F308117

General Info

Members Datasets Scaffolds Average Seq Length
201 125 402 177

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100004938|Ga0070660_1000049389
Length 185
Sequence MVYNIDMSKKDRSSEGLDFDGQRDGEQLLFVFRRHMISMRKGFYLLVIPFALLAIPPLIWQTNLELFLLPILGLTIGLLLFSYHFIMWYFTVYIVTDQRLRQITQQGFFGKNVVELRLSKIQNISYNVPGLSGEIFGYGTIVIQTLVGDLVIHKVEHPDEIYNKLQDAVSAAIAGGQGDYEETTV

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
38 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
62 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
63 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
64 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
65 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
109 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
115 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
116 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
117 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
118 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
119 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
120 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
121 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
122 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
125 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.86
Nodule 0
Rhizoplane 1.49
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 2.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100004938 3300005339 Bacteria 9226
2 MBSR1b_contig_2080750 2162886012 Bacteria 2200
3 JGI24740J21852_10004660 3300001979 Bacteria 5880
4 JGI24739J22299_10025620 3300001989 Bacteria 2074
5 rootH1_10033762 3300003316 Bacteria 18168
6 rootH2_10004334 3300003320 Bacteria 85448
7 rootH1_10001727 3300003323 Bacteria 102468
8 Ga0065715_10004890 3300005293 Bacteria 4300
9 Ga0070685_10295310 3300005466 Bacteria 1090
10 Ga0070684_100574352 3300005535 Unclassified 1047
11 Ga0068855_100000002 3300005563 Bacteria 616881
12 Ga0068855_100000017 3300005563 Bacteria 212278
13 Ga0068857_100000322 3300005577 Bacteria 32987
14 Ga0068857_100019267 3300005577 Bacteria 5991
15 Ga0068857_100020141 3300005577 Bacteria 5864
16 Ga0068856_100002784 3300005614 Bacteria 17907
17 Ga0068856_100915476 3300005614 Bacteria 896
18 Ga0068852_100000001 3300005616 Bacteria 716526
19 Ga0068852_100011881 3300005616 Bacteria 6584
20 Ga0068861_101015935 3300005719 Bacteria 792
21 Ga0081455_10000006 3300005937 Bacteria 323066
22 Ga0075365_10000054 3300006038 Bacteria 35938
23 Ga0075365_10000080 3300006038 Bacteria 27892
24 Ga0075365_10001244 3300006038 Bacteria 11288
25 Ga0075365_10007614 3300006038 Bacteria 6082
26 Ga0075365_10131265 3300006038 Bacteria 1734
27 Ga0075365_10218078 3300006038 Bacteria 1338
28 Ga0075368_10001695 3300006042 Bacteria 7079
29 Ga0075363_100000147 3300006048 Bacteria 17418
30 Ga0075364_10000937 3300006051 Bacteria 15385
31 Ga0075364_10068713 3300006051 Bacteria 2330
32 Ga0075362_10072119 3300006177 Bacteria 1579
33 Ga0075367_10000339 3300006178 Bacteria 16665
34 Ga0075369_10003342 3300006186 Bacteria 5830
35 Ga0075366_10001219 3300006195 Bacteria 12757
36 Ga0075366_10155730 3300006195 Bacteria 1384
37 Ga0097621_100000001 3300006237 Bacteria 632268
38 Ga0097621_101428462 3300006237 Unclassified 655
39 Ga0075370_10019270 3300006353 Bacteria 3715
40 Ga0075370_10057606 3300006353 Bacteria 2209
41 Ga0075370_10118786 3300006353 Bacteria 1538
42 Ga0068871_100000001 3300006358 Bacteria 215987
43 Ga0068871_100170688 3300006358 Bacteria 1864
44 Ga0075428_100007820 3300006844 Bacteria 11853
45 Ga0068865_100000106 3300006881 Bacteria 43112
46 Ga0105240_10000030 3300009093 Bacteria 321312
47 Ga0105240_10000886 3300009093 Bacteria 53766
48 Ga0105240_10000909 3300009093 Bacteria 52908
49 Ga0105240_10010910 3300009093 Bacteria 12732
50 Ga0105240_10189355 3300009093 Bacteria 2420
51 Ga0105245_10375314 3300009098 Bacteria 1415
52 Ga0105241_10001961 3300009174 Bacteria 15578
53 Ga0105241_10065457 3300009174 Bacteria 2808
54 Ga0105241_10236411 3300009174 Bacteria 1542
55 Ga0105241_11180703 3300009174 Bacteria 724
56 Ga0105248_10069436 3300009177 Bacteria 3956
57 Ga0105237_10000001 3300009545 Bacteria 1009213
58 Ga0105237_10000159 3300009545 Bacteria 95980
59 Ga0105237_10032119 3300009545 Bacteria 5316
60 Ga0105238_10000480 3300009551 Bacteria 41924
61 Ga0105249_10165421 3300009553 Bacteria 2141
62 Ga0105032_100009 3300009979 Bacteria 86569
63 Ga0105032_100012 3300009979 Bacteria 73994
64 Ga0105029_100012 3300009984 Bacteria 9525
65 Ga0105028_100264 3300009993 Bacteria 5723
66 Ga0105239_10000481 3300010375 Bacteria 58265
67 Ga0105239_10151137 3300010375 Bacteria 2591
68 Ga0105239_10314605 3300010375 Bacteria 1765
69 Ga0105246_10310464 3300011119 Bacteria 1277
70 Ga0157371_10077597 3300013102 Bacteria 2352
71 Ga0157371_10201922 3300013102 Bacteria 1425
72 Ga0157370_10000232 3300013104 Bacteria 71177
73 Ga0157370_10342615 3300013104 Bacteria 1378
74 Ga0157369_10000003 3300013105 Bacteria 507337
75 Ga0157369_10014799 3300013105 Bacteria 8803
76 Ga0157369_10196836 3300013105 Bacteria 2116
77 Ga0157374_10635392 3300013296 Bacteria 1079
78 Ga0157372_10000007 3300013307 Bacteria 340690
79 Ga0157372_10000096 3300013307 Bacteria 91282
80 Ga0157372_10122414 3300013307 Bacteria 2989
81 Ga0157372_10183343 3300013307 Bacteria 2424
82 Ga0207654_10048162 3300025911 Bacteria 2438
83 Ga0207654_10072942 3300025911 Bacteria 2044
84 Ga0207654_10876735 3300025911 Bacteria 650
85 Ga0207695_10000009 3300025913 Bacteria 1034276
86 Ga0207695_10004142 3300025913 Bacteria 19917
87 Ga0207695_10026439 3300025913 Bacteria 6476
88 Ga0207695_10440163 3300025913 Bacteria 1187
89 Ga0207671_10000003 3300025914 Bacteria 1065461
90 Ga0207671_10000008 3300025914 Bacteria 798229
91 Ga0207671_10283661 3300025914 Bacteria 1306
92 Ga0207657_10000547 3300025919 Bacteria 40133
93 Ga0207694_10000785 3300025924 Bacteria 28533
94 Ga0207704_10000067 3300025938 Bacteria 66570
95 Ga0207711_10063582 3300025941 Bacteria 3186
96 Ga0207679_10000214 3300025945 Bacteria 45882
97 Ga0207679_10116586 3300025945 Bacteria 2118
98 Ga0207667_10000005 3300025949 Bacteria 715503
99 Ga0207667_10000048 3300025949 Bacteria 238293
100 Ga0207667_10102506 3300025949 Bacteria 2952
101 Ga0207712_10246690 3300025961 Bacteria 1441
102 Ga0207702_10000871 3300026078 Bacteria 31407
103 Ga0207702_10850722 3300026078 Bacteria 903
104 Ga0207674_10000563 3300026116 Bacteria 48522
105 Ga0207674_10027414 3300026116 Bacteria 6026
106 Ga0207674_10067241 3300026116 Bacteria 3608
107 Ga0207698_10000169 3300026142 Bacteria 40939
108 Ga0207698_10064146 3300026142 Bacteria 2878
109 Ga0209813_10000225 3300027866 Bacteria 17310
110 Ga0316176_1004111 3300030732 Bacteria 738
111 Ga0314311_1014870 3300030733 Bacteria 3006
112 Ga0316179_1028359 3300030734 Bacteria 22140
113 Ga0316180_1116439 3300030736 Bacteria 3377
114 Ga0316183_1053060 3300030742 Bacteria 10073
115 Ga0316183_1071463 3300030742 Bacteria 1178
116 Ga0316183_1108554 3300030742 Bacteria 6989
117 Ga0316183_1154194 3300030742 Bacteria 16265
118 Ga0316181_1123581 3300030744 Bacteria 76132
119 Ga0316182_1040041 3300030745 Bacteria 1898
120 Ga0316182_1106597 3300030745 Bacteria 12910
121 Ga0316182_1303601 3300030745 Bacteria 10332
122 Ga0316182_1307373 3300030745 Bacteria 2195
123 Ga0307516_10000003 3300031730 Bacteria 459377
124 Ga0307516_10020111 3300031730 Bacteria 6902
125 Ga0307405_10007005 3300031731 Bacteria 5602
126 Ga0307406_10000001 3300031901 Bacteria 638191
127 Ga0307412_10016291 3300031911 Bacteria 4426
128 Ga0373959_0000003 3300034820 Bacteria 105085
129 Ga0395899_0030206 3300037312 Bacteria 4076
130 Ga0395899_0104467 3300037312 Bacteria 2041
131 Ga0395900_0000001 3300037418 Bacteria 931146
132 Ga0395898_0000002 3300037466 Bacteria 931013
133 Ga0395901_0000006 3300038443 Bacteria 514112
134 Ga0439461_0000351 3300041410 Bacteria 6549
135 Ga0439461_0007942 3300041410 Bacteria 1890
136 Ga0439465_0029655 3300041413 Bacteria 1739
137 Ga0439445_0000130 3300042004 Bacteria 12977
138 Ga0439432_016057 3300042006 Bacteria 2522
139 Ga0439432_074639 3300042006 Bacteria 1031
140 Ga0450906_000203 3300042145 Bacteria 11291
141 Ga0450906_043494 3300042145 Unclassified 793
142 Ga0450909_001048 3300042185 Bacteria 3794
143 Ga0439434_0002149 3300042435 Bacteria 5709
144 Ga0439434_0059091 3300042435 Bacteria 1197
145 Ga0466965_0000131 3300044683 Bacteria 21386
146 Ga0453684_0128050 3300044712 Bacteria 3052
147 Ga0451576_0074870 3300045051 Bacteria 3523
148 Ga0495638_0000119 3300046460 Bacteria 127603
149 Ga0495597_0025699 3300046542 Bacteria 2710
150 Ga0495634_0435571 3300046642 Unclassified 775
151 Ga0495660_0000114 3300046810 Bacteria 86218
152 Ga0495660_0030911 3300046810 Bacteria 3014
153 Ga0496100_0156248 3300048903 Unclassified 1631
154 Ga0496110_0549894 3300048913 Bacteria 1049
155 Ga0496115_0000049 3300048918 Bacteria 109919
156 Ga0496118_0089352 3300048921 Bacteria 2127
157 Ga0496124_0007711 3300048927 Bacteria 11380
158 Ga0496124_0096389 3300048927 Bacteria 2403
159 Ga0501034_0001207 3300049571 Bacteria 35479
160 Ga0501034_0489166 3300049571 Bacteria 1145
161 Ga0501037_0000001 3300049573 Bacteria 753276
162 Ga0501038_0002192 3300049574 Bacteria 18167
163 Ga0501043_0092586 3300049579 Bacteria 2377
164 Ga0501080_0244530 3300049742 Bacteria 1637
165 nmdc:mga03n38_15119_c1 3300050490 Bacteria 2974
166 nmdc:mga00v17_301_c1 3300050491 Bacteria 28737
167 nmdc:mga00v17_48495_c1 3300050491 Bacteria 2574
168 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
169 nmdc:mga0yw44_213126_c1 3300050492 Bacteria 1278
170 nmdc:mga0yw44_213_c1 3300050492 Bacteria 20585
171 nmdc:mga0yw44_4000_c1 3300050492 Bacteria 6662
172 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
173 nmdc:mga0k408_58019_c1 3300050493 Bacteria 2248
174 nmdc:mga0k408_762_c2 3300050493 Bacteria 12965
175 nmdc:mga06z11_479_c1 3300050494 Bacteria 14718
176 nmdc:mga04h51_124_c1 3300050495 Bacteria 22571
177 nmdc:mga07m45_18929_c1 3300050496 Bacteria 3725
178 nmdc:mga0sz30_11108_c2 3300050516 Bacteria 2598
179 Ga0500643_009816 3300053087 Bacteria 3624
180 Ga0500643_032306 3300053087 Bacteria 1590
181 Ga0500646_0000010 3300053090 Bacteria 91525
182 Ga0500583_0000924 3300053092 Bacteria 8392
183 Ga0500583_0004818 3300053092 Bacteria 4451
184 Ga0500583_0016239 3300053092 Bacteria 2968
185 Ga0500651_0000043 3300053093 Bacteria 86502
186 Ga0500641_0000001 3300053096 Bacteria 1115973
187 Ga0500650_0005671 3300053098 Bacteria 4686
188 Ga0500555_000005 3300053103 Bacteria 342334
189 Ga0500556_0097740 3300053104 Bacteria 1128
190 Ga0500562_000001 3300053108 Bacteria 1178987
191 Ga0500569_000002 3300053109 Bacteria 127605
192 Ga0500594_0000028 3300053118 Bacteria 50845
193 Ga0500652_000001 3300053131 Bacteria 946868
194 Ga0500655_000280 3300053133 Bacteria 11753
195 Ga0500655_015468 3300053133 Bacteria 1400
196 Ga0500588_0000025 3300053146 Bacteria 35507
197 Ga0500616_0000067 3300053153 Bacteria 236311
198 Ga0500616_0086077 3300053153 Bacteria 1568
199 Ga0500570_002444 3300053724 Bacteria 9237
200 Ga0500570_098275 3300053724 Bacteria 1243
201 Ga0500611_038820 3300053727 Bacteria 1033
202 Ga0070660_100004938
203 MBSR1b_contig_2080750
204 JGI24740J21852_10004660
205 JGI24739J22299_10025620
206 rootH1_10033762
207 rootH2_10004334
208 rootH1_10001727
209 Ga0065715_10004890
210 Ga0070685_10295310
211 Ga0070684_100574352
212 Ga0068855_100000002
213 Ga0068855_100000017
214 Ga0068857_100000322
215 Ga0068857_100019267
216 Ga0068857_100020141
217 Ga0068856_100002784
218 Ga0068856_100915476
219 Ga0068852_100000001
220 Ga0068852_100011881
221 Ga0068861_101015935
222 Ga0081455_10000006
223 Ga0075365_10000054
224 Ga0075365_10000080
225 Ga0075365_10001244
226 Ga0075365_10007614
227 Ga0075365_10131265
228 Ga0075365_10218078
229 Ga0075368_10001695
230 Ga0075363_100000147
231 Ga0075364_10000937
232 Ga0075364_10068713
233 Ga0075362_10072119
234 Ga0075367_10000339
235 Ga0075369_10003342
236 Ga0075366_10001219
237 Ga0075366_10155730
238 Ga0097621_100000001
239 Ga0097621_101428462
240 Ga0075370_10019270
241 Ga0075370_10057606
242 Ga0075370_10118786
243 Ga0068871_100000001
244 Ga0068871_100170688
245 Ga0075428_100007820
246 Ga0068865_100000106
247 Ga0105240_10000030
248 Ga0105240_10000886
249 Ga0105240_10000909
250 Ga0105240_10010910
251 Ga0105240_10189355
252 Ga0105245_10375314
253 Ga0105241_10001961
254 Ga0105241_10065457
255 Ga0105241_10236411
256 Ga0105241_11180703
257 Ga0105248_10069436
258 Ga0105237_10000001
259 Ga0105237_10000159
260 Ga0105237_10032119
261 Ga0105238_10000480
262 Ga0105249_10165421
263 Ga0105032_100009
264 Ga0105032_100012
265 Ga0105029_100012
266 Ga0105028_100264
267 Ga0105239_10000481
268 Ga0105239_10151137
269 Ga0105239_10314605
270 Ga0105246_10310464
271 Ga0157371_10077597
272 Ga0157371_10201922
273 Ga0157370_10000232
274 Ga0157370_10342615
275 Ga0157369_10000003
276 Ga0157369_10014799
277 Ga0157369_10196836
278 Ga0157374_10635392
279 Ga0157372_10000007
280 Ga0157372_10000096
281 Ga0157372_10122414
282 Ga0157372_10183343
283 Ga0207654_10048162
284 Ga0207654_10072942
285 Ga0207654_10876735
286 Ga0207695_10000009
287 Ga0207695_10004142
288 Ga0207695_10026439
289 Ga0207695_10440163
290 Ga0207671_10000003
291 Ga0207671_10000008
292 Ga0207671_10283661
293 Ga0207657_10000547
294 Ga0207694_10000785
295 Ga0207704_10000067
296 Ga0207711_10063582
297 Ga0207679_10000214
298 Ga0207679_10116586
299 Ga0207667_10000005
300 Ga0207667_10000048
301 Ga0207667_10102506
302 Ga0207712_10246690
303 Ga0207702_10000871
304 Ga0207702_10850722
305 Ga0207674_10000563
306 Ga0207674_10027414
307 Ga0207674_10067241
308 Ga0207698_10000169
309 Ga0207698_10064146
310 Ga0209813_10000225
311 Ga0316176_1004111
312 Ga0314311_1014870
313 Ga0316179_1028359
314 Ga0316180_1116439
315 Ga0316183_1053060
316 Ga0316183_1071463
317 Ga0316183_1108554
318 Ga0316183_1154194
319 Ga0316181_1123581
320 Ga0316182_1040041
321 Ga0316182_1106597
322 Ga0316182_1303601
323 Ga0316182_1307373
324 Ga0307516_10000003
325 Ga0307516_10020111
326 Ga0307405_10007005
327 Ga0307406_10000001
328 Ga0307412_10016291
329 Ga0373959_0000003
330 Ga0395899_0030206
331 Ga0395899_0104467
332 Ga0395900_0000001
333 Ga0395898_0000002
334 Ga0395901_0000006
335 Ga0439461_0000351
336 Ga0439461_0007942
337 Ga0439465_0029655
338 Ga0439445_0000130
339 Ga0439432_016057
340 Ga0439432_074639
341 Ga0450906_000203
342 Ga0450906_043494
343 Ga0450909_001048
344 Ga0439434_0002149
345 Ga0439434_0059091
346 Ga0466965_0000131
347 Ga0453684_0128050
348 Ga0451576_0074870
349 Ga0495638_0000119
350 Ga0495597_0025699
351 Ga0495634_0435571
352 Ga0495660_0000114
353 Ga0495660_0030911
354 Ga0496100_0156248
355 Ga0496110_0549894
356 Ga0496115_0000049
357 Ga0496118_0089352
358 Ga0496124_0007711
359 Ga0496124_0096389
360 Ga0501034_0001207
361 Ga0501034_0489166
362 Ga0501037_0000001
363 Ga0501038_0002192
364 Ga0501043_0092586
365 Ga0501080_0244530
366 nmdc:mga03n38_15119_c1
367 nmdc:mga00v17_301_c1
368 nmdc:mga00v17_48495_c1
369 nmdc:mga0yw44_11_c1
370 nmdc:mga0yw44_213126_c1
371 nmdc:mga0yw44_213_c1
372 nmdc:mga0yw44_4000_c1
373 nmdc:mga0yw44_5_c1
374 nmdc:mga0k408_58019_c1
375 nmdc:mga0k408_762_c2
376 nmdc:mga06z11_479_c1
377 nmdc:mga04h51_124_c1
378 nmdc:mga07m45_18929_c1
379 nmdc:mga0sz30_11108_c2
380 Ga0500643_009816
381 Ga0500643_032306
382 Ga0500646_0000010
383 Ga0500583_0000924
384 Ga0500583_0004818
385 Ga0500583_0016239
386 Ga0500651_0000043
387 Ga0500641_0000001
388 Ga0500650_0005671
389 Ga0500555_000005
390 Ga0500556_0097740
391 Ga0500562_000001
392 Ga0500569_000002
393 Ga0500594_0000028
394 Ga0500652_000001
395 Ga0500655_000280
396 Ga0500655_015468
397 Ga0500588_0000025
398 Ga0500616_0000067
399 Ga0500616_0086077
400 Ga0500570_002444
401 Ga0500570_098275
402 Ga0500611_038820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03703

bPH_2

Bacterial PH domain

88

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bq8-assembly1.cif.gz_X crystal structure of human purple acid phosphatase with an inhibitory conformation of the repression loop 0.8124 83 111
8a8o-assembly1.cif.gz_C paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a 0.8023 81 111
1qfc-assembly1.cif.gz_A structure of rat purple acid phosphatase 0.7969 83 111
1qhw-assembly1.cif.gz_A purple acid phosphatase from rat bone 0.791 83 111
1ute-assembly1.cif.gz_A pig purple acid phosphatase complexed with phosphate 0.7786 83 111
ID Description Score Start End Superfamily
af_E7F236_82_190_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.842 84 165 2.30.29.30
af_P43560_195_305_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.834 84 165 2.30.29.30
af_Q54S82_15_150_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.8282 83 115 3.40.1000.30
af_Q553Y9_172_281_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8189 83 163 2.30.29.30
af_Q0DTQ9_188_334_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.8151 83 114 3.40.1000.30
ID Description Score Start End GO Terms
AF-A0A2G6C233-F1-model_v4 YdbS-like PH domain-containing protein 0.8929 12 175 GO:0016020
AF-A0A1F7QUM6-F1-model_v4 YdbS-like PH domain-containing protein 0.89 5 171 GO:0016020
AF-A0A7W4HQ49-F1-model_v4 PH domain-containing protein 0.8887 12 175 GO:0016020
AF-A0A7W4EEI2-F1-model_v4 PH domain-containing protein 0.8886 8 177 GO:0016020
AF-A0A660LZE5-F1-model_v4 YdbS-like PH domain-containing protein 0.888 10 175 GO:0016020

Map