Bacteria 3028
147 Ga0265316_10061306 3300031344 Bacteria 2922
148 Ga0265316_10118505 3300031344 Bacteria 2000
149 Ga0265316_10133543 3300031344 Unclassified 1868
150 Ga0265316_10158289 3300031344 Bacteria 1694
151 Ga0265316_10186806 3300031344 Bacteria 1541
152 Ga0265313_10002065 3300031595 Bacteria 17976
153 Ga0265313_10005533 3300031595 Bacteria 9261
154 Ga0265313_10034641 3300031595 Unclassified 2550
155 Ga0265313_10058959 3300031595 Unclassified 1807
156 Ga0265314_10000028 3300031711 Bacteria 278016
157 Ga0265314_10000607 3300031711 Bacteria 44349
158 Ga0265314_10001215 3300031711 Bacteria 29615
159 Ga0265314_10009096 3300031711 Bacteria 8438
160 Ga0265314_10056794 3300031711 Bacteria 2692
161 Ga0265314_10071023 3300031711 Unclassified 2331
162 Ga0265314_10180848 3300031711 Bacteria 1264
163 Ga0265342_10000002 3300031712 Bacteria 374497
164 Ga0265342_10000528 3300031712 Bacteria 40677
165 Ga0265342_10002414 3300031712 Bacteria 16172
166 Ga0265342_10003133 3300031712 Bacteria 13831
167 Ga0265342_10007872 3300031712 Bacteria 7735
168 Ga0265342_10011116 3300031712 Bacteria 6179
169 Ga0265342_10081900 3300031712 Unclassified 1863
170 Ga0307516_10002331 3300031730 Bacteria 25549
171 Ga0307406_10505969 3300031901 Bacteria 980
172 Ga0373935_0026837 3300035692 Bacteria 3559
173 Ga0373937_0048028 3300036401 Bacteria 3906
174 Ga0395898_0005032 3300037466 Bacteria 14335
175 Ga0436364_0603050 3300037853 Bacteria 1521
176 Ga0436365_1099451 3300039437 Bacteria 1455
177 Ga0436360_0418356 3300039438 Bacteria 3503
178 Ga0436363_1449737 3300039450 Bacteria 1117
179 Ga0436362_0508894 3300039453 Bacteria 1574
180 Ga0436362_1225666 3300039453 Bacteria 6211
181 Ga0451576_0104713 3300045051 Unclassified 2943
182 Ga0495603_0049806 3300046455 Bacteria 2493
183 Ga0495639_0017117 3300046475 Bacteria 3148
184 Ga0495662_0022481 3300046476 Bacteria 3045
185 Ga0495665_0026354 3300046531 Bacteria 3122
186 Ga0495647_0232285 3300046681 Bacteria 817
187 Ga0495613_0090300 3300046689 Bacteria 2219
188 Ga0495581_0014315 3300047315 Bacteria 4600
189 Ga0495604_0213234 3300047317 Bacteria 1333
190 Ga0495676_0062263 3300047321 Bacteria 2914
191 Ga0496109_0661247 3300048912 Bacteria 982
192 Ga0496126_0015832 3300048929 Bacteria 7573
193 Ga0496126_0104197 3300048929 Bacteria 2478
194 Ga0501035_0283804 3300049822 Bacteria 1399
195 nmdc:mga08y16_214040_c1 3300050511 Bacteria 1995

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0232285 Ga0495647_0232285_24_725 225
2 3300049822 Ga0501035_0283804 Ga0501035_0283804_647_1336 227
3 3300006844 Ga0075428_100317588 Ga0075428_1003175882 243
4 3300028800 Ga0265338_10039359 Ga0265338_100393592 243
5 3300031241 Ga0265325_10039128 Ga0265325_100391284 243
6 3300045051 Ga0451576_0104713 Ga0451576_0104713_65_817 244
7 iso_pu_bacteria 2818991460 2819678234 244
8 iso_pu_bacteria 2929177148 2929181078 244
9 iso_pu_bacteria 2939669807 2939673008 244
10 iso_pu_bacteria 2945977869 2945983479 244
11 iso_pu_bacteria 2946013367 2946017131 244
12 3300005329 Ga0070683_100046198 Ga0070683_1000461983 247
13 3300005535 Ga0070684_100154302 Ga0070684_1001543021 247
14 3300005535 Ga0070684_100239048 Ga0070684_1002390482 247
15 3300005563 Ga0068855_100049763 Ga0068855_1000497637 247
16 3300005614 Ga0068856_100003603 Ga0068856_10000360310 247
17 3300005616 Ga0068852_100418648 Ga0068852_1004186482 247
18 3300005618 Ga0068864_100678401 Ga0068864_1006784012 247
19 3300005842 Ga0068858_100015576 Ga0068858_1000155762 247
20 3300009093 Ga0105240_10032987 Ga0105240_100329876 247
21 3300009093 Ga0105240_10047745 Ga0105240_100477455 247
22 3300009545 Ga0105237_10039683 Ga0105237_100396836 247
23 3300009553 Ga0105249_10045496 Ga0105249_100454966 247
24 3300010375 Ga0105239_10041336 Ga0105239_100413364 247
25 3300011119 Ga0105246_10110727 Ga0105246_101107272 247
26 3300013104 Ga0157370_10004698 Ga0157370_1000469812 247
27 3300013105 Ga0157369_10026226 Ga0157369_100262266 247
28 3300013105 Ga0157369_10055609 Ga0157369_100556095 247
29 3300013296 Ga0157374_10062813 Ga0157374_100628134 247
30 3300013307 Ga0157372_10078169 Ga0157372_100781694 247
31 3300013307 Ga0157372_10113733 Ga0157372_101137332 247
32 3300013308 Ga0157375_10004423 Ga0157375_100044238 247
33 3300014969 Ga0157376_10052410 Ga0157376_100524105 247
34 3300021358 Ga0213873_10001469 Ga0213873_100014692 247
35 3300025913 Ga0207695_10025900 Ga0207695_100259006 247
36 3300025913 Ga0207695_10160684 Ga0207695_101606842 247
37 3300025914 Ga0207671_10032960 Ga0207671_100329606 247
38 3300025927 Ga0207687_10011924 Ga0207687_100119246 247
39 3300025941 Ga0207711_10000655 Ga0207711_1000065537 247
40 3300025941 Ga0207711_10001410 Ga0207711_1000141023 247
41 3300025944 Ga0207661_10020669 Ga0207661_100206693 247
42 3300025949 Ga0207667_10057497 Ga0207667_100574975 247
43 3300025961 Ga0207712_10182602 Ga0207712_101826022 247
44 3300026035 Ga0207703_10020898 Ga0207703_100208981 247
45 3300028558 Ga0265326_10009331 Ga0265326_100093314 247
46 3300028800 Ga0265338_10329031 Ga0265338_103290312 247
47 3300031247 Ga0265340_10028650 Ga0265340_100286502 247
48 3300031250 Ga0265331_10219372 Ga0265331_102193721 247
49 3300031344 Ga0265316_10000905 Ga0265316_1000090513 247
50 3300031344 Ga0265316_10061306 Ga0265316_100613062 247
51 3300039437 Ga0436365_1099451 Ga0436365_1099451_278_1021 247
52 3300039450 Ga0436363_1449737 Ga0436363_1449737_58_801 247
53 3300039453 Ga0436362_0508894 Ga0436362_0508894_788_1531 247
54 3300039453 Ga0436362_1225666 Ga0436362_1225666_2970_3713 247
55 3300048929 Ga0496126_0015832 Ga0496126_0015832_6407_7150 247
56 3300003320 rootH2_10009584 rootH2_1000958419 248
57 3300003323 rootH1_10017554 rootH1_100175542 248
58 3300005336 Ga0070680_100035588 Ga0070680_1000355883 248
59 3300005341 Ga0070691_10088230 Ga0070691_100882302 248
60 3300005434 Ga0070709_10273902 Ga0070709_102739022 248
61 3300005445 Ga0070708_100600326 Ga0070708_1006003261 248
62 3300005458 Ga0070681_10043999 Ga0070681_100439992 248
63 3300005468 Ga0070707_100402041 Ga0070707_1004020413 248
64 3300005471 Ga0070698_100037707 Ga0070698_1000377072 248
65 3300005518 Ga0070699_100248941 Ga0070699_1002489412 248
66 3300005530 Ga0070679_100031274 Ga0070679_1000312744 248
67 3300005535 Ga0070684_100549192 Ga0070684_1005491922 248
68 3300005536 Ga0070697_100054308 Ga0070697_1000543084 248
69 3300005545 Ga0070695_100249648 Ga0070695_1002496482 248
70 3300005545 Ga0070695_100349981 Ga0070695_1003499811 248
71 3300005563 Ga0068855_100011128 Ga0068855_1000111283 248
72 3300005614 Ga0068856_100259748 Ga0068856_1002597482 248
73 3300005614 Ga0068856_100761626 Ga0068856_1007616262 248
74 3300009093 Ga0105240_10082729 Ga0105240_100827292 248
75 3300009093 Ga0105240_10146375 Ga0105240_101463752 248
76 3300009093 Ga0105240_10157115 Ga0105240_101571152 248
77 3300009094 Ga0111539_10268841 Ga0111539_102688412 248
78 3300009174 Ga0105241_10083540 Ga0105241_100835402 248
79 3300009177 Ga0105248_10031811 Ga0105248_100318113 248
80 3300009545 Ga0105237_10010586 Ga0105237_100105864 248
81 3300009545 Ga0105237_10423845 Ga0105237_104238452 248
82 3300009551 Ga0105238_10008964 Ga0105238_100089647 248
83 3300009551 Ga0105238_10186633 Ga0105238_101866332 248
84 3300009551 Ga0105238_10219613 Ga0105238_102196132 248
85 3300010375 Ga0105239_10188471 Ga0105239_101884712 248
86 3300010375 Ga0105239_10318608 Ga0105239_103186082 248
87 3300013104 Ga0157370_10003738 Ga0157370_1000373813 248
88 3300013105 Ga0157369_10046815 Ga0157369_100468154 248
89 3300014325 Ga0163163_10388166 Ga0163163_103881662 248
90 3300014968 Ga0157379_10146675 Ga0157379_101466752 248
91 3300021441 Ga0213871_10016432 Ga0213871_100164322 248
92 3300024227 Ga0228598_1014757 Ga0228598_10147572 248
93 3300025208 Ga0209436_102232 Ga0209436_1022326 248
94 3300025284 Ga0209130_1003671 Ga0209130_10036712 248
95 3300025911 Ga0207654_10026509 Ga0207654_100265092 248
96 3300025912 Ga0207707_10004127 Ga0207707_100041277 248
97 3300025912 Ga0207707_10020503 Ga0207707_100205036 248
98 3300025913 Ga0207695_10012991 Ga0207695_100129915 248
99 3300025913 Ga0207695_10305387 Ga0207695_103053871 248
100 3300025914 Ga0207671_10019612 Ga0207671_100196125 248
101 3300025914 Ga0207671_10490444 Ga0207671_104904442 248
102 3300025921 Ga0207652_10023105 Ga0207652_100231056 248
103 3300025921 Ga0207652_10144863 Ga0207652_101448632 248
104 3300025924 Ga0207694_10006084 Ga0207694_100060842 248
105 3300025924 Ga0207694_10204258 Ga0207694_102042582 248
106 3300025941 Ga0207711_10100471 Ga0207711_101004713 248
107 3300025949 Ga0207667_10010858 Ga0207667_1001085814 248
108 3300026116 Ga0207674_10386577 Ga0207674_103865772 248
109 3300028556 Ga0265337_1068380 Ga0265337_10683801 248
110 3300028563 Ga0265319_1036242 Ga0265319_10362422 248
111 3300028573 Ga0265334_10013001 Ga0265334_100130012 248
112 3300028577 Ga0265318_10002014 Ga0265318_100020146 248
113 3300028653 Ga0265323_10001081 Ga0265323_1000108113 248
114 3300028800 Ga0265338_10004571 Ga0265338_1000457112 248
115 3300028800 Ga0265338_10004882 Ga0265338_100048824 248
116 3300028800 Ga0265338_10016075 Ga0265338_100160757 248
117 3300028800 Ga0265338_10040442 Ga0265338_100404422 248
118 3300028800 Ga0265338_10052951 Ga0265338_100529512 248
119 3300028800 Ga0265338_10064823 Ga0265338_100648232 248
120 3300028800 Ga0265338_10067896 Ga0265338_100678962 248
121 3300028800 Ga0265338_10087796 Ga0265338_100877963 248
122 3300028800 Ga0265338_10198345 Ga0265338_101983452 248
123 3300028800 Ga0265338_10420286 Ga0265338_104202862 248
124 3300029957 Ga0265324_10000060 Ga0265324_1000006021 248
125 3300031235 Ga0265330_10000224 Ga0265330_1000022427 248
126 3300031235 Ga0265330_10001560 Ga0265330_100015604 248
127 3300031235 Ga0265330_10006933 Ga0265330_100069333 248
128 3300031235 Ga0265330_10080124 Ga0265330_100801242 248
129 3300031235 Ga0265330_10105224 Ga0265330_101052242 248
130 3300031238 Ga0265332_10000232 Ga0265332_1000023227 248
131 3300031238 Ga0265332_10004468 Ga0265332_100044686 248
132 3300031239 Ga0265328_10009388 Ga0265328_100093882 248
133 3300031240 Ga0265320_10003482 Ga0265320_100034829 248
134 3300031240 Ga0265320_10160147 Ga0265320_101601472 248
135 3300031241 Ga0265325_10029948 Ga0265325_100299483 248
136 3300031241 Ga0265325_10072533 Ga0265325_100725332 248
137 3300031241 Ga0265325_10083347 Ga0265325_100833472 248
138 3300031242 Ga0265329_10000018 Ga0265329_1000001820 248
139 3300031242 Ga0265329_10028588 Ga0265329_100285882 248
140 3300031247 Ga0265340_10002958 Ga0265340_100029583 248
141 3300031247 Ga0265340_10025345 Ga0265340_100253452 248
142 3300031247 Ga0265340_10046742 Ga0265340_100467423 248
143 3300031247 Ga0265340_10079871 Ga0265340_100798712 248
144 3300031249 Ga0265339_10000063 Ga0265339_1000006371 248
145 3300031249 Ga0265339_10001719 Ga0265339_100017192 248
146 3300031249 Ga0265339_10004229 Ga0265339_100042293 248
147 3300031249 Ga0265339_10005475 Ga0265339_100054752 248
148 3300031249 Ga0265339_10012255 Ga0265339_100122553 248
149 3300031249 Ga0265339_10017231 Ga0265339_100172315 248
150 3300031249 Ga0265339_10099593 Ga0265339_100995932 248
151 3300031250 Ga0265331_10039950 Ga0265331_100399502 248
152 3300031250 Ga0265331_10059878 Ga0265331_100598782 248
153 3300031250 Ga0265331_10067090 Ga0265331_100670902 248
154 3300031250 Ga0265331_10237417 Ga0265331_102374171 248
155 3300031344 Ga0265316_10000002 Ga0265316_10000002124 248
156 3300031344 Ga0265316_10000524 Ga0265316_1000052427 248
157 3300031344 Ga0265316_10002858 Ga0265316_1000285811 248
158 3300031344 Ga0265316_10010205 Ga0265316_100102053 248
159 3300031344 Ga0265316_10056393 Ga0265316_100563933 248
160 3300031344 Ga0265316_10057627 Ga0265316_100576272 248
161 3300031344 Ga0265316_10118505 Ga0265316_101185052 248
162 3300031344 Ga0265316_10133543 Ga0265316_101335432 248
163 3300031344 Ga0265316_10158289 Ga0265316_101582892 248
164 3300031344 Ga0265316_10186806 Ga0265316_101868062 248
165 3300031595 Ga0265313_10002065 Ga0265313_100020654 248
166 3300031595 Ga0265313_10005533 Ga0265313_100055333 248
167 3300031595 Ga0265313_10034641 Ga0265313_100346412 248
168 3300031595 Ga0265313_10058959 Ga0265313_100589592 248
169 3300031711 Ga0265314_10000028 Ga0265314_10000028195 248
170 3300031711 Ga0265314_10000607 Ga0265314_1000060728 248
171 3300031711 Ga0265314_10001215 Ga0265314_100012152 248
172 3300031711 Ga0265314_10009096 Ga0265314_100090962 248
173 3300031711 Ga0265314_10056794 Ga0265314_100567943 248
174 3300031711 Ga0265314_10071023 Ga0265314_100710232 248
175 3300031711 Ga0265314_10180848 Ga0265314_101808482 248
176 3300031712 Ga0265342_10000002 Ga0265342_10000002261 248
177 3300031712 Ga0265342_10000528 Ga0265342_100005288 248
178 3300031712 Ga0265342_10002414 Ga0265342_1000241415 248
179 3300031712 Ga0265342_10003133 Ga0265342_100031332 248
180 3300031712 Ga0265342_10007872 Ga0265342_100078722 248
181 3300031712 Ga0265342_10011116 Ga0265342_100111162 248
182 3300031712 Ga0265342_10081900 Ga0265342_100819002 248
183 3300031730 Ga0307516_10002331 Ga0307516_1000233111 248
184 3300031901 Ga0307406_10505969 Ga0307406_105059692 248
185 3300035692 Ga0373935_0026837 Ga0373935_0026837_2165_3037 248
186 3300036401 Ga0373937_0048028 Ga0373937_0048028_1763_2566 248
187 3300037466 Ga0395898_0005032 Ga0395898_0005032_4292_5041 248
188 3300037853 Ga0436364_0603050 Ga0436364_0603050_290_1042 248
189 3300039438 Ga0436360_0418356 Ga0436360_0418356_2145_2891 248
190 3300046455 Ga0495603_0049806 Ga0495603_0049806_1170_1961 248
191 3300046475 Ga0495639_0017117 Ga0495639_0017117_54_857 248
192 3300046476 Ga0495662_0022481 Ga0495662_0022481_930_1727 248
193 3300046531 Ga0495665_0026354 Ga0495665_0026354_242_1045 248
194 3300046689 Ga0495613_0090300 Ga0495613_0090300_300_1070 248
195 3300047315 Ga0495581_0014315 Ga0495581_0014315_2889_3692 248
196 3300047317 Ga0495604_0213234 Ga0495604_0213234_42_812 248
197 3300047321 Ga0495676_0062263 Ga0495676_0062263_1143_1946 248
198 3300048912 Ga0496109_0661247 Ga0496109_0661247_116_874 248
199 3300048929 Ga0496126_0104197 Ga0496126_0104197_133_885 248
200 3300050511 nmdc:mga08y16_214040_c1 nmdc:mga08y16_214040_c1_1162_1941 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

15

230

0.88

PF03332

PMM

Eukaryotic phosphomannomutase

34

256

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.903 1 245
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.9017 1 245
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8895 1 245
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8881 1 245
6i5x-assembly1.cif.gz_A crystal structure of aspergillus fumigatus phosphomannomutase 0.8239 3 242
ID Description Score Start End Superfamily
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9615 1 245 3.40.50.1000
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9375 1 245 3.40.50.1000
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.9305 90 181 3.30.1240.20
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.8848 90 181 3.30.1240.20
af_B5DF46_1_74_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8551 1 78 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A208Y5C1-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9878 1 248 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0016791
GO:0046872
AF-A0A7C7LUT6-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9863 2 245 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0016791
GO:0046872
AF-A0A194V1M1-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9853 1 248 GO:0004615
GO:0005737
GO:0009298
GO:0046872
AF-A0A1C4H2V0-F1-model_v4 Phosphomannomutase 0.9849 2 246 GO:0005737
GO:0016791
AF-A0A1W2DUB9-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9839 1 245 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.95 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map