F308981

General Info

Members Datasets Scaffolds Average Seq Length
201 121 201 216

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0036092|Ga0495686_0036092_2208_2915
Length 235
Sequence LETFEENVMAEKNNETLDKLKEGILEFQRKIYPARQEDYEYAATHPQKPHTLLITCADSRIDPEALTNSGPGEIFVARNVGNMVPAYGEMMGGVSAVIEYAIDALKVKHAVVCGHTDCGAMKGILAGEGQLDAMPTVKSWLRNADAAKRVASTVDDGPPSLKTMTEQNVLLQIQHLRTHPSVAGAIARGALTVSGWVYDIARGDVRIYDEAENKFVSLRETAAEDTTGAPQGAKA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
86 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 1
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 7.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10011545 3300003320 Bacteria 2241
2 rootH1_10370396 3300003323 Bacteria 1206
3 Ga0070658_10018824 3300005327 Bacteria 5532
4 Ga0070658_10080282 3300005327 Bacteria 2679
5 Ga0070658_10247633 3300005327 Bacteria 1511
6 Ga0070658_10277579 3300005327 Bacteria 1426
7 Ga0070658_10309675 3300005327 Bacteria 1347
8 Ga0070683_100071273 3300005329 Bacteria 3242
9 Ga0070680_100018754 3300005336 Bacteria 5474
10 Ga0070660_100036401 3300005339 Bacteria 3728
11 Ga0070660_100109386 3300005339 Bacteria 2197
12 Ga0070661_100007186 3300005344 Bacteria 7674
13 Ga0070659_100021996 3300005366 Bacteria 4865
14 Ga0070659_100025241 3300005366 Bacteria 4562
15 Ga0070663_100226733 3300005455 Bacteria 1469
16 Ga0070663_100373987 3300005455 Bacteria 1159
17 Ga0070663_100950960 3300005455 Unclassified 745
18 Ga0070681_10019682 3300005458 Bacteria 6760
19 Ga0070681_10093997 3300005458 Bacteria 2947
20 Ga0070681_10107535 3300005458 Bacteria 2730
21 Ga0070681_10256134 3300005458 Bacteria 1662
22 Ga0068867_100054860 3300005459 Bacteria 2945
23 Ga0070679_100010816 3300005530 Bacteria 8668
24 Ga0070679_100121792 3300005530 Bacteria 2593
25 Ga0070679_100198435 3300005530 Bacteria 1973
26 Ga0070684_100025543 3300005535 Bacteria 4967
27 Ga0070684_100261125 3300005535 Bacteria 1584
28 Ga0070684_100526110 3300005535 Bacteria 1096
29 Ga0068853_100000174 3300005539 Bacteria 44771
30 Ga0068853_100177082 3300005539 Bacteria 1932
31 Ga0070665_100075553 3300005548 Bacteria 3376
32 Ga0070665_100423273 3300005548 Unclassified 1340
33 Ga0068855_100072781 3300005563 Bacteria 3994
34 Ga0068855_100156770 3300005563 Bacteria 2586
35 Ga0068857_100034906 3300005577 Bacteria 4450
36 Ga0068854_100000186 3300005578 Bacteria 41742
37 Ga0068854_100003111 3300005578 Bacteria 10323
38 Ga0068863_100012290 3300005841 Bacteria 8265
39 Ga0068858_100954821 3300005842 Bacteria 839
40 Ga0081455_10013928 3300005937 Bacteria 7904
41 Ga0081539_10197815 3300005985 Unclassified 931
42 Ga0099794_10204630 3300007265 Bacteria 1011
43 Ga0105240_10022181 3300009093 Bacteria 8423
44 Ga0105240_10113679 3300009093 Bacteria 3271
45 Ga0105240_10192973 3300009093 Bacteria 2393
46 Ga0105240_10299239 3300009093 Bacteria 1841
47 Ga0105242_11512546 3300009176 Bacteria 702
48 Ga0105237_10003629 3300009545 Bacteria 18215
49 Ga0105237_10008018 3300009545 Bacteria 11494
50 Ga0105238_10024687 3300009551 Bacteria 6128
51 Ga0105238_10081648 3300009551 Bacteria 3222
52 Ga0105238_10250853 3300009551 Bacteria 1748
53 Ga0105239_10798660 3300010375 Bacteria 1081
54 Ga0105239_11202084 3300010375 Bacteria 874
55 Ga0157370_10017000 3300013104 Bacteria 7352
56 Ga0157370_10064812 3300013104 Bacteria 3458
57 Ga0157370_10099466 3300013104 Bacteria 2726
58 Ga0157369_10020050 3300013105 Bacteria 7478
59 Ga0157369_10064660 3300013105 Bacteria 3939
60 Ga0157369_10205551 3300013105 Bacteria 2065
61 Ga0157369_10446201 3300013105 Bacteria 1340
62 Ga0157374_10087178 3300013296 Bacteria 2971
63 Ga0157374_10318055 3300013296 Bacteria 1542
64 Ga0163162_10763129 3300013306 Bacteria 1086
65 Ga0157372_10010017 3300013307 Bacteria 10080
66 Ga0157372_10052996 3300013307 Bacteria 4520
67 Ga0213876_10072096 3300021384 Bacteria 1824
68 Ga0213876_10090976 3300021384 Bacteria 1616
69 Ga0209233_1001646 3300025261 Bacteria 8697
70 Ga0209233_1012490 3300025261 Bacteria 2464
71 Ga0207647_10031007 3300025904 Bacteria 3445
72 Ga0207705_10005749 3300025909 Bacteria 9257
73 Ga0207705_10089666 3300025909 Bacteria 2250
74 Ga0207705_10107831 3300025909 Bacteria 2055
75 Ga0207705_10201639 3300025909 Bacteria 1507
76 Ga0207705_10207135 3300025909 Bacteria 1487
77 Ga0207707_10102450 3300025912 Bacteria 2502
78 Ga0207707_10376775 3300025912 Bacteria 1220
79 Ga0207707_10516651 3300025912 Bacteria 1017
80 Ga0207695_10008216 3300025913 Bacteria 13110
81 Ga0207695_10115772 3300025913 Bacteria 2655
82 Ga0207695_10149955 3300025913 Bacteria 2272
83 Ga0207671_10030224 3300025914 Bacteria 4041
84 Ga0207671_10165005 3300025914 Bacteria 1717
85 Ga0207660_10024960 3300025917 Bacteria 4052
86 Ga0207657_10016614 3300025919 Bacteria 7091
87 Ga0207649_10019175 3300025920 Bacteria 3906
88 Ga0207652_10000304 3300025921 Bacteria 50509
89 Ga0207652_10062029 3300025921 Bacteria 3230
90 Ga0207694_10613067 3300025924 Bacteria 916
91 Ga0207700_10615879 3300025928 Bacteria 967
92 Ga0207690_10002265 3300025932 Bacteria 11729
93 Ga0207711_10338731 3300025941 Bacteria 1392
94 Ga0207679_10128573 3300025945 Bacteria 2029
95 Ga0207667_10049659 3300025949 Bacteria 4430
96 Ga0207667_10146211 3300025949 Bacteria 2433
97 Ga0207667_10230579 3300025949 Bacteria 1896
98 Ga0207640_10000034 3300025981 Bacteria 112705
99 Ga0207640_10016055 3300025981 Bacteria 4347
100 Ga0207639_10000115 3300026041 Bacteria 62079
101 Ga0207678_10012986 3300026067 Bacteria 7311
102 Ga0207678_10032218 3300026067 Bacteria 4568
103 Ga0207678_10067787 3300026067 Bacteria 3062
104 Ga0207674_10001373 3300026116 Bacteria 31477
105 Ga0268266_10005587 3300028379 Bacteria 11682
106 Ga0268266_10361083 3300028379 Bacteria 1367
107 Ga0268266_10375266 3300028379 Unclassified 1340
108 Ga0307510_10056902 3300033180 Bacteria 4066
109 Ga0373933_0056804 3300035724 Bacteria 2351
110 Ga0373925_0090488 3300037068 Bacteria 2339
111 Ga0373925_0390592 3300037068 Unclassified 1134
112 Ga0395900_0537580 3300037418 Bacteria 1115
113 Ga0395898_0896399 3300037466 Bacteria 825
114 Ga0436364_0159667 3300037853 Bacteria 8042
115 Ga0395901_0153386 3300038443 Bacteria 2420
116 Ga0436365_0248934 3300039437 Unclassified 1400
117 Ga0436365_1330454 3300039437 Unclassified 1525
118 Ga0436365_1888099 3300039437 Bacteria 7490
119 Ga0436363_0448238 3300039450 Unclassified 855
120 Ga0436363_0505455 3300039450 Bacteria 865
121 Ga0495603_0200976 3300046455 Unclassified 1152
122 Ga0495650_0000038 3300046471 Bacteria 377530
123 Ga0495580_0222592 3300046472 Unclassified 1297
124 Ga0495582_0001790 3300046473 Bacteria 12134
125 Ga0495639_0015626 3300046475 Bacteria 3292
126 Ga0495662_0000317 3300046476 Bacteria 21000
127 Ga0495664_0132275 3300046477 Bacteria 1511
128 Ga0495585_0108826 3300046492 Bacteria 1476
129 Ga0495628_0006206 3300046516 Bacteria 10448
130 Ga0495666_0001255 3300046526 Bacteria 12292
131 Ga0495587_0029502 3300046536 Bacteria 3330
132 Ga0495587_0181060 3300046536 Bacteria 1195
133 Ga0495645_0024275 3300046543 Bacteria 4398
134 Ga0495633_0287094 3300046558 Bacteria 748
135 Ga0495667_0158736 3300046559 Bacteria 1455
136 Ga0495634_0017980 3300046642 Bacteria 5037
137 Ga0495634_0185028 3300046642 Bacteria 1302
138 Ga0495625_0000580 3300046660 Bacteria 53177
139 Ga0495625_0079768 3300046660 Bacteria 2281
140 Ga0495635_0358144 3300046663 Unclassified 972
141 Ga0495661_0029401 3300046665 Bacteria 3508
142 Ga0495661_0296757 3300046665 Bacteria 810
143 Ga0495588_0331995 3300046674 Unclassified 800
144 Ga0495599_0027907 3300046678 Bacteria 3536
145 Ga0495599_0197114 3300046678 Bacteria 1238
146 Ga0495623_0150334 3300046679 Bacteria 1377
147 Ga0495646_0041605 3300046680 Bacteria 2822
148 Ga0495613_0024889 3300046689 Bacteria 4460
149 Ga0495624_0012402 3300046690 Bacteria 5829
150 Ga0495600_0023960 3300046809 Bacteria 3928
151 Ga0495581_0017380 3300047315 Bacteria 4176
152 Ga0495674_0030164 3300047319 Bacteria 4933
153 Ga0495674_0144537 3300047319 Bacteria 1997
154 Ga0495676_0027918 3300047321 Bacteria 4832
155 Ga0495680_0367601 3300047322 Bacteria 998
156 Ga0495684_0017333 3300047471 Bacteria 5544
157 Ga0495686_0000064 3300047472 Bacteria 226284
158 Ga0495686_0002792 3300047472 Bacteria 15861
159 Ga0495686_0025244 3300047472 Bacteria 3898
160 Ga0495686_0036092 3300047472 Bacteria 3173
161 Ga0495602_0129240 3300048088 Bacteria 2018
162 Ga0495614_0061659 3300048089 Unclassified 1611
163 Ga0496104_0000027 3300048907 Bacteria 203475
164 Ga0496115_0067797 3300048918 Unclassified 2887
165 Ga0496117_0238215 3300048920 Bacteria 1001
166 Ga0496126_0000005 3300048929 Bacteria 891906
167 Ga0496126_0000018 3300048929 Bacteria 581170
168 Ga0496126_0371313 3300048929 Unclassified 1166
169 Ga0501032_0003281 3300049569 Bacteria 12454
170 Ga0501033_0012887 3300049570 Bacteria 6377
171 Ga0501033_0076500 3300049570 Bacteria 2457
172 Ga0501034_0001806 3300049571 Bacteria 27246
173 Ga0501034_0019278 3300049571 Bacteria 6981
174 Ga0501036_0007562 3300049572 Bacteria 8867
175 Ga0501036_0295640 3300049572 Bacteria 1355
176 Ga0501037_0139381 3300049573 Bacteria 1736
177 Ga0501037_0402154 3300049573 Bacteria 939
178 Ga0501038_0013560 3300049574 Bacteria 7427
179 Ga0501038_0191336 3300049574 Bacteria 1646
180 Ga0501042_0256144 3300049578 Bacteria 1263
181 Ga0501043_0010436 3300049579 Bacteria 7275
182 Ga0501046_0000056 3300049580 Bacteria 129342
183 Ga0501046_0566520 3300049580 Bacteria 808
184 Ga0501047_0012091 3300049581 Bacteria 8170
185 Ga0501047_0115328 3300049581 Bacteria 2568
186 Ga0501047_0160055 3300049581 Bacteria 2123
187 Ga0501048_0527281 3300049582 Bacteria 847
188 Ga0501070_0012925 3300049586 Bacteria 7036
189 Ga0501070_0196002 3300049586 Bacteria 1659
190 Ga0501073_0007972 3300049589 Bacteria 7861
191 Ga0501073_0159481 3300049589 Bacteria 1563
192 Ga0501074_0163561 3300049590 Bacteria 1589
193 Ga0501074_0315872 3300049590 Bacteria 1110
194 Ga0501080_0112965 3300049742 Bacteria 2518
195 Ga0501080_0521577 3300049742 Bacteria 1060
196 Ga0501035_0002066 3300049822 Bacteria 19989
197 Ga0501044_0006095 3300049823 Bacteria 13304
198 Ga0501044_0157459 3300049823 Bacteria 2250
199 Ga0500643_048429 3300053087 Bacteria 1222
200 Ga0500651_0000005 3300053093 Bacteria 384761
201 Ga0500661_015394 3300055283 Bacteria 1371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10093997 Ga0070681_100939972 172
2 3300049590 Ga0501074_0315872 Ga0501074_0315872_526_1095 173
3 3300048929 Ga0496126_0000018 Ga0496126_0000018_547251_547853 182
4 3300005841 Ga0068863_100012290 Ga0068863_1000122906 187
5 3300039450 Ga0436363_0505455 Ga0436363_0505455_165_815 194
6 3300009545 Ga0105237_10003629 Ga0105237_1000362910 196
7 3300025914 Ga0207671_10030224 Ga0207671_100302242 196
8 3300048918 Ga0496115_0067797 Ga0496115_0067797_861_1490 196
9 3300003323 rootH1_10370396 rootH1_103703961 197
10 3300005327 Ga0070658_10018824 Ga0070658_100188243 198
11 3300005327 Ga0070658_10080282 Ga0070658_100802822 198
12 3300005327 Ga0070658_10247633 Ga0070658_102476333 198
13 3300005327 Ga0070658_10309675 Ga0070658_103096752 198
14 3300005329 Ga0070683_100071273 Ga0070683_1000712734 198
15 3300005336 Ga0070680_100018754 Ga0070680_1000187544 198
16 3300005339 Ga0070660_100036401 Ga0070660_1000364011 198
17 3300005339 Ga0070660_100109386 Ga0070660_1001093862 198
18 3300005344 Ga0070661_100007186 Ga0070661_1000071864 198
19 3300005366 Ga0070659_100021996 Ga0070659_1000219963 198
20 3300005455 Ga0070663_100226733 Ga0070663_1002267332 198
21 3300005455 Ga0070663_100373987 Ga0070663_1003739872 198
22 3300005455 Ga0070663_100950960 Ga0070663_1009509601 198
23 3300005458 Ga0070681_10019682 Ga0070681_100196822 198
24 3300005458 Ga0070681_10256134 Ga0070681_102561342 198
25 3300005530 Ga0070679_100010816 Ga0070679_1000108167 198
26 3300005530 Ga0070679_100121792 Ga0070679_1001217921 198
27 3300005530 Ga0070679_100198435 Ga0070679_1001984352 198
28 3300005535 Ga0070684_100025543 Ga0070684_1000255433 198
29 3300005539 Ga0068853_100177082 Ga0068853_1001770822 198
30 3300005563 Ga0068855_100072781 Ga0068855_1000727811 198
31 3300005563 Ga0068855_100156770 Ga0068855_1001567705 198
32 3300005577 Ga0068857_100034906 Ga0068857_1000349064 198
33 3300005578 Ga0068854_100003111 Ga0068854_10000311110 198
34 3300007265 Ga0099794_10204630 Ga0099794_102046302 198
35 3300009093 Ga0105240_10113679 Ga0105240_101136794 198
36 3300009093 Ga0105240_10192973 Ga0105240_101929732 198
37 3300009093 Ga0105240_10299239 Ga0105240_102992393 198
38 3300009176 Ga0105242_11512546 Ga0105242_115125461 198
39 3300009545 Ga0105237_10008018 Ga0105237_100080183 198
40 3300009551 Ga0105238_10024687 Ga0105238_100246873 198
41 3300009551 Ga0105238_10250853 Ga0105238_102508531 198
42 3300010375 Ga0105239_11202084 Ga0105239_112020842 198
43 3300013104 Ga0157370_10064812 Ga0157370_100648124 198
44 3300013104 Ga0157370_10099466 Ga0157370_100994662 198
45 3300013105 Ga0157369_10020050 Ga0157369_1002005011 198
46 3300013105 Ga0157369_10205551 Ga0157369_102055513 198
47 3300013105 Ga0157369_10446201 Ga0157369_104462012 198
48 3300013296 Ga0157374_10087178 Ga0157374_100871783 198
49 3300013296 Ga0157374_10318055 Ga0157374_103180552 198
50 3300013306 Ga0163162_10763129 Ga0163162_107631292 198
51 3300013307 Ga0157372_10010017 Ga0157372_1001001711 198
52 3300013307 Ga0157372_10052996 Ga0157372_100529963 198
53 3300025261 Ga0209233_1012490 Ga0209233_10124902 198
54 3300025904 Ga0207647_10031007 Ga0207647_100310074 198
55 3300025909 Ga0207705_10005749 Ga0207705_100057499 198
56 3300025909 Ga0207705_10089666 Ga0207705_100896662 198
57 3300025909 Ga0207705_10107831 Ga0207705_101078312 198
58 3300025909 Ga0207705_10201639 Ga0207705_102016393 198
59 3300025912 Ga0207707_10102450 Ga0207707_101024503 198
60 3300025912 Ga0207707_10516651 Ga0207707_105166511 198
61 3300025913 Ga0207695_10115772 Ga0207695_101157722 198
62 3300025913 Ga0207695_10149955 Ga0207695_101499553 198
63 3300025914 Ga0207671_10165005 Ga0207671_101650052 198
64 3300025917 Ga0207660_10024960 Ga0207660_100249603 198
65 3300025920 Ga0207649_10019175 Ga0207649_100191753 198
66 3300025921 Ga0207652_10000304 Ga0207652_1000030433 198
67 3300025921 Ga0207652_10062029 Ga0207652_100620295 198
68 3300025924 Ga0207694_10613067 Ga0207694_106130672 198
69 3300025928 Ga0207700_10615879 Ga0207700_106158791 198
70 3300025941 Ga0207711_10338731 Ga0207711_103387312 198
71 3300025945 Ga0207679_10128573 Ga0207679_101285733 198
72 3300025949 Ga0207667_10049659 Ga0207667_100496592 198
73 3300025949 Ga0207667_10146211 Ga0207667_101462112 198
74 3300025949 Ga0207667_10230579 Ga0207667_102305792 198
75 3300025981 Ga0207640_10016055 Ga0207640_100160555 198
76 3300026067 Ga0207678_10012986 Ga0207678_100129862 198
77 3300026067 Ga0207678_10032218 Ga0207678_100322183 198
78 3300026067 Ga0207678_10067787 Ga0207678_100677874 198
79 3300026116 Ga0207674_10001373 Ga0207674_1000137314 198
80 3300035724 Ga0373933_0056804 Ga0373933_0056804_946_1584 198
81 3300046455 Ga0495603_0200976 Ga0495603_0200976_438_1088 198
82 3300046471 Ga0495650_0000038 Ga0495650_0000038_136712_137359 198
83 3300046472 Ga0495580_0222592 Ga0495580_0222592_10_660 198
84 3300046473 Ga0495582_0001790 Ga0495582_0001790_3982_4632 198
85 3300046475 Ga0495639_0015626 Ga0495639_0015626_236_886 198
86 3300046476 Ga0495662_0000317 Ga0495662_0000317_11030_11680 198
87 3300046477 Ga0495664_0132275 Ga0495664_0132275_286_936 198
88 3300046492 Ga0495585_0108826 Ga0495585_0108826_180_827 198
89 3300046516 Ga0495628_0006206 Ga0495628_0006206_5961_6611 198
90 3300046526 Ga0495666_0001255 Ga0495666_0001255_4600_5250 198
91 3300046536 Ga0495587_0029502 Ga0495587_0029502_970_1620 198
92 3300046536 Ga0495587_0181060 Ga0495587_0181060_416_1054 198
93 3300046543 Ga0495645_0024275 Ga0495645_0024275_2127_2777 198
94 3300046558 Ga0495633_0287094 Ga0495633_0287094_16_663 198
95 3300046559 Ga0495667_0158736 Ga0495667_0158736_732_1370 198
96 3300046642 Ga0495634_0017980 Ga0495634_0017980_2414_3064 198
97 3300046642 Ga0495634_0185028 Ga0495634_0185028_432_1070 198
98 3300046660 Ga0495625_0079768 Ga0495625_0079768_672_1319 198
99 3300046663 Ga0495635_0358144 Ga0495635_0358144_99_749 198
100 3300046665 Ga0495661_0029401 Ga0495661_0029401_2659_3306 198
101 3300046674 Ga0495588_0331995 Ga0495588_0331995_73_723 198
102 3300046678 Ga0495599_0027907 Ga0495599_0027907_1595_2245 198
103 3300046678 Ga0495599_0197114 Ga0495599_0197114_32_682 198
104 3300046679 Ga0495623_0150334 Ga0495623_0150334_443_1093 198
105 3300046680 Ga0495646_0041605 Ga0495646_0041605_228_878 198
106 3300046689 Ga0495613_0024889 Ga0495613_0024889_971_1621 198
107 3300046690 Ga0495624_0012402 Ga0495624_0012402_1831_2481 198
108 3300046809 Ga0495600_0023960 Ga0495600_0023960_2060_2710 198
109 3300047315 Ga0495581_0017380 Ga0495581_0017380_1636_2286 198
110 3300047319 Ga0495674_0030164 Ga0495674_0030164_252_902 198
111 3300047319 Ga0495674_0144537 Ga0495674_0144537_148_786 198
112 3300047321 Ga0495676_0027918 Ga0495676_0027918_1406_2056 198
113 3300047322 Ga0495680_0367601 Ga0495680_0367601_77_727 198
114 3300047471 Ga0495684_0017333 Ga0495684_0017333_518_1168 198
115 3300047472 Ga0495686_0002792 Ga0495686_0002792_963_1595 198
116 3300048088 Ga0495602_0129240 Ga0495602_0129240_1055_1705 198
117 3300048089 Ga0495614_0061659 Ga0495614_0061659_45_695 198
118 3300049569 Ga0501032_0003281 Ga0501032_0003281_276_926 198
119 3300049570 Ga0501033_0012887 Ga0501033_0012887_5236_5886 198
120 3300049570 Ga0501033_0076500 Ga0501033_0076500_1197_1841 198
121 3300049571 Ga0501034_0001806 Ga0501034_0001806_26451_27101 198
122 3300049572 Ga0501036_0007562 Ga0501036_0007562_6335_6985 198
123 3300049573 Ga0501037_0139381 Ga0501037_0139381_443_1093 198
124 3300049574 Ga0501038_0013560 Ga0501038_0013560_448_1098 198
125 3300049574 Ga0501038_0191336 Ga0501038_0191336_302_946 198
126 3300049578 Ga0501042_0256144 Ga0501042_0256144_475_1119 198
127 3300049579 Ga0501043_0010436 Ga0501043_0010436_5674_6324 198
128 3300049580 Ga0501046_0000056 Ga0501046_0000056_98858_99508 198
129 3300049581 Ga0501047_0012091 Ga0501047_0012091_1858_2508 198
130 3300049581 Ga0501047_0160055 Ga0501047_0160055_641_1285 198
131 3300049582 Ga0501048_0527281 Ga0501048_0527281_42_692 198
132 3300049586 Ga0501070_0196002 Ga0501070_0196002_63_707 198
133 3300049589 Ga0501073_0007972 Ga0501073_0007972_6365_7015 198
134 3300049590 Ga0501074_0163561 Ga0501074_0163561_449_1099 198
135 3300049742 Ga0501080_0112965 Ga0501080_0112965_854_1504 198
136 3300049742 Ga0501080_0521577 Ga0501080_0521577_59_703 198
137 3300049822 Ga0501035_0002066 Ga0501035_0002066_13675_14325 198
138 3300049823 Ga0501044_0006095 Ga0501044_0006095_1721_2371 198
139 3300049823 Ga0501044_0157459 Ga0501044_0157459_1268_1912 198
140 3300053087 Ga0500643_048429 Ga0500643_048429_244_891 198
141 3300053093 Ga0500651_0000005 Ga0500651_0000005_217224_217871 198
142 3300005548 Ga0070665_100423273 Ga0070665_1004232731 199
143 3300005842 Ga0068858_100954821 Ga0068858_1009548212 199
144 3300021384 Ga0213876_10090976 Ga0213876_100909762 199
145 3300028379 Ga0268266_10375266 Ga0268266_103752662 199
146 3300033180 Ga0307510_10056902 Ga0307510_100569023 199
147 3300037853 Ga0436364_0159667 Ga0436364_0159667_1828_2514 199
148 3300039437 Ga0436365_1330454 Ga0436365_1330454_451_1092 199
149 3300005327 Ga0070658_10277579 Ga0070658_102775792 200
150 3300005458 Ga0070681_10107535 Ga0070681_101075352 200
151 3300005535 Ga0070684_100261125 Ga0070684_1002611252 200
152 3300005535 Ga0070684_100526110 Ga0070684_1005261102 200
153 3300005937 Ga0081455_10013928 Ga0081455_100139286 200
154 3300005985 Ga0081539_10197815 Ga0081539_101978152 200
155 3300009551 Ga0105238_10081648 Ga0105238_100816482 200
156 3300010375 Ga0105239_10798660 Ga0105239_107986602 200
157 3300013105 Ga0157369_10064660 Ga0157369_100646603 200
158 3300021384 Ga0213876_10072096 Ga0213876_100720962 200
159 3300025909 Ga0207705_10207135 Ga0207705_102071352 200
160 3300025912 Ga0207707_10376775 Ga0207707_103767752 200
161 3300028379 Ga0268266_10361083 Ga0268266_103610832 200
162 3300037068 Ga0373925_0090488 Ga0373925_0090488_884_1567 200
163 3300037068 Ga0373925_0390592 Ga0373925_0390592_346_1044 200
164 3300037418 Ga0395900_0537580 Ga0395900_0537580_213_914 200
165 3300037466 Ga0395898_0896399 Ga0395898_0896399_125_796 200
166 3300038443 Ga0395901_0153386 Ga0395901_0153386_968_1639 200
167 3300039437 Ga0436365_0248934 Ga0436365_0248934_256_939 200
168 3300039437 Ga0436365_1888099 Ga0436365_1888099_3987_4670 200
169 3300039450 Ga0436363_0448238 Ga0436363_0448238_61_744 200
170 3300048929 Ga0496126_0371313 Ga0496126_0371313_169_855 200
171 3300049571 Ga0501034_0019278 Ga0501034_0019278_4600_5259 200
172 3300049572 Ga0501036_0295640 Ga0501036_0295640_59_718 200
173 3300049573 Ga0501037_0402154 Ga0501037_0402154_76_735 200
174 3300049580 Ga0501046_0566520 Ga0501046_0566520_118_777 200
175 3300049581 Ga0501047_0115328 Ga0501047_0115328_1570_2229 200
176 3300049586 Ga0501070_0012925 Ga0501070_0012925_5978_6637 200
177 3300049589 Ga0501073_0159481 Ga0501073_0159481_265_924 200
178 3300005366 Ga0070659_100025241 Ga0070659_1000252412 201
179 3300005539 Ga0068853_100000174 Ga0068853_10000017437 201
180 3300005548 Ga0070665_100075553 Ga0070665_1000755533 201
181 3300005578 Ga0068854_100000186 Ga0068854_10000018635 201
182 3300009093 Ga0105240_10022181 Ga0105240_100221814 201
183 3300013104 Ga0157370_10017000 Ga0157370_100170005 201
184 3300025913 Ga0207695_10008216 Ga0207695_1000821611 201
185 3300025919 Ga0207657_10016614 Ga0207657_100166142 201
186 3300025932 Ga0207690_10002265 Ga0207690_100022654 201
187 3300025981 Ga0207640_10000034 Ga0207640_100000349 201
188 3300026041 Ga0207639_10000115 Ga0207639_1000011540 201
189 3300028379 Ga0268266_10005587 Ga0268266_100055874 201
190 3300046660 Ga0495625_0000580 Ga0495625_0000580_13416_14072 201
191 3300055283 Ga0500661_015394 Ga0500661_015394_413_1084 201
192 3300003320 rootH2_10011545 rootH2_100115452 202
193 3300005459 Ga0068867_100054860 Ga0068867_1000548605 202
194 3300025261 Ga0209233_1001646 Ga0209233_10016467 202
195 3300046665 Ga0495661_0296757 Ga0495661_0296757_104_772 202
196 3300047472 Ga0495686_0000064 Ga0495686_0000064_212264_212923 202
197 3300047472 Ga0495686_0025244 Ga0495686_0025244_2632_3291 202
198 3300047472 Ga0495686_0036092 Ga0495686_0036092_2208_2915 202
199 3300048907 Ga0496104_0000027 Ga0496104_0000027_202_861 202
200 3300048920 Ga0496117_0238215 Ga0496117_0238215_227_874 202
201 3300048929 Ga0496126_0000005 Ga0496126_0000005_842050_842709 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

51

205

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.9413 7 200
5swc-assembly1.cif.gz_E the structure of the beta-carbonic anhydrase ccaa 0.9408 6 200
5swc-assembly1.cif.gz_E the structure of the beta-carbonic anhydrase ccaa 0.9052 6 200
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.9011 7 200
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.8965 38 196
ID Description Score Start End Superfamily
5swcF00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9365 6 200 3.40.1050.10
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9209 9 201 3.40.1050.10
af_A0A1D6NHQ1_7_236_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.904 11 202 3.40.1050.10
5swcF00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9008 6 200 3.40.1050.10
af_I1K1G3_108_328_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8918 6 199 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A7D8BF62-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9671 4 201 GO:0004089
GO:0008270
GO:0015976
AF-A0A3L8J359-F1-model_v4 deleted 0.9595 11 198
AF-A0A3M2L705-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9543 9 198 GO:0004089
GO:0008270
GO:0015976
AF-A0A3N4S0U8-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9543 11 202 GO:0004089
GO:0008270
GO:0015976
AF-A0A3D0WLQ7-F1-model_v4 deleted 0.9518 9 184

Feature Viewer

pLDDT pTM Quality
92.56 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map