F307461

General Info

Members Datasets Scaffolds Average Seq Length
200 120 400 300

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000001|Ga0395899_0000001_776892_777857
Length 321
Sequence MKHKQSSIKTLKNLKNHYINIMRIFALITLFSGLLVSSYAQTTIPLYPNGVPNSKPTPTAYTEKRNEWGGITDVSIPTLTSYILNDGTTHTAVLVIPGGGYSAVVRGHEGDSIAHAFNKIGVSAFVLKYRLPSDSIMVDKTIGPLQDAQSALVMIRKNAKQWNIDPAKVGVIGFSAGGHLASTLGTHFDKPAIKDYGNVSLRPDFMALIYPVITFGPFAHVGSRENLIGKNPSQELIDLYSNEKQVTPETPPTFLVHAEDDRTVPVQNTLMFYNALVQNKVQGEMHIYPHGDHGFGLNNWTTKDYWFDRLKEWMEANGWVK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
107 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
110 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
113 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
114 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
115 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
116 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
117 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
118 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
119 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
120 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0.5
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.5
Nodule 0
Rhizoplane 0.5
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000001 3300037312 Bacteria 1750322
2 JGI24740J21852_10023029 3300001979 Bacteria 2134
3 JGI24737J22298_10000333 3300001990 Bacteria 15751
4 JGI24737J22298_10008297 3300001990 Bacteria 3484
5 JGI24735J21928_10000003 3300002067 Bacteria 385983
6 JGI25162J39368_1000005 3300002737 Bacteria 435925
7 JGI25162J39368_1002471 3300002737 Bacteria 7139
8 JGI25164J39214_1003742 3300002772 Bacteria 1854
9 JGI25165J46597_1000399 3300003214 Bacteria 45926
10 rootH1_10005973 3300003316 Bacteria 11300
11 rootH2_10035311 3300003320 Bacteria 15199
12 rootH2_10160844 3300003320 Bacteria 4205
13 rootL2_10110501 3300003322 Bacteria 5074
14 rootH1_10029236 3300003323 Bacteria 5684
15 rootH1_10175076 3300003323 Bacteria 3309
16 rootH1_10209165 3300003323 Bacteria 2191
17 rootH1_10328926 3300003323 Bacteria 2799
18 Ga0070658_10000060 3300005327 Bacteria 112561
19 Ga0070658_10109345 3300005327 Bacteria 2289
20 Ga0070676_10015935 3300005328 Bacteria 4148
21 Ga0070683_100016372 3300005329 Bacteria 6539
22 Ga0068868_100261417 3300005338 Bacteria 1460
23 Ga0070660_100013606 3300005339 Bacteria 5845
24 Ga0070660_100036313 3300005339 Bacteria 3732
25 Ga0070660_100126421 3300005339 Bacteria 2043
26 Ga0070674_100224386 3300005356 Bacteria 1463
27 Ga0070673_100011689 3300005364 Bacteria 6000
28 Ga0070659_100019550 3300005366 Bacteria 5135
29 Ga0070659_100134382 3300005366 Bacteria 2011
30 Ga0070678_100290229 3300005456 Bacteria 1386
31 Ga0070662_100000145 3300005457 Bacteria 40435
32 Ga0070662_100000436 3300005457 Bacteria 24652
33 Ga0068867_100000996 3300005459 Bacteria 19320
34 Ga0070684_100039272 3300005535 Bacteria 4070
35 Ga0068853_100003458 3300005539 Bacteria 12076
36 Ga0068853_100431174 3300005539 Bacteria 1238
37 Ga0068855_100010994 3300005563 Bacteria 10922
38 Ga0068855_100030833 3300005563 Bacteria 6410
39 Ga0068855_100110844 3300005563 Bacteria 3150
40 Ga0068855_100158013 3300005563 Bacteria 2575
41 Ga0068855_100258891 3300005563 Bacteria 1939
42 Ga0068856_100007449 3300005614 Bacteria 10681
43 Ga0068856_100011413 3300005614 Bacteria 8618
44 Ga0068852_100000735 3300005616 Bacteria 21499
45 Ga0068866_10022046 3300005718 Bacteria 2943
46 Ga0068858_100063998 3300005842 Bacteria 3403
47 Ga0068858_100388101 3300005842 Bacteria 1340
48 Ga0075366_10015420 3300006195 Bacteria 4380
49 Ga0075366_10123104 3300006195 Bacteria 1563
50 Ga0097621_100000684 3300006237 Bacteria 23771
51 Ga0068871_100000037 3300006358 Bacteria 70231
52 Ga0068865_100000067 3300006881 Bacteria 54449
53 Ga0105240_10000068 3300009093 Bacteria 207756
54 Ga0105240_10029281 3300009093 Bacteria 7178
55 Ga0105240_10068164 3300009093 Bacteria 4407
56 Ga0105240_10439170 3300009093 Bacteria 1463
57 Ga0105245_10056922 3300009098 Bacteria 3515
58 Ga0105241_10000251 3300009174 Bacteria 40576
59 Ga0105241_10006137 3300009174 Bacteria 8859
60 Ga0105241_10012314 3300009174 Bacteria 6274
61 Ga0105241_10039789 3300009174 Bacteria 3547
62 Ga0105241_10077932 3300009174 Bacteria 2588
63 Ga0105241_10081024 3300009174 Bacteria 2542
64 Ga0105237_10001623 3300009545 Bacteria 29201
65 Ga0105237_10002578 3300009545 Bacteria 22344
66 Ga0105237_10073462 3300009545 Unclassified 3412
67 Ga0105237_10074145 3300009545 Unclassified 3395
68 Ga0105237_10561895 3300009545 Bacteria 1148
69 Ga0105238_10015735 3300009551 Bacteria 7659
70 Ga0105238_10032516 3300009551 Bacteria 5308
71 Ga0105239_10000032 3300010375 Bacteria 225528
72 Ga0105239_10001824 3300010375 Bacteria 27887
73 Ga0105239_10160676 3300010375 Bacteria 2510
74 Ga0105239_10312540 3300010375 Bacteria 1771
75 Ga0105246_10016999 3300011119 Bacteria 4619
76 Ga0157373_10000013 3300013100 Bacteria 186870
77 Ga0157373_10004429 3300013100 Bacteria 10576
78 Ga0157373_10062504 3300013100 Bacteria 2637
79 Ga0157371_10005280 3300013102 Bacteria 10945
80 Ga0157371_10006033 3300013102 Bacteria 10086
81 Ga0157371_10030370 3300013102 Bacteria 3899
82 Ga0157370_10081574 3300013104 Bacteria 3043
83 Ga0157369_10001043 3300013105 Bacteria 35027
84 Ga0157369_10085993 3300013105 Bacteria 3359
85 Ga0157369_10432424 3300013105 Bacteria 1364
86 Ga0157374_10000207 3300013296 Bacteria 54174
87 Ga0157374_10000418 3300013296 Bacteria 38471
88 Ga0157378_10091928 3300013297 Bacteria 2760
89 Ga0163162_10000008 3300013306 Bacteria 316194
90 Ga0163162_10011508 3300013306 Bacteria 8628
91 Ga0163162_10133464 3300013306 Bacteria 2593
92 Ga0157372_10000001 3300013307 Bacteria 791349
93 Ga0157372_10001765 3300013307 Bacteria 23452
94 Ga0157372_10106494 3300013307 Bacteria 3207
95 Ga0157372_10163569 3300013307 Bacteria 2572
96 Ga0157375_10014375 3300013308 Bacteria 7059
97 Ga0157375_10250492 3300013308 Unclassified 1932
98 Ga0157377_10035429 3300014745 Bacteria 2738
99 Ga0206351_10757906 3300020077 Bacteria 2077
100 Ga0213872_10010438 3300021361 Bacteria 4421
101 Ga0213872_10014637 3300021361 Bacteria 3657
102 Ga0209563_103312 3300025230 Bacteria 3367
103 Ga0207427_100072 3300025231 Bacteria 158364
104 Ga0209437_100026 3300025233 Bacteria 542698
105 Ga0209437_100043 3300025233 Bacteria 440454
106 Ga0209026_1002522 3300025250 Bacteria 6784
107 Ga0209129_1010738 3300025258 Bacteria 2253
108 Ga0209233_1000111 3300025261 Bacteria 260262
109 Ga0209233_1004642 3300025261 Bacteria 4644
110 Ga0207642_10093568 3300025899 Bacteria 1491
111 Ga0207647_10000079 3300025904 Bacteria 72325
112 Ga0207647_10000302 3300025904 Bacteria 40592
113 Ga0207647_10011709 3300025904 Bacteria 6139
114 Ga0207647_10125701 3300025904 Bacteria 1509
115 Ga0207645_10000067 3300025907 Bacteria 75648
116 Ga0207705_10000233 3300025909 Bacteria 55125
117 Ga0207654_10047145 3300025911 Bacteria 2461
118 Ga0207695_10000131 3300025913 Bacteria 223762
119 Ga0207695_10001921 3300025913 Bacteria 32318
120 Ga0207695_10003303 3300025913 Bacteria 22890
121 Ga0207695_10040100 3300025913 Bacteria 5026
122 Ga0207695_10078192 3300025913 Bacteria 3357
123 Ga0207695_10218091 3300025913 Bacteria 1816
124 Ga0207671_10000787 3300025914 Bacteria 40182
125 Ga0207671_10002013 3300025914 Bacteria 22350
126 Ga0207671_10011597 3300025914 Bacteria 7156
127 Ga0207671_10411093 3300025914 Bacteria 1076
128 Ga0207657_10106977 3300025919 Bacteria 2314
129 Ga0207657_10121762 3300025919 Bacteria 2146
130 Ga0207652_10057998 3300025921 Bacteria 3336
131 Ga0207690_10104250 3300025932 Bacteria 2031
132 Ga0207706_10000013 3300025933 Bacteria 188236
133 Ga0207706_10000538 3300025933 Bacteria 40240
134 Ga0207669_10224103 3300025937 Bacteria 1382
135 Ga0207704_10000056 3300025938 Bacteria 78848
136 Ga0207661_10020521 3300025944 Bacteria 4940
137 Ga0207667_10024828 3300025949 Bacteria 6572
138 Ga0207651_10010168 3300025960 Bacteria 5199
139 Ga0207703_10108922 3300026035 Bacteria 2360
140 Ga0207639_10129308 3300026041 Unclassified 2088
141 Ga0207639_10260060 3300026041 Bacteria 1518
142 Ga0207702_10047973 3300026078 Bacteria 3600
143 Ga0207648_10000738 3300026089 Bacteria 36673
144 Ga0207674_10257199 3300026116 Bacteria 1693
145 Ga0207698_10003486 3300026142 Bacteria 9485
146 Ga0265323_10020660 3300028653 Bacteria 2533
147 Ga0395899_0000027 3300037312 Bacteria 337387
148 Ga0395899_0000150 3300037312 Bacteria 105946
149 Ga0395899_0000474 3300037312 Bacteria 45411
150 Ga0395899_0065216 3300037312 Bacteria 2676
151 Ga0395900_0000413 3300037418 Bacteria 61555
152 Ga0395900_0011945 3300037418 Bacteria 8881
153 Ga0395898_0007319 3300037466 Bacteria 11721
154 Ga0395898_0189509 3300037466 Bacteria 1965
155 Ga0395905_0000188 3300037471 Bacteria 98070
156 Ga0395905_0000729 3300037471 Bacteria 43376
157 Ga0395901_0000611 3300038443 Bacteria 41511
158 Ga0395901_0002249 3300038443 Bacteria 19697
159 Ga0436361_0746278 3300039447 Bacteria 8494
160 Ga0436361_1166428 3300039447 Bacteria 7045
161 Ga0439448_0003040 3300042005 Bacteria 4610
162 Ga0466969_0109610 3300044656 Bacteria 1294
163 Ga0466966_0091505 3300044684 Bacteria 1888
164 Ga0453684_0001568 3300044712 Bacteria 63367
165 Ga0453684_0022122 3300044712 Bacteria 9454
166 Ga0453684_0182133 3300044712 Bacteria 2465
167 Ga0466959_0210511 3300045049 Bacteria 1351
168 Ga0451576_0018886 3300045051 Bacteria 7536
169 Ga0495650_0000107 3300046471 Bacteria 200864
170 Ga0495585_0000753 3300046492 Bacteria 28699
171 Ga0495583_0010597 3300046506 Bacteria 5362
172 Ga0495606_0000303 3300046507 Bacteria 84874
173 Ga0495616_0004163 3300046513 Bacteria 9168
174 Ga0495652_0106837 3300046529 Bacteria 2259
175 Ga0495633_0006747 3300046558 Bacteria 6750
176 Ga0495625_0000021 3300046660 Bacteria 282133
177 Ga0495625_0019736 3300046660 Bacteria 5219
178 Ga0495661_0005828 3300046665 Bacteria 8709
179 Ga0495661_0104798 3300046665 Bacteria 1585
180 Ga0495649_0000009 3300046694 Bacteria 451725
181 Ga0495687_001026 3300047443 Bacteria 27810
182 Ga0495687_001909 3300047443 Bacteria 17895
183 Ga0495687_002406 3300047443 Bacteria 15082
184 Ga0495677_0050490 3300047445 Bacteria 1531
185 Ga0495686_0040834 3300047472 Bacteria 2956
186 Ga0501219_000580 3300049703 Bacteria 5356
187 Ga0501284_00012 3300050005 Bacteria 124103
188 nmdc:mga0k408_147839_c1 3300050493 Bacteria 1399
189 Ga0500635_0008967 3300053080 Bacteria 2760
190 Ga0500618_021901 3300053125 Bacteria 1557
191 Ga0500622_0003583 3300053156 Bacteria 10247
192 2599479688 2599185184 Bacteria 6430550
193 2852625574 2852623160 Bacteria 4376875
194 2884934577 2884933994 Bacteria 4535041
195 2919190557 2919186247 Bacteria 6244071
196 2928083757 2928078545 Bacteria 6534839
197 2928152198 2928147474 Bacteria 6512076
198 2932084759 2932082852 Bacteria 6563563
199 2945978064 2945977869 Bacteria 7777518
200 2977235620 2977232053 Bacteria 5485925
201 Ga0395899_0000001
202 JGI24740J21852_10023029
203 JGI24737J22298_10000333
204 JGI24737J22298_10008297
205 JGI24735J21928_10000003
206 JGI25162J39368_1000005
207 JGI25162J39368_1002471
208 JGI25164J39214_1003742
209 JGI25165J46597_1000399
210 rootH1_10005973
211 rootH2_10035311
212 rootH2_10160844
213 rootL2_10110501
214 rootH1_10029236
215 rootH1_10175076
216 rootH1_10209165
217 rootH1_10328926
218 Ga0070658_10000060
219 Ga0070658_10109345
220 Ga0070676_10015935
221 Ga0070683_100016372
222 Ga0068868_100261417
223 Ga0070660_100013606
224 Ga0070660_100036313
225 Ga0070660_100126421
226 Ga0070674_100224386
227 Ga0070673_100011689
228 Ga0070659_100019550
229 Ga0070659_100134382
230 Ga0070678_100290229
231 Ga0070662_100000145
232 Ga0070662_100000436
233 Ga0068867_100000996
234 Ga0070684_100039272
235 Ga0068853_100003458
236 Ga0068853_100431174
237 Ga0068855_100010994
238 Ga0068855_100030833
239 Ga0068855_100110844
240 Ga0068855_100158013
241 Ga0068855_100258891
242 Ga0068856_100007449
243 Ga0068856_100011413
244 Ga0068852_100000735
245 Ga0068866_10022046
246 Ga0068858_100063998
247 Ga0068858_100388101
248 Ga0075366_10015420
249 Ga0075366_10123104
250 Ga0097621_100000684
251 Ga0068871_100000037
252 Ga0068865_100000067
253 Ga0105240_10000068
254 Ga0105240_10029281
255 Ga0105240_10068164
256 Ga0105240_10439170
257 Ga0105245_10056922
258 Ga0105241_10000251
259 Ga0105241_10006137
260 Ga0105241_10012314
261 Ga0105241_10039789
262 Ga0105241_10077932
263 Ga0105241_10081024
264 Ga0105237_10001623
265 Ga0105237_10002578
266 Ga0105237_10073462
267 Ga0105237_10074145
268 Ga0105237_10561895
269 Ga0105238_10015735
270 Ga0105238_10032516
271 Ga0105239_10000032
272 Ga0105239_10001824
273 Ga0105239_10160676
274 Ga0105239_10312540
275 Ga0105246_10016999
276 Ga0157373_10000013
277 Ga0157373_10004429
278 Ga0157373_10062504
279 Ga0157371_10005280
280 Ga0157371_10006033
281 Ga0157371_10030370
282 Ga0157370_10081574
283 Ga0157369_10001043
284 Ga0157369_10085993
285 Ga0157369_10432424
286 Ga0157374_10000207
287 Ga0157374_10000418
288 Ga0157378_10091928
289 Ga0163162_10000008
290 Ga0163162_10011508
291 Ga0163162_10133464
292 Ga0157372_10000001
293 Ga0157372_10001765
294 Ga0157372_10106494
295 Ga0157372_10163569
296 Ga0157375_10014375
297 Ga0157375_10250492
298 Ga0157377_10035429
299 Ga0206351_10757906
300 Ga0213872_10010438
301 Ga0213872_10014637
302 Ga0209563_103312
303 Ga0207427_100072
304 Ga0209437_100026
305 Ga0209437_100043
306 Ga0209026_1002522
307 Ga0209129_1010738
308 Ga0209233_1000111
309 Ga0209233_1004642
310 Ga0207642_10093568
311 Ga0207647_10000079
312 Ga0207647_10000302
313 Ga0207647_10011709
314 Ga0207647_10125701
315 Ga0207645_10000067
316 Ga0207705_10000233
317 Ga0207654_10047145
318 Ga0207695_10000131
319 Ga0207695_10001921
320 Ga0207695_10003303
321 Ga0207695_10040100
322 Ga0207695_10078192
323 Ga0207695_10218091
324 Ga0207671_10000787
325 Ga0207671_10002013
326 Ga0207671_10011597
327 Ga0207671_10411093
328 Ga0207657_10106977
329 Ga0207657_10121762
330 Ga0207652_10057998
331 Ga0207690_10104250
332 Ga0207706_10000013
333 Ga0207706_10000538
334 Ga0207669_10224103
335 Ga0207704_10000056
336 Ga0207661_10020521
337 Ga0207667_10024828
338 Ga0207651_10010168
339 Ga0207703_10108922
340 Ga0207639_10129308
341 Ga0207639_10260060
342 Ga0207702_10047973
343 Ga0207648_10000738
344 Ga0207674_10257199
345 Ga0207698_10003486
346 Ga0265323_10020660
347 Ga0395899_0000027
348 Ga0395899_0000150
349 Ga0395899_0000474
350 Ga0395899_0065216
351 Ga0395900_0000413
352 Ga0395900_0011945
353 Ga0395898_0007319
354 Ga0395898_0189509
355 Ga0395905_0000188
356 Ga0395905_0000729
357 Ga0395901_0000611
358 Ga0395901_0002249
359 Ga0436361_0746278
360 Ga0436361_1166428
361 Ga0439448_0003040
362 Ga0466969_0109610
363 Ga0466966_0091505
364 Ga0453684_0001568
365 Ga0453684_0022122
366 Ga0453684_0182133
367 Ga0466959_0210511
368 Ga0451576_0018886
369 Ga0495650_0000107
370 Ga0495585_0000753
371 Ga0495583_0010597
372 Ga0495606_0000303
373 Ga0495616_0004163
374 Ga0495652_0106837
375 Ga0495633_0006747
376 Ga0495625_0000021
377 Ga0495625_0019736
378 Ga0495661_0005828
379 Ga0495661_0104798
380 Ga0495649_0000009
381 Ga0495687_001026
382 Ga0495687_001909
383 Ga0495687_002406
384 Ga0495677_0050490
385 Ga0495686_0040834
386 Ga0501219_000580
387 Ga0501284_00012
388 nmdc:mga0k408_147839_c1
389 Ga0500635_0008967
390 Ga0500618_021901
391 Ga0500622_0003583
392 2599479688
393 2852625574
394 2884934577
395 2919190557
396 2928083757
397 2928152198
398 2932084759
399 2945978064
400 2977235620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

135

305

0.84

PF20434

BD-FAE

BD-FAE

82

276

0.83

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

93

297

0.78

PF00326

Peptidase_S9

Prolyl oligopeptidase family

145

318

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.9183 58 297
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.9076 22 302
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.8818 22 302
6nkf-assembly2.cif.gz_B crystal structure of the lipase lip_vut4 from goat rumen metagenome. 0.817 55 297
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8082 58 299
ID Description Score Start End Superfamily
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8473 57 285 3.40.50.1820
af_Q966P1_347_555_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7952 71 192 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7916 42 302 3.40.50.1820
2z3wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7884 55 275 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7827 42 302 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V1SQW2-F1-model_v4 Alpha/beta hydrolase 0.9907 160 302 GO:0006508
GO:0008236
AF-A0A7X8FGZ4-F1-model_v4 Alpha/beta hydrolase 0.978 54 300 GO:0016787
AF-A0A7Y2DH42-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9753 143 300 GO:0006508
GO:0008236
AF-A0A7V1SQW2-F1-model_v4 Alpha/beta hydrolase 0.9705 160 302 GO:0006508
GO:0008236
AF-A0A1H7THI8-F1-model_v4 Acetyl esterase/lipase 0.9689 14 299 GO:0016787

Map