F307340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 200 | 106 | 195 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10004882|Ga0265338_100048824 |
| Length | 270 |
| Sequence | LRYHNQLKNEMKRLIVFDLDGTLAESKSSLDAEMSKLLHNLLGIIKVAVISGGNWPQFEKQLLSNLPHDENLENLFLLPTCGTKFYKYADGNWEKIYSEDFTDIEKKKIVDSLKKAIDETGFKVKKVWGELIEDRGSQITYSALGQQAPLEEKKKWDADFAKRKKIKAILGKLIPEFSVRLGGTTSVDITKPGIDKAYGIKKLQDSLGIAIEDMIFIGDALFPGGNDYPAKEAGVLSIKVRDPNESKRIIEAIVACLTNVYETSLKQGGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 2 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 3 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 4 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 5 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 45 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 46 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 47 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 64 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 65 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 66 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 67 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 73 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 75 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 77 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 79 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 88 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 89 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 90 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 91 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 92 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 93 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 94 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 104 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 105 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.5 |
| Metatranscriptomes | 0 |
| Isolates | 2.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 93.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10009584 | 3300003320 | Bacteria | 21327 |
| 2 | rootH1_10017554 | 3300003323 | Bacteria | 10290 |
| 3 | Ga0070683_100046198 | 3300005329 | Bacteria | 4022 |
| 4 | Ga0070680_100035588 | 3300005336 | Bacteria | 4020 |
| 5 | Ga0070691_10088230 | 3300005341 | Unclassified | 1526 |
| 6 | Ga0070709_10273902 | 3300005434 | Bacteria | 1224 |
| 7 | Ga0070708_100600326 | 3300005445 | Bacteria | 1038 |
| 8 | Ga0070681_10043999 | 3300005458 | Bacteria | 4469 |
| 9 | Ga0070707_100402041 | 3300005468 | Unclassified | 1330 |
| 10 | Ga0070698_100037707 | 3300005471 | Bacteria | 4983 |
| 11 | Ga0070699_100248941 | 3300005518 | Bacteria | 1587 |
| 12 | Ga0070679_100031274 | 3300005530 | Bacteria | 5257 |
| 13 | Ga0070684_100154302 | 3300005535 | Bacteria | 2081 |
| 14 | Ga0070684_100239048 | 3300005535 | Bacteria | 1659 |
| 15 | Ga0070684_100549192 | 3300005535 | Unclassified | 1072 |
| 16 | Ga0070697_100054308 | 3300005536 | Bacteria | 3256 |
| 17 | Ga0070695_100249648 | 3300005545 | Bacteria | 1291 |
| 18 | Ga0070695_100349981 | 3300005545 | Bacteria | 1107 |
| 19 | Ga0068855_100011128 | 3300005563 | Bacteria | 10861 |
| 20 | Ga0068855_100049763 | 3300005563 | Bacteria | 4942 |
| 21 | Ga0068856_100003603 | 3300005614 | Bacteria | 15588 |
| 22 | Ga0068856_100259748 | 3300005614 | Unclassified | 1752 |
| 23 | Ga0068856_100761626 | 3300005614 | Bacteria | 988 |
| 24 | Ga0068852_100418648 | 3300005616 | Unclassified | 1321 |
| 25 | Ga0068864_100678401 | 3300005618 | Bacteria | 1005 |
| 26 | Ga0068858_100015576 | 3300005842 | Bacteria | 7152 |
| 27 | Ga0075428_100317588 | 3300006844 | Bacteria | 1674 |
| 28 | Ga0105240_10032987 | 3300009093 | Bacteria | 6695 |
| 29 | Ga0105240_10047745 | 3300009093 | Bacteria | 5416 |
| 30 | Ga0105240_10082729 | 3300009093 | Bacteria | 3942 |
| 31 | Ga0105240_10146375 | 3300009093 | Bacteria | 2818 |
| 32 | Ga0105240_10157115 | 3300009093 | Bacteria | 2703 |
| 33 | Ga0111539_10268841 | 3300009094 | Bacteria | 1985 |
| 34 | Ga0105241_10083540 | 3300009174 | Bacteria | 2505 |
| 35 | Ga0105248_10031811 | 3300009177 | Bacteria | 5896 |
| 36 | Ga0105237_10010586 | 3300009545 | Bacteria | 9797 |
| 37 | Ga0105237_10039683 | 3300009545 | Bacteria | 4752 |
| 38 | Ga0105237_10423845 | 3300009545 | Bacteria | 1336 |
| 39 | Ga0105238_10008964 | 3300009551 | Bacteria | 10012 |
| 40 | Ga0105238_10186633 | 3300009551 | Unclassified | 2050 |
| 41 | Ga0105238_10219613 | 3300009551 | Unclassified | 1877 |
| 42 | Ga0105249_10045496 | 3300009553 | Bacteria | 3992 |
| 43 | Ga0105239_10041336 | 3300010375 | Bacteria | 5053 |
| 44 | Ga0105239_10188471 | 3300010375 | Unclassified | 2309 |
| 45 | Ga0105239_10318608 | 3300010375 | Unclassified | 1753 |
| 46 | Ga0105246_10110727 | 3300011119 | Bacteria | 2017 |
| 47 | Ga0157370_10003738 | 3300013104 | Bacteria | 17793 |
| 48 | Ga0157370_10004698 | 3300013104 | Bacteria | 15573 |
| 49 | Ga0157369_10026226 | 3300013105 | Bacteria | 6467 |
| 50 | Ga0157369_10046815 | 3300013105 | Bacteria | 4700 |
| 51 | Ga0157369_10055609 | 3300013105 | Bacteria | 4272 |
| 52 | Ga0157374_10062813 | 3300013296 | Bacteria | 3482 |
| 53 | Ga0157372_10078169 | 3300013307 | Bacteria | 3738 |
| 54 | Ga0157372_10113733 | 3300013307 | Bacteria | 3102 |
| 55 | Ga0157375_10004423 | 3300013308 | Bacteria | 12204 |
| 56 | Ga0163163_10388166 | 3300014325 | Unclassified | 1454 |
| 57 | Ga0157379_10146675 | 3300014968 | Unclassified | 2128 |
| 58 | Ga0157376_10052410 | 3300014969 | Bacteria | 3392 |
| 59 | Ga0213873_10001469 | 3300021358 | Bacteria | 3920 |
| 60 | Ga0213871_10016432 | 3300021441 | Bacteria | 1784 |
| 61 | Ga0228598_1014757 | 3300024227 | Unclassified | 1545 |
| 62 | Ga0209436_102232 | 3300025208 | Bacteria | 6013 |
| 63 | Ga0209130_1003671 | 3300025284 | Bacteria | 6345 |
| 64 | Ga0207654_10026509 | 3300025911 | Bacteria | 3139 |
| 65 | Ga0207707_10004127 | 3300025912 | Bacteria | 12873 |
| 66 | Ga0207707_10020503 | 3300025912 | Bacteria | 5772 |
| 67 | Ga0207695_10012991 | 3300025913 | Bacteria | 9949 |
| 68 | Ga0207695_10025900 | 3300025913 | Bacteria | 6555 |
| 69 | Ga0207695_10160684 | 3300025913 | Bacteria | 2178 |
| 70 | Ga0207695_10305387 | 3300025913 | Unclassified | 1482 |
| 71 | Ga0207671_10019612 | 3300025914 | Bacteria | 5168 |
| 72 | Ga0207671_10032960 | 3300025914 | Bacteria | 3856 |
| 73 | Ga0207671_10490444 | 3300025914 | Unclassified | 979 |
| 74 | Ga0207652_10023105 | 3300025921 | Bacteria | 5149 |
| 75 | Ga0207652_10144863 | 3300025921 | Bacteria | 2125 |
| 76 | Ga0207694_10006084 | 3300025924 | Bacteria | 9225 |
| 77 | Ga0207694_10204258 | 3300025924 | Bacteria | 1608 |
| 78 | Ga0207687_10011924 | 3300025927 | Bacteria | 5684 |
| 79 | Ga0207711_10000655 | 3300025941 | Bacteria | 34545 |
| 80 | Ga0207711_10001410 | 3300025941 | Bacteria | 22505 |
| 81 | Ga0207711_10100471 | 3300025941 | Bacteria | 2559 |
| 82 | Ga0207661_10020669 | 3300025944 | Bacteria | 4925 |
| 83 | Ga0207667_10010858 | 3300025949 | Bacteria | 10621 |
| 84 | Ga0207667_10057497 | 3300025949 | Bacteria | 4082 |
| 85 | Ga0207712_10182602 | 3300025961 | Bacteria | 1649 |
| 86 | Ga0207703_10020898 | 3300026035 | Bacteria | 5121 |
| 87 | Ga0207674_10386577 | 3300026116 | Bacteria | 1353 |
| 88 | Ga0265337_1068380 | 3300028556 | Bacteria | 978 |
| 89 | Ga0265326_10009331 | 3300028558 | Unclassified | 2933 |
| 90 | Ga0265319_1036242 | 3300028563 | Bacteria | 1688 |
| 91 | Ga0265334_10013001 | 3300028573 | Bacteria | 3491 |
| 92 | Ga0265318_10002014 | 3300028577 | Bacteria | 11247 |
| 93 | Ga0265323_10001081 | 3300028653 | Bacteria | 14096 |
| 94 | Ga0265338_10004571 | 3300028800 | Bacteria | 18621 |
| 95 | Ga0265338_10004882 | 3300028800 | Bacteria | 17862 |
| 96 | Ga0265338_10016075 | 3300028800 | Bacteria | 8169 |
| 97 | Ga0265338_10039359 | 3300028800 | Bacteria | 4461 |
| 98 | Ga0265338_10040442 | 3300028800 | Bacteria | 4379 |
| 99 | Ga0265338_10052951 | 3300028800 | Bacteria | 3636 |
| 100 | Ga0265338_10064823 | 3300028800 | Bacteria | 3174 |
| 101 | Ga0265338_10067896 | 3300028800 | Bacteria | 3075 |
| 102 | Ga0265338_10087796 | 3300028800 | Bacteria | 2582 |
| 103 | Ga0265338_10198345 | 3300028800 | Bacteria | 1515 |
| 104 | Ga0265338_10329031 | 3300028800 | Bacteria | 1104 |
| 105 | Ga0265338_10420286 | 3300028800 | Unclassified | 950 |
| 106 | Ga0265324_10000060 | 3300029957 | Bacteria | 92715 |
| 107 | Ga0265330_10000224 | 3300031235 | Bacteria | 43333 |
| 108 | Ga0265330_10001560 | 3300031235 | Bacteria | 13151 |
| 109 | Ga0265330_10006933 | 3300031235 | Bacteria | 5565 |
| 110 | Ga0265330_10080124 | 3300031235 | Bacteria | 1407 |
| 111 | Ga0265330_10105224 | 3300031235 | Bacteria | 1207 |
| 112 | Ga0265332_10000232 | 3300031238 | Bacteria | 44688 |
| 113 | Ga0265332_10004468 | 3300031238 | Bacteria | 6557 |
| 114 | Ga0265328_10009388 | 3300031239 | Bacteria | 3988 |
| 115 | Ga0265320_10003482 | 3300031240 | Bacteria | 10555 |
| 116 | Ga0265320_10160147 | 3300031240 | Bacteria | 1013 |
| 117 | Ga0265325_10029948 | 3300031241 | Unclassified | 2922 |
| 118 | Ga0265325_10039128 | 3300031241 | Bacteria | 2499 |
| 119 | Ga0265325_10072533 | 3300031241 | Bacteria | 1725 |
| 120 | Ga0265325_10083347 | 3300031241 | Unclassified | 1586 |
| 121 | Ga0265329_10000018 | 3300031242 | Bacteria | 66794 |
| 122 | Ga0265329_10028588 | 3300031242 | Bacteria | 1827 |
| 123 | Ga0265340_10002958 | 3300031247 | Bacteria | 9672 |
| 124 | Ga0265340_10025345 | 3300031247 | Unclassified | 3004 |
| 125 | Ga0265340_10028650 | 3300031247 | Bacteria | 2800 |
| 126 | Ga0265340_10046742 | 3300031247 | Bacteria | 2110 |
| 127 | Ga0265340_10079871 | 3300031247 | Bacteria | 1541 |
| 128 | Ga0265339_10000063 | 3300031249 | Bacteria | 93016 |
| 129 | Ga0265339_10001719 | 3300031249 | Bacteria | 16122 |
| 130 | Ga0265339_10004229 | 3300031249 | Bacteria | 9838 |
| 131 | Ga0265339_10005475 | 3300031249 | Bacteria | 8456 |
| 132 | Ga0265339_10012255 | 3300031249 | Bacteria | 5242 |
| 133 | Ga0265339_10017231 | 3300031249 | Unclassified | 4283 |
| 134 | Ga0265339_10099593 | 3300031249 | Unclassified | 1515 |
| 135 | Ga0265331_10039950 | 3300031250 | Bacteria | 2284 |
| 136 | Ga0265331_10059878 | 3300031250 | Bacteria | 1800 |
| 137 | Ga0265331_10067090 | 3300031250 | Unclassified | 1684 |
| 138 | Ga0265331_10219372 | 3300031250 | Bacteria | 855 |
| 139 | Ga0265331_10237417 | 3300031250 | Bacteria | 818 |
| 140 | Ga0265316_10000002 | 3300031344 | Bacteria | 387521 |
| 141 | Ga0265316_10000524 | 3300031344 | Bacteria | 43341 |
| 142 | Ga0265316_10000905 | 3300031344 | Bacteria | 32395 |
| 143 | Ga0265316_10002858 | 3300031344 | Bacteria | 17674 |
| 144 | Ga0265316_10010205 | 3300031344 | Bacteria | 8574 |
| 145 | Ga0265316_10056393 | 3300031344 | Bacteria | 3069 |
| 146 | Ga0265316_10057627 | 3300031344 | Bacteria | 3028 |
| 147 | Ga0265316_10061306 | 3300031344 | Bacteria | 2922 |
| 148 | Ga0265316_10118505 | 3300031344 | Bacteria | 2000 |
| 149 | Ga0265316_10133543 | 3300031344 | Unclassified | 1868 |
| 150 | Ga0265316_10158289 | 3300031344 | Bacteria | 1694 |
| 151 | Ga0265316_10186806 | 3300031344 | Bacteria | 1541 |
| 152 | Ga0265313_10002065 | 3300031595 | Bacteria | 17976 |
| 153 | Ga0265313_10005533 | 3300031595 | Bacteria | 9261 |
| 154 | Ga0265313_10034641 | 3300031595 | Unclassified | 2550 |
| 155 | Ga0265313_10058959 | 3300031595 | Unclassified | 1807 |
| 156 | Ga0265314_10000028 | 3300031711 | Bacteria | 278016 |
| 157 | Ga0265314_10000607 | 3300031711 | Bacteria | 44349 |
| 158 | Ga0265314_10001215 | 3300031711 | Bacteria | 29615 |
| 159 | Ga0265314_10009096 | 3300031711 | Bacteria | 8438 |
| 160 | Ga0265314_10056794 | 3300031711 | Bacteria | 2692 |
| 161 | Ga0265314_10071023 | 3300031711 | Unclassified | 2331 |
| 162 | Ga0265314_10180848 | 3300031711 | Bacteria | 1264 |
| 163 | Ga0265342_10000002 | 3300031712 | Bacteria | 374497 |
| 164 | Ga0265342_10000528 | 3300031712 | Bacteria | 40677 |
| 165 | Ga0265342_10002414 | 3300031712 | Bacteria | 16172 |
| 166 | Ga0265342_10003133 | 3300031712 | Bacteria | 13831 |
| 167 | Ga0265342_10007872 | 3300031712 | Bacteria | 7735 |
| 168 | Ga0265342_10011116 | 3300031712 | Bacteria | 6179 |
| 169 | Ga0265342_10081900 | 3300031712 | Unclassified | 1863 |
| 170 | Ga0307516_10002331 | 3300031730 | Bacteria | 25549 |
| 171 | Ga0307406_10505969 | 3300031901 | Bacteria | 980 |
| 172 | Ga0373935_0026837 | 3300035692 | Bacteria | 3559 |
| 173 | Ga0373937_0048028 | 3300036401 | Bacteria | 3906 |
| 174 | Ga0395898_0005032 | 3300037466 | Bacteria | 14335 |
| 175 | Ga0436364_0603050 | 3300037853 | Bacteria | 1521 |
| 176 | Ga0436365_1099451 | 3300039437 | Bacteria | 1455 |
| 177 | Ga0436360_0418356 | 3300039438 | Bacteria | 3503 |
| 178 | Ga0436363_1449737 | 3300039450 | Bacteria | 1117 |
| 179 | Ga0436362_0508894 | 3300039453 | Bacteria | 1574 |
| 180 | Ga0436362_1225666 | 3300039453 | Bacteria | 6211 |
| 181 | Ga0451576_0104713 | 3300045051 | Unclassified | 2943 |
| 182 | Ga0495603_0049806 | 3300046455 | Bacteria | 2493 |
| 183 | Ga0495639_0017117 | 3300046475 | Bacteria | 3148 |
| 184 | Ga0495662_0022481 | 3300046476 | Bacteria | 3045 |
| 185 | Ga0495665_0026354 | 3300046531 | Bacteria | 3122 |
| 186 | Ga0495647_0232285 | 3300046681 | Bacteria | 817 |
| 187 | Ga0495613_0090300 | 3300046689 | Bacteria | 2219 |
| 188 | Ga0495581_0014315 | 3300047315 | Bacteria | 4600 |
| 189 | Ga0495604_0213234 | 3300047317 | Bacteria | 1333 |
| 190 | Ga0495676_0062263 | 3300047321 | Bacteria | 2914 |
| 191 | Ga0496109_0661247 | 3300048912 | Bacteria | 982 |
| 192 | Ga0496126_0015832 | 3300048929 | Bacteria | 7573 |
| 193 | Ga0496126_0104197 | 3300048929 | Bacteria | 2478 |
| 194 | Ga0501035_0283804 | 3300049822 | Bacteria | 1399 |
| 195 | nmdc:mga08y16_214040_c1 | 3300050511 | Bacteria | 1995 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046681 | Ga0495647_0232285 | Ga0495647_0232285_24_725 | 225 |
| 2 | 3300049822 | Ga0501035_0283804 | Ga0501035_0283804_647_1336 | 227 |
| 3 | 3300006844 | Ga0075428_100317588 | Ga0075428_1003175882 | 243 |
| 4 | 3300028800 | Ga0265338_10039359 | Ga0265338_100393592 | 243 |
| 5 | 3300031241 | Ga0265325_10039128 | Ga0265325_100391284 | 243 |
| 6 | 3300045051 | Ga0451576_0104713 | Ga0451576_0104713_65_817 | 244 |
| 7 | iso_pu_bacteria | 2818991460 | 2819678234 | 244 |
| 8 | iso_pu_bacteria | 2929177148 | 2929181078 | 244 |
| 9 | iso_pu_bacteria | 2939669807 | 2939673008 | 244 |
| 10 | iso_pu_bacteria | 2945977869 | 2945983479 | 244 |
| 11 | iso_pu_bacteria | 2946013367 | 2946017131 | 244 |
| 12 | 3300005329 | Ga0070683_100046198 | Ga0070683_1000461983 | 247 |
| 13 | 3300005535 | Ga0070684_100154302 | Ga0070684_1001543021 | 247 |
| 14 | 3300005535 | Ga0070684_100239048 | Ga0070684_1002390482 | 247 |
| 15 | 3300005563 | Ga0068855_100049763 | Ga0068855_1000497637 | 247 |
| 16 | 3300005614 | Ga0068856_100003603 | Ga0068856_10000360310 | 247 |
| 17 | 3300005616 | Ga0068852_100418648 | Ga0068852_1004186482 | 247 |
| 18 | 3300005618 | Ga0068864_100678401 | Ga0068864_1006784012 | 247 |
| 19 | 3300005842 | Ga0068858_100015576 | Ga0068858_1000155762 | 247 |
| 20 | 3300009093 | Ga0105240_10032987 | Ga0105240_100329876 | 247 |
| 21 | 3300009093 | Ga0105240_10047745 | Ga0105240_100477455 | 247 |
| 22 | 3300009545 | Ga0105237_10039683 | Ga0105237_100396836 | 247 |
| 23 | 3300009553 | Ga0105249_10045496 | Ga0105249_100454966 | 247 |
| 24 | 3300010375 | Ga0105239_10041336 | Ga0105239_100413364 | 247 |
| 25 | 3300011119 | Ga0105246_10110727 | Ga0105246_101107272 | 247 |
| 26 | 3300013104 | Ga0157370_10004698 | Ga0157370_1000469812 | 247 |
| 27 | 3300013105 | Ga0157369_10026226 | Ga0157369_100262266 | 247 |
| 28 | 3300013105 | Ga0157369_10055609 | Ga0157369_100556095 | 247 |
| 29 | 3300013296 | Ga0157374_10062813 | Ga0157374_100628134 | 247 |
| 30 | 3300013307 | Ga0157372_10078169 | Ga0157372_100781694 | 247 |
| 31 | 3300013307 | Ga0157372_10113733 | Ga0157372_101137332 | 247 |
| 32 | 3300013308 | Ga0157375_10004423 | Ga0157375_100044238 | 247 |
| 33 | 3300014969 | Ga0157376_10052410 | Ga0157376_100524105 | 247 |
| 34 | 3300021358 | Ga0213873_10001469 | Ga0213873_100014692 | 247 |
| 35 | 3300025913 | Ga0207695_10025900 | Ga0207695_100259006 | 247 |
| 36 | 3300025913 | Ga0207695_10160684 | Ga0207695_101606842 | 247 |
| 37 | 3300025914 | Ga0207671_10032960 | Ga0207671_100329606 | 247 |
| 38 | 3300025927 | Ga0207687_10011924 | Ga0207687_100119246 | 247 |
| 39 | 3300025941 | Ga0207711_10000655 | Ga0207711_1000065537 | 247 |
| 40 | 3300025941 | Ga0207711_10001410 | Ga0207711_1000141023 | 247 |
| 41 | 3300025944 | Ga0207661_10020669 | Ga0207661_100206693 | 247 |
| 42 | 3300025949 | Ga0207667_10057497 | Ga0207667_100574975 | 247 |
| 43 | 3300025961 | Ga0207712_10182602 | Ga0207712_101826022 | 247 |
| 44 | 3300026035 | Ga0207703_10020898 | Ga0207703_100208981 | 247 |
| 45 | 3300028558 | Ga0265326_10009331 | Ga0265326_100093314 | 247 |
| 46 | 3300028800 | Ga0265338_10329031 | Ga0265338_103290312 | 247 |
| 47 | 3300031247 | Ga0265340_10028650 | Ga0265340_100286502 | 247 |
| 48 | 3300031250 | Ga0265331_10219372 | Ga0265331_102193721 | 247 |
| 49 | 3300031344 | Ga0265316_10000905 | Ga0265316_1000090513 | 247 |
| 50 | 3300031344 | Ga0265316_10061306 | Ga0265316_100613062 | 247 |
| 51 | 3300039437 | Ga0436365_1099451 | Ga0436365_1099451_278_1021 | 247 |
| 52 | 3300039450 | Ga0436363_1449737 | Ga0436363_1449737_58_801 | 247 |
| 53 | 3300039453 | Ga0436362_0508894 | Ga0436362_0508894_788_1531 | 247 |
| 54 | 3300039453 | Ga0436362_1225666 | Ga0436362_1225666_2970_3713 | 247 |
| 55 | 3300048929 | Ga0496126_0015832 | Ga0496126_0015832_6407_7150 | 247 |
| 56 | 3300003320 | rootH2_10009584 | rootH2_1000958419 | 248 |
| 57 | 3300003323 | rootH1_10017554 | rootH1_100175542 | 248 |
| 58 | 3300005336 | Ga0070680_100035588 | Ga0070680_1000355883 | 248 |
| 59 | 3300005341 | Ga0070691_10088230 | Ga0070691_100882302 | 248 |
| 60 | 3300005434 | Ga0070709_10273902 | Ga0070709_102739022 | 248 |
| 61 | 3300005445 | Ga0070708_100600326 | Ga0070708_1006003261 | 248 |
| 62 | 3300005458 | Ga0070681_10043999 | Ga0070681_100439992 | 248 |
| 63 | 3300005468 | Ga0070707_100402041 | Ga0070707_1004020413 | 248 |
| 64 | 3300005471 | Ga0070698_100037707 | Ga0070698_1000377072 | 248 |
| 65 | 3300005518 | Ga0070699_100248941 | Ga0070699_1002489412 | 248 |
| 66 | 3300005530 | Ga0070679_100031274 | Ga0070679_1000312744 | 248 |
| 67 | 3300005535 | Ga0070684_100549192 | Ga0070684_1005491922 | 248 |
| 68 | 3300005536 | Ga0070697_100054308 | Ga0070697_1000543084 | 248 |
| 69 | 3300005545 | Ga0070695_100249648 | Ga0070695_1002496482 | 248 |
| 70 | 3300005545 | Ga0070695_100349981 | Ga0070695_1003499811 | 248 |
| 71 | 3300005563 | Ga0068855_100011128 | Ga0068855_1000111283 | 248 |
| 72 | 3300005614 | Ga0068856_100259748 | Ga0068856_1002597482 | 248 |
| 73 | 3300005614 | Ga0068856_100761626 | Ga0068856_1007616262 | 248 |
| 74 | 3300009093 | Ga0105240_10082729 | Ga0105240_100827292 | 248 |
| 75 | 3300009093 | Ga0105240_10146375 | Ga0105240_101463752 | 248 |
| 76 | 3300009093 | Ga0105240_10157115 | Ga0105240_101571152 | 248 |
| 77 | 3300009094 | Ga0111539_10268841 | Ga0111539_102688412 | 248 |
| 78 | 3300009174 | Ga0105241_10083540 | Ga0105241_100835402 | 248 |
| 79 | 3300009177 | Ga0105248_10031811 | Ga0105248_100318113 | 248 |
| 80 | 3300009545 | Ga0105237_10010586 | Ga0105237_100105864 | 248 |
| 81 | 3300009545 | Ga0105237_10423845 | Ga0105237_104238452 | 248 |
| 82 | 3300009551 | Ga0105238_10008964 | Ga0105238_100089647 | 248 |
| 83 | 3300009551 | Ga0105238_10186633 | Ga0105238_101866332 | 248 |
| 84 | 3300009551 | Ga0105238_10219613 | Ga0105238_102196132 | 248 |
| 85 | 3300010375 | Ga0105239_10188471 | Ga0105239_101884712 | 248 |
| 86 | 3300010375 | Ga0105239_10318608 | Ga0105239_103186082 | 248 |
| 87 | 3300013104 | Ga0157370_10003738 | Ga0157370_1000373813 | 248 |
| 88 | 3300013105 | Ga0157369_10046815 | Ga0157369_100468154 | 248 |
| 89 | 3300014325 | Ga0163163_10388166 | Ga0163163_103881662 | 248 |
| 90 | 3300014968 | Ga0157379_10146675 | Ga0157379_101466752 | 248 |
| 91 | 3300021441 | Ga0213871_10016432 | Ga0213871_100164322 | 248 |
| 92 | 3300024227 | Ga0228598_1014757 | Ga0228598_10147572 | 248 |
| 93 | 3300025208 | Ga0209436_102232 | Ga0209436_1022326 | 248 |
| 94 | 3300025284 | Ga0209130_1003671 | Ga0209130_10036712 | 248 |
| 95 | 3300025911 | Ga0207654_10026509 | Ga0207654_100265092 | 248 |
| 96 | 3300025912 | Ga0207707_10004127 | Ga0207707_100041277 | 248 |
| 97 | 3300025912 | Ga0207707_10020503 | Ga0207707_100205036 | 248 |
| 98 | 3300025913 | Ga0207695_10012991 | Ga0207695_100129915 | 248 |
| 99 | 3300025913 | Ga0207695_10305387 | Ga0207695_103053871 | 248 |
| 100 | 3300025914 | Ga0207671_10019612 | Ga0207671_100196125 | 248 |
| 101 | 3300025914 | Ga0207671_10490444 | Ga0207671_104904442 | 248 |
| 102 | 3300025921 | Ga0207652_10023105 | Ga0207652_100231056 | 248 |
| 103 | 3300025921 | Ga0207652_10144863 | Ga0207652_101448632 | 248 |
| 104 | 3300025924 | Ga0207694_10006084 | Ga0207694_100060842 | 248 |
| 105 | 3300025924 | Ga0207694_10204258 | Ga0207694_102042582 | 248 |
| 106 | 3300025941 | Ga0207711_10100471 | Ga0207711_101004713 | 248 |
| 107 | 3300025949 | Ga0207667_10010858 | Ga0207667_1001085814 | 248 |
| 108 | 3300026116 | Ga0207674_10386577 | Ga0207674_103865772 | 248 |
| 109 | 3300028556 | Ga0265337_1068380 | Ga0265337_10683801 | 248 |
| 110 | 3300028563 | Ga0265319_1036242 | Ga0265319_10362422 | 248 |
| 111 | 3300028573 | Ga0265334_10013001 | Ga0265334_100130012 | 248 |
| 112 | 3300028577 | Ga0265318_10002014 | Ga0265318_100020146 | 248 |
| 113 | 3300028653 | Ga0265323_10001081 | Ga0265323_1000108113 | 248 |
| 114 | 3300028800 | Ga0265338_10004571 | Ga0265338_1000457112 | 248 |
| 115 | 3300028800 | Ga0265338_10004882 | Ga0265338_100048824 | 248 |
| 116 | 3300028800 | Ga0265338_10016075 | Ga0265338_100160757 | 248 |
| 117 | 3300028800 | Ga0265338_10040442 | Ga0265338_100404422 | 248 |
| 118 | 3300028800 | Ga0265338_10052951 | Ga0265338_100529512 | 248 |
| 119 | 3300028800 | Ga0265338_10064823 | Ga0265338_100648232 | 248 |
| 120 | 3300028800 | Ga0265338_10067896 | Ga0265338_100678962 | 248 |
| 121 | 3300028800 | Ga0265338_10087796 | Ga0265338_100877963 | 248 |
| 122 | 3300028800 | Ga0265338_10198345 | Ga0265338_101983452 | 248 |
| 123 | 3300028800 | Ga0265338_10420286 | Ga0265338_104202862 | 248 |
| 124 | 3300029957 | Ga0265324_10000060 | Ga0265324_1000006021 | 248 |
| 125 | 3300031235 | Ga0265330_10000224 | Ga0265330_1000022427 | 248 |
| 126 | 3300031235 | Ga0265330_10001560 | Ga0265330_100015604 | 248 |
| 127 | 3300031235 | Ga0265330_10006933 | Ga0265330_100069333 | 248 |
| 128 | 3300031235 | Ga0265330_10080124 | Ga0265330_100801242 | 248 |
| 129 | 3300031235 | Ga0265330_10105224 | Ga0265330_101052242 | 248 |
| 130 | 3300031238 | Ga0265332_10000232 | Ga0265332_1000023227 | 248 |
| 131 | 3300031238 | Ga0265332_10004468 | Ga0265332_100044686 | 248 |
| 132 | 3300031239 | Ga0265328_10009388 | Ga0265328_100093882 | 248 |
| 133 | 3300031240 | Ga0265320_10003482 | Ga0265320_100034829 | 248 |
| 134 | 3300031240 | Ga0265320_10160147 | Ga0265320_101601472 | 248 |
| 135 | 3300031241 | Ga0265325_10029948 | Ga0265325_100299483 | 248 |
| 136 | 3300031241 | Ga0265325_10072533 | Ga0265325_100725332 | 248 |
| 137 | 3300031241 | Ga0265325_10083347 | Ga0265325_100833472 | 248 |
| 138 | 3300031242 | Ga0265329_10000018 | Ga0265329_1000001820 | 248 |
| 139 | 3300031242 | Ga0265329_10028588 | Ga0265329_100285882 | 248 |
| 140 | 3300031247 | Ga0265340_10002958 | Ga0265340_100029583 | 248 |
| 141 | 3300031247 | Ga0265340_10025345 | Ga0265340_100253452 | 248 |
| 142 | 3300031247 | Ga0265340_10046742 | Ga0265340_100467423 | 248 |
| 143 | 3300031247 | Ga0265340_10079871 | Ga0265340_100798712 | 248 |
| 144 | 3300031249 | Ga0265339_10000063 | Ga0265339_1000006371 | 248 |
| 145 | 3300031249 | Ga0265339_10001719 | Ga0265339_100017192 | 248 |
| 146 | 3300031249 | Ga0265339_10004229 | Ga0265339_100042293 | 248 |
| 147 | 3300031249 | Ga0265339_10005475 | Ga0265339_100054752 | 248 |
| 148 | 3300031249 | Ga0265339_10012255 | Ga0265339_100122553 | 248 |
| 149 | 3300031249 | Ga0265339_10017231 | Ga0265339_100172315 | 248 |
| 150 | 3300031249 | Ga0265339_10099593 | Ga0265339_100995932 | 248 |
| 151 | 3300031250 | Ga0265331_10039950 | Ga0265331_100399502 | 248 |
| 152 | 3300031250 | Ga0265331_10059878 | Ga0265331_100598782 | 248 |
| 153 | 3300031250 | Ga0265331_10067090 | Ga0265331_100670902 | 248 |
| 154 | 3300031250 | Ga0265331_10237417 | Ga0265331_102374171 | 248 |
| 155 | 3300031344 | Ga0265316_10000002 | Ga0265316_10000002124 | 248 |
| 156 | 3300031344 | Ga0265316_10000524 | Ga0265316_1000052427 | 248 |
| 157 | 3300031344 | Ga0265316_10002858 | Ga0265316_1000285811 | 248 |
| 158 | 3300031344 | Ga0265316_10010205 | Ga0265316_100102053 | 248 |
| 159 | 3300031344 | Ga0265316_10056393 | Ga0265316_100563933 | 248 |
| 160 | 3300031344 | Ga0265316_10057627 | Ga0265316_100576272 | 248 |
| 161 | 3300031344 | Ga0265316_10118505 | Ga0265316_101185052 | 248 |
| 162 | 3300031344 | Ga0265316_10133543 | Ga0265316_101335432 | 248 |
| 163 | 3300031344 | Ga0265316_10158289 | Ga0265316_101582892 | 248 |
| 164 | 3300031344 | Ga0265316_10186806 | Ga0265316_101868062 | 248 |
| 165 | 3300031595 | Ga0265313_10002065 | Ga0265313_100020654 | 248 |
| 166 | 3300031595 | Ga0265313_10005533 | Ga0265313_100055333 | 248 |
| 167 | 3300031595 | Ga0265313_10034641 | Ga0265313_100346412 | 248 |
| 168 | 3300031595 | Ga0265313_10058959 | Ga0265313_100589592 | 248 |
| 169 | 3300031711 | Ga0265314_10000028 | Ga0265314_10000028195 | 248 |
| 170 | 3300031711 | Ga0265314_10000607 | Ga0265314_1000060728 | 248 |
| 171 | 3300031711 | Ga0265314_10001215 | Ga0265314_100012152 | 248 |
| 172 | 3300031711 | Ga0265314_10009096 | Ga0265314_100090962 | 248 |
| 173 | 3300031711 | Ga0265314_10056794 | Ga0265314_100567943 | 248 |
| 174 | 3300031711 | Ga0265314_10071023 | Ga0265314_100710232 | 248 |
| 175 | 3300031711 | Ga0265314_10180848 | Ga0265314_101808482 | 248 |
| 176 | 3300031712 | Ga0265342_10000002 | Ga0265342_10000002261 | 248 |
| 177 | 3300031712 | Ga0265342_10000528 | Ga0265342_100005288 | 248 |
| 178 | 3300031712 | Ga0265342_10002414 | Ga0265342_1000241415 | 248 |
| 179 | 3300031712 | Ga0265342_10003133 | Ga0265342_100031332 | 248 |
| 180 | 3300031712 | Ga0265342_10007872 | Ga0265342_100078722 | 248 |
| 181 | 3300031712 | Ga0265342_10011116 | Ga0265342_100111162 | 248 |
| 182 | 3300031712 | Ga0265342_10081900 | Ga0265342_100819002 | 248 |
| 183 | 3300031730 | Ga0307516_10002331 | Ga0307516_1000233111 | 248 |
| 184 | 3300031901 | Ga0307406_10505969 | Ga0307406_105059692 | 248 |
| 185 | 3300035692 | Ga0373935_0026837 | Ga0373935_0026837_2165_3037 | 248 |
| 186 | 3300036401 | Ga0373937_0048028 | Ga0373937_0048028_1763_2566 | 248 |
| 187 | 3300037466 | Ga0395898_0005032 | Ga0395898_0005032_4292_5041 | 248 |
| 188 | 3300037853 | Ga0436364_0603050 | Ga0436364_0603050_290_1042 | 248 |
| 189 | 3300039438 | Ga0436360_0418356 | Ga0436360_0418356_2145_2891 | 248 |
| 190 | 3300046455 | Ga0495603_0049806 | Ga0495603_0049806_1170_1961 | 248 |
| 191 | 3300046475 | Ga0495639_0017117 | Ga0495639_0017117_54_857 | 248 |
| 192 | 3300046476 | Ga0495662_0022481 | Ga0495662_0022481_930_1727 | 248 |
| 193 | 3300046531 | Ga0495665_0026354 | Ga0495665_0026354_242_1045 | 248 |
| 194 | 3300046689 | Ga0495613_0090300 | Ga0495613_0090300_300_1070 | 248 |
| 195 | 3300047315 | Ga0495581_0014315 | Ga0495581_0014315_2889_3692 | 248 |
| 196 | 3300047317 | Ga0495604_0213234 | Ga0495604_0213234_42_812 | 248 |
| 197 | 3300047321 | Ga0495676_0062263 | Ga0495676_0062263_1143_1946 | 248 |
| 198 | 3300048912 | Ga0496109_0661247 | Ga0496109_0661247_116_874 | 248 |
| 199 | 3300048929 | Ga0496126_0104197 | Ga0496126_0104197_133_885 | 248 |
| 200 | 3300050511 | nmdc:mga08y16_214040_c1 | nmdc:mga08y16_214040_c1_1162_1941 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.903 | 1 | 245 |
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.9017 | 1 | 245 |
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8895 | 1 | 245 |
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8881 | 1 | 245 |
| 6i5x-assembly1.cif.gz_A | crystal structure of aspergillus fumigatus phosphomannomutase | 0.8239 | 3 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9615 | 1 | 245 | 3.40.50.1000 |
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9375 | 1 | 245 | 3.40.50.1000 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.9305 | 90 | 181 | 3.30.1240.20 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.8848 | 90 | 181 | 3.30.1240.20 |
| af_B5DF46_1_74_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8551 | 1 | 78 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A208Y5C1-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9878 | 1 | 248 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0016791 GO:0046872 |
| AF-A0A7C7LUT6-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9863 | 2 | 245 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0016791 GO:0046872 |
| AF-A0A194V1M1-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9853 | 1 | 248 |
GO:0004615
GO:0005737 GO:0009298 GO:0046872 |
| AF-A0A1C4H2V0-F1-model_v4 | Phosphomannomutase | 0.9849 | 2 | 246 |
GO:0005737
GO:0016791 |
| AF-A0A1W2DUB9-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9839 | 1 | 245 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0016791 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar