F308661

General Info

Members Datasets Scaffolds Average Seq Length
201 152 402 162

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10239307|Ga0265339_102393072
Length 191
Sequence VTDRRETREPIRVCFVCLGNICRSPTAEAIMRHLLAEEAEEGRRPEQDDEATGARAIPIEVESAGTGDWHVGEPRDRRSRAAGERRGIPLSGRARQFTATDFARFHHVVAMDRKNLADLEAMAPDAAARAKLSLLRAHTPEGELDVPDPYDGGEEGFDRVFDICLTACRALLARLRRGPASAIGPDPAPPP

Samples

Sample ID Description Type Environment
1 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
74 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
75 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
122 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
123 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
124 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
144 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
145 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
146 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
147 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
148 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
149 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
150 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
151 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
152 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0.5
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0.5
Rhizoplane 2.49
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265339_10239307 3300031249 Bacteria 882
2 JGI24735J21928_10010585 3300002067 Bacteria 2939
3 JGI25406J46586_10126645 3300003203 Bacteria 750
4 Ga0006562J51391_1201760 3300003578 Bacteria 2110
5 Ga0055529_1011871 3300003763 Bacteria 1119
6 Ga0070658_10003946 3300005327 Bacteria 12162
7 Ga0070660_100028701 3300005339 Bacteria 4164
8 Ga0070660_100182846 3300005339 Bacteria 1697
9 Ga0070714_102050645 3300005435 Bacteria 558
10 Ga0070713_100461135 3300005436 Bacteria 1195
11 Ga0070681_10026754 3300005458 Bacteria 5800
12 Ga0070697_100014775 3300005536 Bacteria 6127
13 Ga0070696_100063864 3300005546 Bacteria 2580
14 Ga0068855_100156312 3300005563 Bacteria 2590
15 Ga0068855_100353805 3300005563 Bacteria 1617
16 Ga0068857_100173821 3300005577 Bacteria 1959
17 Ga0068854_100558209 3300005578 Bacteria 972
18 Ga0068852_100006551 3300005616 Bacteria 8426
19 Ga0081538_10041676 3300005981 Bacteria 2909
20 Ga0081539_10000556 3300005985 Bacteria 77121
21 Ga0075364_10345432 3300006051 Bacteria 1014
22 Ga0075367_10174354 3300006178 Bacteria 1340
23 Ga0075428_100812300 3300006844 Bacteria 994
24 Ga0075431_100573378 3300006847 Bacteria 1114
25 Ga0105240_10009785 3300009093 Bacteria 13536
26 Ga0105237_10000205 3300009545 Bacteria 84204
27 Ga0105238_10031291 3300009551 Bacteria 5416
28 Ga0105238_11606888 3300009551 Bacteria 680
29 Ga0105239_10251605 3300010375 Bacteria 1985
30 Ga0157373_10000442 3300013100 Bacteria 32910
31 Ga0157374_10282541 3300013296 Bacteria 1639
32 Ga0157380_11978638 3300014326 Bacteria 644
33 Ga0213875_10000855 3300021388 Bacteria 22512
34 Ga0209148_1000579 3300025254 Bacteria 33716
35 Ga0209455_1000804 3300025272 Bacteria 17250
36 Ga0207647_10045315 3300025904 Bacteria 2744
37 Ga0207705_10011874 3300025909 Bacteria 6294
38 Ga0207705_10081775 3300025909 Bacteria 2354
39 Ga0207707_10054147 3300025912 Bacteria 3493
40 Ga0207695_10014915 3300025913 Bacteria 9173
41 Ga0207671_10000224 3300025914 Bacteria 84986
42 Ga0207693_10218860 3300025915 Bacteria 1496
43 Ga0207652_10036271 3300025921 Bacteria 4168
44 Ga0207694_10121880 3300025924 Bacteria 2082
45 Ga0207674_10263606 3300026116 Bacteria 1670
46 Ga0207698_10004687 3300026142 Bacteria 8360
47 Ga0265334_10040003 3300028573 Bacteria 1838
48 Ga0265318_10000396 3300028577 Bacteria 34105
49 Ga0265318_10037688 3300028577 Bacteria 1851
50 Ga0265322_10052082 3300028654 Bacteria 1161
51 Ga0265338_10039130 3300028800 Bacteria 4480
52 Ga0265338_10139216 3300028800 Bacteria 1903
53 Ga0265330_10000271 3300031235 Bacteria 38160
54 Ga0265330_10004988 3300031235 Bacteria 6672
55 Ga0265330_10028439 3300031235 Bacteria 2519
56 Ga0265332_10000909 3300031238 Bacteria 17757
57 Ga0265332_10022364 3300031238 Bacteria 2791
58 Ga0265328_10000827 3300031239 Bacteria 14309
59 Ga0265328_10003648 3300031239 Bacteria 6784
60 Ga0265320_10002739 3300031240 Bacteria 12189
61 Ga0265320_10003526 3300031240 Bacteria 10475
62 Ga0265320_10004074 3300031240 Bacteria 9600
63 Ga0265329_10000602 3300031242 Bacteria 18508
64 Ga0265329_10005707 3300031242 Bacteria 5002
65 Ga0265340_10209898 3300031247 Bacteria 874
66 Ga0265339_10007059 3300031249 Bacteria 7293
67 Ga0265339_10008005 3300031249 Bacteria 6775
68 Ga0265331_10001472 3300031250 Bacteria 17338
69 Ga0265331_10050360 3300031250 Bacteria 1997
70 Ga0265316_10000029 3300031344 Bacteria 164218
71 Ga0265316_10010804 3300031344 Bacteria 8295
72 Ga0265316_10036690 3300031344 Bacteria 3962
73 Ga0265316_10060968 3300031344 Bacteria 2931
74 Ga0265313_10023296 3300031595 Bacteria 3338
75 Ga0265313_10112209 3300031595 Bacteria 1197
76 Ga0265314_10001335 3300031711 Bacteria 27972
77 Ga0265314_10002250 3300031711 Bacteria 19988
78 Ga0265314_10003085 3300031711 Bacteria 16415
79 Ga0265314_10014207 3300031711 Bacteria 6385
80 Ga0265314_10047093 3300031711 Bacteria 3037
81 Ga0265342_10000980 3300031712 Bacteria 28257
82 Ga0265342_10001318 3300031712 Bacteria 23274
83 Ga0265342_10002528 3300031712 Bacteria 15752
84 Ga0265342_10010034 3300031712 Bacteria 6608
85 Ga0373934_0004505 3300035086 Bacteria 5148
86 Ga0373953_0000068 3300035117 Bacteria 25605
87 Ga0373956_0000758 3300035119 Bacteria 13358
88 Ga0373956_0126931 3300035119 Bacteria 1193
89 Ga0373957_0170899 3300035120 Bacteria 898
90 Ga0373955_0000141 3300035172 Bacteria 28366
91 Ga0373955_0113664 3300035172 Bacteria 1567
92 Ga0373924_0000209 3300035410 Bacteria 17849
93 Ga0373933_0000040 3300035724 Bacteria 79834
94 Ga0373933_0000439 3300035724 Bacteria 26018
95 Ga0373937_0000034 3300036401 Bacteria 116552
96 Ga0373937_0017942 3300036401 Bacteria 6313
97 Ga0373925_1782962 3300037068 Bacteria 502
98 Ga0395899_0423166 3300037312 Bacteria 877
99 Ga0395898_0010354 3300037466 Bacteria 9753
100 Ga0395905_0356288 3300037471 Bacteria 1356
101 Ga0436364_0047432 3300037853 Bacteria 88437
102 Ga0395901_0017972 3300038443 Bacteria 7217
103 Ga0439439_0142824 3300041406 Bacteria 677
104 Ga0451789_0519630 3300041443 Bacteria 702
105 Ga0451802_0760784 3300041460 Bacteria 763
106 Ga0451806_186007 3300041462 Bacteria 989
107 Ga0466961_0591764 3300044693 Bacteria 667
108 Ga0466968_0158602 3300044735 Bacteria 1043
109 Ga0495592_0000500 3300046454 Bacteria 28524
110 Ga0495651_0000005 3300046462 Bacteria 173396
111 Ga0495653_0012959 3300046463 Bacteria 6802
112 Ga0495608_0000464 3300046511 Bacteria 28326
113 Ga0495628_0000930 3300046516 Bacteria 26870
114 Ga0495630_0238605 3300046517 Bacteria 1389
115 Ga0495652_0001259 3300046529 Bacteria 28353
116 Ga0495652_0819578 3300046529 Bacteria 618
117 Ga0495587_0000030 3300046536 Bacteria 135844
118 Ga0495609_0039811 3300046538 Bacteria 2115
119 Ga0495645_0188205 3300046543 Bacteria 1409
120 Ga0495667_0001129 3300046559 Bacteria 17370
121 Ga0495657_0000018 3300046675 Bacteria 173397
122 Ga0495599_0000325 3300046678 Bacteria 28377
123 Ga0495623_0000381 3300046679 Bacteria 29058
124 Ga0495646_0033504 3300046680 Bacteria 3193
125 Ga0495600_0012593 3300046809 Bacteria 5294
126 Ga0495604_0000083 3300047317 Bacteria 82509
127 Ga0495674_0040341 3300047319 Bacteria 4176
128 Ga0495676_0126716 3300047321 Bacteria 1849
129 Ga0495680_0001196 3300047322 Bacteria 28462
130 Ga0495675_0000459 3300047444 Bacteria 26886
131 Ga0495685_019637 3300047447 Bacteria 2322
132 Ga0495602_0000921 3300048088 Bacteria 28383
133 Ga0496112_0328732 3300048915 Bacteria 1473
134 Ga0496114_1174580 3300048917 Bacteria 653
135 Ga0496119_0039902 3300048922 Bacteria 3012
136 Ga0496120_0038638 3300048923 Bacteria 2822
137 Ga0501032_0083594 3300049569 Bacteria 2123
138 Ga0501033_0002140 3300049570 Bacteria 17092
139 Ga0501033_0063941 3300049570 Bacteria 2708
140 Ga0501034_0015568 3300049571 Bacteria 7811
141 Ga0501034_0026026 3300049571 Bacteria 5959
142 Ga0501036_0004186 3300049572 Bacteria 11621
143 Ga0501038_0010423 3300049574 Bacteria 8500
144 Ga0501039_0119453 3300049575 Bacteria 2065
145 Ga0501042_0280506 3300049578 Bacteria 1203
146 Ga0501043_0058903 3300049579 Bacteria 3014
147 Ga0501043_0382750 3300049579 Bacteria 1065
148 Ga0501046_0000009 3300049580 Bacteria 335813
149 Ga0501046_0064484 3300049580 Bacteria 2860
150 Ga0501047_0079063 3300049581 Bacteria 3162
151 Ga0501047_0281398 3300049581 Bacteria 1508
152 Ga0501048_0299783 3300049582 Bacteria 1143
153 Ga0501048_0914338 3300049582 Bacteria 631
154 Ga0501069_0073265 3300049585 Bacteria 1920
155 Ga0501069_0126258 3300049585 Bacteria 1463
156 Ga0501070_0034923 3300049586 Bacteria 4202
157 Ga0501071_0480160 3300049587 Bacteria 952
158 Ga0501073_0123423 3300049589 Bacteria 1795
159 Ga0501076_1183064 3300049592 Bacteria 629
160 Ga0501216_004724 3300049660 Bacteria 2028
161 Ga0501227_000491 3300049665 Bacteria 8431
162 Ga0501233_016307 3300049668 Bacteria 1539
163 Ga0501236_022393 3300049670 Bacteria 944
164 Ga0501225_0003456 3300049705 Bacteria 4776
165 Ga0501234_069436 3300049707 Bacteria 607
166 Ga0501035_0006806 3300049822 Bacteria 10680
167 Ga0501035_0088478 3300049822 Bacteria 2729
168 Ga0501045_0057222 3300049824 Bacteria 2853
169 Ga0501045_0182475 3300049824 Bacteria 1564
170 Ga0501212_039587 3300049851 Bacteria 777
171 nmdc:mga00v17_290569_c1 3300050491 Bacteria 1061
172 nmdc:mga06z11_152643_c1 3300050494 Bacteria 1314
173 nmdc:mga06r32_3557_c1 3300050510 Bacteria 13919
174 Ga0495612_0093851 3300053078 Bacteria 1273
175 Ga0495595_0000490 3300053084 Bacteria 15092
176 Ga0500650_0026343 3300053098 Bacteria 2608
177 Ga0500556_0000008 3300053104 Bacteria 304943
178 Ga0500559_0001023 3300053136 Bacteria 17163
179 Ga0500559_0002050 3300053136 Bacteria 10788
180 Ga0500568_0000003 3300053139 Bacteria 863587
181 Ga0500573_0010185 3300053140 Bacteria 5241
182 Ga0500573_0032544 3300053140 Bacteria 3009
183 Ga0500573_0063161 3300053140 Bacteria 2119
184 Ga0500573_0176277 3300053140 Bacteria 1152
185 Ga0500573_0179024 3300053140 Bacteria 1141
186 Ga0500577_0034408 3300053142 Bacteria 1799
187 Ga0500577_0067332 3300053142 Bacteria 1395
188 Ga0501084_0182148 3300054114 Bacteria 1773
189 Ga0501084_1293566 3300054114 Bacteria 611
190 Ga0501082_0026374 3300060353 Bacteria 5006
191 Ga0501082_1148880 3300060353 Bacteria 679
192 2644181859 2643221632 Bacteria 3406696
193 2808972715 2808606384 Bacteria 8474373
194 2809007697 2808606390 Bacteria 8476311
195 2809014763 2808606391 Bacteria 8308166
196 2852644026 2852643534 Bacteria 3013378
197 2857735040 2857733635 Bacteria 3532004
198 2870625384 2870622029 Bacteria 3643329
199 2939660494 2939657138 Bacteria 3740283
200 8048411517 8048406513 Bacteria 8936924
201 8055302047 8055301274 Bacteria 8587385
202 Ga0265339_10239307
203 JGI24735J21928_10010585
204 JGI25406J46586_10126645
205 Ga0006562J51391_1201760
206 Ga0055529_1011871
207 Ga0070658_10003946
208 Ga0070660_100028701
209 Ga0070660_100182846
210 Ga0070714_102050645
211 Ga0070713_100461135
212 Ga0070681_10026754
213 Ga0070697_100014775
214 Ga0070696_100063864
215 Ga0068855_100156312
216 Ga0068855_100353805
217 Ga0068857_100173821
218 Ga0068854_100558209
219 Ga0068852_100006551
220 Ga0081538_10041676
221 Ga0081539_10000556
222 Ga0075364_10345432
223 Ga0075367_10174354
224 Ga0075428_100812300
225 Ga0075431_100573378
226 Ga0105240_10009785
227 Ga0105237_10000205
228 Ga0105238_10031291
229 Ga0105238_11606888
230 Ga0105239_10251605
231 Ga0157373_10000442
232 Ga0157374_10282541
233 Ga0157380_11978638
234 Ga0213875_10000855
235 Ga0209148_1000579
236 Ga0209455_1000804
237 Ga0207647_10045315
238 Ga0207705_10011874
239 Ga0207705_10081775
240 Ga0207707_10054147
241 Ga0207695_10014915
242 Ga0207671_10000224
243 Ga0207693_10218860
244 Ga0207652_10036271
245 Ga0207694_10121880
246 Ga0207674_10263606
247 Ga0207698_10004687
248 Ga0265334_10040003
249 Ga0265318_10000396
250 Ga0265318_10037688
251 Ga0265322_10052082
252 Ga0265338_10039130
253 Ga0265338_10139216
254 Ga0265330_10000271
255 Ga0265330_10004988
256 Ga0265330_10028439
257 Ga0265332_10000909
258 Ga0265332_10022364
259 Ga0265328_10000827
260 Ga0265328_10003648
261 Ga0265320_10002739
262 Ga0265320_10003526
263 Ga0265320_10004074
264 Ga0265329_10000602
265 Ga0265329_10005707
266 Ga0265340_10209898
267 Ga0265339_10007059
268 Ga0265339_10008005
269 Ga0265331_10001472
270 Ga0265331_10050360
271 Ga0265316_10000029
272 Ga0265316_10010804
273 Ga0265316_10036690
274 Ga0265316_10060968
275 Ga0265313_10023296
276 Ga0265313_10112209
277 Ga0265314_10001335
278 Ga0265314_10002250
279 Ga0265314_10003085
280 Ga0265314_10014207
281 Ga0265314_10047093
282 Ga0265342_10000980
283 Ga0265342_10001318
284 Ga0265342_10002528
285 Ga0265342_10010034
286 Ga0373934_0004505
287 Ga0373953_0000068
288 Ga0373956_0000758
289 Ga0373956_0126931
290 Ga0373957_0170899
291 Ga0373955_0000141
292 Ga0373955_0113664
293 Ga0373924_0000209
294 Ga0373933_0000040
295 Ga0373933_0000439
296 Ga0373937_0000034
297 Ga0373937_0017942
298 Ga0373925_1782962
299 Ga0395899_0423166
300 Ga0395898_0010354
301 Ga0395905_0356288
302 Ga0436364_0047432
303 Ga0395901_0017972
304 Ga0439439_0142824
305 Ga0451789_0519630
306 Ga0451802_0760784
307 Ga0451806_186007
308 Ga0466961_0591764
309 Ga0466968_0158602
310 Ga0495592_0000500
311 Ga0495651_0000005
312 Ga0495653_0012959
313 Ga0495608_0000464
314 Ga0495628_0000930
315 Ga0495630_0238605
316 Ga0495652_0001259
317 Ga0495652_0819578
318 Ga0495587_0000030
319 Ga0495609_0039811
320 Ga0495645_0188205
321 Ga0495667_0001129
322 Ga0495657_0000018
323 Ga0495599_0000325
324 Ga0495623_0000381
325 Ga0495646_0033504
326 Ga0495600_0012593
327 Ga0495604_0000083
328 Ga0495674_0040341
329 Ga0495676_0126716
330 Ga0495680_0001196
331 Ga0495675_0000459
332 Ga0495685_019637
333 Ga0495602_0000921
334 Ga0496112_0328732
335 Ga0496114_1174580
336 Ga0496119_0039902
337 Ga0496120_0038638
338 Ga0501032_0083594
339 Ga0501033_0002140
340 Ga0501033_0063941
341 Ga0501034_0015568
342 Ga0501034_0026026
343 Ga0501036_0004186
344 Ga0501038_0010423
345 Ga0501039_0119453
346 Ga0501042_0280506
347 Ga0501043_0058903
348 Ga0501043_0382750
349 Ga0501046_0000009
350 Ga0501046_0064484
351 Ga0501047_0079063
352 Ga0501047_0281398
353 Ga0501048_0299783
354 Ga0501048_0914338
355 Ga0501069_0073265
356 Ga0501069_0126258
357 Ga0501070_0034923
358 Ga0501071_0480160
359 Ga0501073_0123423
360 Ga0501076_1183064
361 Ga0501216_004724
362 Ga0501227_000491
363 Ga0501233_016307
364 Ga0501236_022393
365 Ga0501225_0003456
366 Ga0501234_069436
367 Ga0501035_0006806
368 Ga0501035_0088478
369 Ga0501045_0057222
370 Ga0501045_0182475
371 Ga0501212_039587
372 nmdc:mga00v17_290569_c1
373 nmdc:mga06z11_152643_c1
374 nmdc:mga06r32_3557_c1
375 Ga0495612_0093851
376 Ga0495595_0000490
377 Ga0500650_0026343
378 Ga0500556_0000008
379 Ga0500559_0001023
380 Ga0500559_0002050
381 Ga0500568_0000003
382 Ga0500573_0010185
383 Ga0500573_0032544
384 Ga0500573_0063161
385 Ga0500573_0176277
386 Ga0500573_0179024
387 Ga0500577_0034408
388 Ga0500577_0067332
389 Ga0501084_0182148
390 Ga0501084_1293566
391 Ga0501082_0026374
392 Ga0501082_1148880
393 2644181859
394 2808972715
395 2809007697
396 2809014763
397 2852644026
398 2857735040
399 2870625384
400 2939660494
401 8048411517
402 8055302047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

13

172

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lrq-assembly2.cif.gz_D crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395 0.9567 4 150
7cuy-assembly2.cif.gz_B crystal structure of primo-1 0.9474 3 150
6y2w-assembly1.cif.gz_A crystal structure of the single mutant i16k of low molecular weight protein tyrosine phosphatase (lmw-ptp) 0.9462 3 150
1c0e-assembly2.cif.gz_B active site s19a mutant of bovine heart phosphotyrosyl phosphatase 0.9459 2 152
5jnr-assembly1.cif.gz_A crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a 0.9441 2 150
ID Description Score Start End Superfamily
4lrqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9584 5 151 3.40.50.2300
af_P82890_1_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9545 2 150 3.40.50.2300
af_Q8ING6_1_159_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9435 5 155 3.40.50.2300
af_P82891_5_163_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9412 1 157 3.40.50.2300
af_P41893_1_155_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9409 1 150 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3XQ65-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 1.005 4 93 GO:0004726
GO:0030946
GO:0140793
AF-A0A110B061-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9995 5 100 GO:0004726
GO:0030946
GO:0140793
AF-A0A3D4WBD3-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9993 4 94 GO:0004725
AF-A0A4Q3XU27-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9963 2 129 GO:0004726
GO:0030946
GO:0140793
AF-U2Y812-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9945 1 151 GO:0004726
GO:0030946
GO:0140793

Map