F309169

General Info

Members Datasets Scaffolds Average Seq Length
201 135 157 306

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606361|2808857726
Length 366
Sequence LAITPPVLGRISIGKVVEKNGKRLPEKDDQFTITSQVQGNDGWLLHPLNDELRQGKEDKLRSIPVRLLFNEPELNFRADYTLFDRQSGRPLCVGNGETCKRVTQDGMQSLPCPSPNTCSLAKGNACKPYGRLNVIIGDDDPLGSFVFRTTGFNSIRTLAARLHYFKAISGNRLACLPLELRLRGKSTRQSHGTPIFYVDLTVRGGMDIAETLQAANELDAQRQAAGFVQAALDEAAKRGFGNGAFEDSEEDAGAIAEEFYPAEETSSPTTNTSQRSAKTSLAEKLDAQAQRHTPPTVHHQGAQHAPTQAEGQRIDRHLPGRVAGHRNQHPADGQAVGESASASGASTDFTEGNIQPPAGAAGRLRA

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2511231017 Pseudomonas sp. GM55 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
7 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
8 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
9 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
12 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
13 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
14 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
15 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
16 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
17 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
18 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
19 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
20 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
21 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
22 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
23 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
24 2885266251 Ralstonia sp. SET104 Isolate Nodule
25 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
26 2904564687 Burkholderia sp. 571 Isolate Unclassified
27 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
28 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
29 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
30 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
31 2928058823 Ralstonia sp. 1138 Isolate Unclassified
32 2928536128 Burkholderia sola 565 Isolate Unclassified
33 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
34 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
35 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
86 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
87 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
134 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
135 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.11
Metatranscriptomes 0
Isolates 21.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.97
Nodule 3.98
Rhizoplane 1
Rhizosphere 70.65
Stem 0
Stem Tuber 0
Unclassified 17.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001012 3300001989 Bacteria 10436
2 JGI25154J39366_1000819 3300002738 Bacteria 13522
3 Ga0055538_1000344 3300003751 Bacteria 20554
4 Ga0055542_1001105 3300003762 Bacteria 16214
5 Ga0055541_1000125 3300003841 Bacteria 50666
6 Ga0055541_1006811 3300003841 Bacteria 1914
7 Ga0065714_10002363 3300005288 Bacteria 22671
8 Ga0065704_10227177 3300005289 Bacteria 1055
9 Ga0070659_100145736 3300005366 Bacteria 1929
10 Ga0099823_1002502 3300006944 Bacteria 16630
11 Ga0099823_1012610 3300006944 Bacteria 8539
12 Ga0105251_10000776 3300009011 Bacteria 29035
13 Ga0105244_10000889 3300009036 Bacteria 25274
14 Ga0105242_10008105 3300009176 Bacteria 8083
15 Ga0105237_10003959 3300009545 Bacteria 17340
16 Ga0105246_10005811 3300011119 Bacteria 7525
17 Ga0157373_10000682 3300013100 Bacteria 26579
18 Ga0157373_10001351 3300013100 Bacteria 18813
19 Ga0157371_10022666 3300013102 Bacteria 4596
20 Ga0157370_10076628 3300013104 Bacteria 3150
21 Ga0163162_10000749 3300013306 Bacteria 30243
22 Ga0157375_10000600 3300013308 Bacteria 31984
23 Ga0182008_10001573 3300014497 Bacteria 15186
24 Ga0182008_10002843 3300014497 Bacteria 10709
25 Ga0182008_10003365 3300014497 Bacteria 9703
26 Ga0182006_1000318 3300015261 Bacteria 42249
27 Ga0182006_1000553 3300015261 Bacteria 28152
28 Ga0182007_10000217 3300015262 Bacteria 38571
29 Ga0182007_10000707 3300015262 Bacteria 19015
30 Ga0182007_10002514 3300015262 Bacteria 9053
31 Ga0182005_1000152 3300015265 Bacteria 48562
32 Ga0182005_1005983 3300015265 Bacteria 3762
33 Ga0163161_10031414 3300017792 Bacteria 3783
34 Ga0213872_10002538 3300021361 Bacteria 10638
35 Ga0209784_100162 3300025224 Bacteria 57991
36 Ga0209784_100289 3300025224 Bacteria 27867
37 Ga0209566_100225 3300025225 Bacteria 55718
38 Ga0209566_100241 3300025225 Bacteria 52702
39 Ga0209674_100189 3300025226 Bacteria 66805
40 Ga0209674_100774 3300025226 Bacteria 10833
41 Ga0209646_1000119 3300025246 Bacteria 147427
42 Ga0209026_1001633 3300025250 Bacteria 9535
43 Ga0209677_110587 3300025253 Bacteria 1518
44 Ga0209148_1000166 3300025254 Bacteria 135829
45 Ga0209759_1000872 3300025256 Bacteria 23120
46 Ga0209256_1001408 3300025299 Bacteria 24993
47 Ga0209051_1003825 3300025303 Bacteria 9634
48 Ga0207655_1000319 3300025728 Bacteria 71324
49 Ga0207655_1001178 3300025728 Bacteria 25387
50 Ga0207655_1028818 3300025728 Bacteria 2611
51 Ga0207713_1000714 3300025735 Bacteria 31005
52 Ga0207713_1036545 3300025735 Bacteria 2105
53 Ga0207695_10003439 3300025913 Bacteria 22335
54 Ga0207671_10000060 3300025914 Bacteria 178435
55 Ga0207690_10155851 3300025932 Bacteria 1698
56 Ga0207667_10015272 3300025949 Bacteria 8732
57 Ga0209389_1030837 3300027296 Bacteria 4508
58 Ga0209389_1036917 3300027296 Bacteria 3905
59 Ga0265338_10000239 3300028800 Bacteria 101471
60 Ga0307516_10230335 3300031730 Bacteria 1556
61 Ga0436361_0248346 3300039447 Bacteria 2113
62 Ga0436361_0682487 3300039447 Bacteria 30182
63 Ga0439438_003439 3300041405 Bacteria 6396
64 Ga0439438_010279 3300041405 Bacteria 2967
65 Ga0439447_000035 3300041407 Bacteria 47294
66 Ga0439447_000087 3300041407 Bacteria 32513
67 Ga0439447_001733 3300041407 Bacteria 7989
68 Ga0439466_0000416 3300041411 Bacteria 16174
69 Ga0439466_0014251 3300041411 Bacteria 2898
70 Ga0439432_000018 3300042006 Bacteria 61583
71 Ga0439452_000289 3300042010 Bacteria 32524
72 Ga0439456_000169 3300042013 Bacteria 19339
73 Ga0450904_000974 3300042139 Bacteria 4490
74 Ga0450906_000020 3300042145 Bacteria 29396
75 Ga0439446_0023663 3300042156 Bacteria 1749
76 Ga0466972_0018043 3300044658 Bacteria 3529
77 Ga0466966_0012370 3300044684 Bacteria 5655
78 Ga0466961_0000730 3300044693 Bacteria 20657
79 Ga0466959_0164793 3300045049 Bacteria 1557
80 Ga0495627_003243 3300046453 Bacteria 7302
81 Ga0495591_000874 3300046458 Bacteria 21151
82 Ga0495591_003226 3300046458 Bacteria 8582
83 Ga0495653_0000200 3300046463 Bacteria 48706
84 Ga0495653_0000560 3300046463 Bacteria 28456
85 Ga0495580_0006196 3300046472 Bacteria 9782
86 Ga0495580_0006449 3300046472 Bacteria 9551
87 Ga0495580_0013187 3300046472 Bacteria 6322
88 Ga0495580_0227669 3300046472 Bacteria 1280
89 Ga0495584_0000068 3300046491 Bacteria 73307
90 Ga0495584_0000222 3300046491 Bacteria 41020
91 Ga0495607_0000084 3300046501 Bacteria 96419
92 Ga0495583_0000181 3300046506 Bacteria 107973
93 Ga0495583_0004434 3300046506 Bacteria 10048
94 Ga0495606_0023636 3300046507 Bacteria 4447
95 Ga0495610_0000755 3300046512 Bacteria 30548
96 Ga0495610_0008780 3300046512 Bacteria 6485
97 Ga0495610_0042732 3300046512 Bacteria 2264
98 Ga0495610_0064006 3300046512 Bacteria 1740
99 Ga0495610_0114548 3300046512 Bacteria 1190
100 Ga0495631_0000138 3300046518 Bacteria 49408
101 Ga0495632_0000713 3300046519 Bacteria 30134
102 Ga0495632_0001709 3300046519 Bacteria 17846
103 Ga0495632_0027219 3300046519 Bacteria 2997
104 Ga0495637_0000038 3300046520 Bacteria 118140
105 Ga0495637_0000501 3300046520 Bacteria 28370
106 Ga0495648_0000356 3300046524 Bacteria 50394
107 Ga0495648_0000660 3300046524 Bacteria 36843
108 Ga0495648_0000712 3300046524 Bacteria 35479
109 Ga0495648_0000728 3300046524 Bacteria 35165
110 Ga0495648_0022181 3300046524 Bacteria 4378
111 Ga0495654_0000528 3300046530 Bacteria 30944
112 Ga0495654_0020510 3300046530 Bacteria 3442
113 Ga0495665_0176123 3300046531 Bacteria 1112
114 Ga0495597_0000151 3300046542 Bacteria 61673
115 Ga0495597_0000871 3300046542 Bacteria 23497
116 Ga0495597_0016151 3300046542 Bacteria 3529
117 Ga0495622_0040101 3300046557 Bacteria 2180
118 Ga0495634_0113556 3300046642 Bacteria 1739
119 Ga0495625_0001151 3300046660 Bacteria 34051
120 Ga0495625_0003149 3300046660 Bacteria 16806
121 Ga0495661_0000044 3300046665 Bacteria 148721
122 Ga0495661_0005346 3300046665 Bacteria 9130
123 Ga0495661_0037632 3300046665 Bacteria 3019
124 Ga0495661_0050462 3300046665 Bacteria 2519
125 Ga0495671_0008008 3300046692 Bacteria 5971
126 Ga0495649_0000278 3300046694 Bacteria 45149
127 Ga0495649_0001459 3300046694 Bacteria 17800
128 Ga0495649_0003871 3300046694 Bacteria 9909
129 Ga0495649_0009525 3300046694 Bacteria 5762
130 Ga0495649_0042461 3300046694 Bacteria 2485
131 Ga0495660_0000093 3300046810 Bacteria 95425
132 Ga0495660_0000316 3300046810 Bacteria 43536
133 Ga0495660_0000317 3300046810 Bacteria 43361
134 Ga0495674_0001611 3300047319 Bacteria 22120
135 Ga0495672_0000482 3300047320 Bacteria 47015
136 Ga0495672_0010436 3300047320 Bacteria 6615
137 Ga0495680_0028811 3300047322 Bacteria 4551
138 Ga0495673_0000503 3300047469 Bacteria 41432
139 Ga0495673_0001527 3300047469 Bacteria 18240
140 Ga0495673_0001544 3300047469 Bacteria 18104
141 Ga0495681_0007686 3300047470 Bacteria 6843
142 Ga0495681_0045809 3300047470 Bacteria 2090
143 Ga0495602_0000809 3300048088 Bacteria 29911
144 Ga0495614_0004142 3300048089 Bacteria 6529
145 Ga0495626_0000789 3300048091 Bacteria 28776
146 Ga0495626_0022068 3300048091 Bacteria 3148
147 Ga0496117_0000613 3300048920 Bacteria 58024
148 Ga0496118_0002283 3300048921 Bacteria 26160
149 Ga0496122_0001078 3300048925 Bacteria 47355
150 Ga0496122_0002033 3300048925 Bacteria 30019
151 Ga0496123_0000564 3300048926 Bacteria 63390
152 Ga0496125_0002226 3300048928 Bacteria 25817
153 Ga0496125_0002949 3300048928 Bacteria 21399
154 Ga0496125_0247312 3300048928 Bacteria 1127
155 Ga0495682_0000131 3300049460 Bacteria 65377
156 Ga0501034_0000085 3300049571 Bacteria 166893
157 Ga0466962_0046789 3300061719 Bacteria 2067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10230335 Ga0307516_102303351 283
2 iso_pu_bacteria 2919501602 2919504642 284
3 iso_pu_bacteria 2926063275 2926064785 284
4 3300046472 Ga0495580_0006449 Ga0495580_0006449_8412_9368 286
5 iso_pu_bacteria 2606217733 2608382113 287
6 iso_pu_bacteria 2597489889 2597871874 288
7 iso_pu_bacteria 2738543020 2739287333 288
8 iso_pu_bacteria 2738543021 2739292646 288
9 iso_pu_bacteria 2885266251 2885266513 288
10 iso_pu_bacteria 2808606379 2808942881 290
11 3300046665 Ga0495661_0005346 Ga0495661_0005346_4664_5593 291
12 iso_pu_bacteria 2606217733 2608379753 291
13 iso_pu_bacteria 2808606361 2808857726 291
14 iso_pu_bacteria 2808606378 2808937850 291
15 iso_pu_bacteria 2808606383 2808966210 291
16 iso_pu_bacteria 2808606389 2809001102 291
17 iso_pu_bacteria 2808606445 2809215474 291
18 3300005289 Ga0065704_10227177 Ga0065704_102271771 292
19 3300006944 Ga0099823_1002502 Ga0099823_10025027 292
20 3300009176 Ga0105242_10008105 Ga0105242_100081052 292
21 3300013102 Ga0157371_10022666 Ga0157371_100226665 292
22 3300014497 Ga0182008_10001573 Ga0182008_1000157311 292
23 3300025303 Ga0209051_1003825 Ga0209051_100382510 292
24 3300027296 Ga0209389_1036917 Ga0209389_10369173 292
25 3300041411 Ga0439466_0014251 Ga0439466_0014251_931_1878 292
26 3300047322 Ga0495680_0028811 Ga0495680_0028811_3329_4225 292
27 3300048920 Ga0496117_0000613 Ga0496117_0000613_16545_17489 292
28 3300048921 Ga0496118_0002283 Ga0496118_0002283_4090_5034 292
29 3300048925 Ga0496122_0002033 Ga0496122_0002033_17347_18240 292
30 3300048926 Ga0496123_0000564 Ga0496123_0000564_45531_46424 292
31 3300048928 Ga0496125_0002226 Ga0496125_0002226_8203_9147 292
32 iso_pu_bacteria 2939636861 2939638424 292
33 3300009036 Ga0105244_10000889 Ga0105244_100008898 293
34 3300014497 Ga0182008_10002843 Ga0182008_100028437 293
35 3300015265 Ga0182005_1000152 Ga0182005_100015213 293
36 3300025728 Ga0207655_1001178 Ga0207655_100117815 293
37 3300039447 Ga0436361_0248346 Ga0436361_0248346_80_1060 293
38 3300039447 Ga0436361_0682487 Ga0436361_0682487_17621_18601 293
39 3300046472 Ga0495580_0227669 Ga0495580_0227669_59_988 293
40 iso_pu_bacteria 2904564687 2904571578 293
41 iso_pu_bacteria 2904571731 2904578634 293
42 iso_pu_bacteria 2928536128 2928543186 293
43 iso_pu_bacteria 8039098773 8039101420 293
44 3300041405 Ga0439438_003439 Ga0439438_003439_3408_4334 294
45 3300041407 Ga0439447_000035 Ga0439447_000035_15417_16343 294
46 3300041411 Ga0439466_0000416 Ga0439466_0000416_4718_5644 294
47 iso_pu_bacteria 2511231008 2511279734 294
48 iso_pu_bacteria 2511231017 2511330418 294
49 iso_pu_bacteria 2643221571 2643869607 294
50 iso_pu_bacteria 2738541271 2738687289 294
51 iso_pu_bacteria 2738543016 2739262910 294
52 iso_pu_bacteria 2945961074 2945967945 294
53 iso_pu_bacteria 8020945358 8020952280 294
54 3300009011 Ga0105251_10000776 Ga0105251_1000077618 295
55 3300013100 Ga0157373_10000682 Ga0157373_1000068217 295
56 3300015265 Ga0182005_1005983 Ga0182005_10059832 295
57 3300025735 Ga0207713_1000714 Ga0207713_10007148 295
58 3300042145 Ga0450906_000020 Ga0450906_000020_9240_10190 295
59 3300042156 Ga0439446_0023663 Ga0439446_0023663_791_1702 295
60 3300046512 Ga0495610_0114548 Ga0495610_0114548_97_1047 295
61 3300049571 Ga0501034_0000085 Ga0501034_0000085_3890_4891 295
62 iso_pu_bacteria 2512047030 2512347198 295
63 iso_pu_bacteria 2515154189 2516025035 295
64 iso_pu_bacteria 2713897149 2715757238 295
65 iso_pu_bacteria 2816332256 2817278295 295
66 iso_pu_bacteria 2928058823 2928062384 295
67 iso_pu_bacteria 2935353572 2935353657 295
68 iso_pu_bacteria 8018845410 8018852330 295
69 iso_pu_bacteria 8020945358 8020946814 295
70 3300005366 Ga0070659_100145736 Ga0070659_1001457363 296
71 3300013104 Ga0157370_10076628 Ga0157370_100766283 296
72 3300015261 Ga0182006_1000318 Ga0182006_100031813 296
73 3300015261 Ga0182006_1000553 Ga0182006_100055313 296
74 3300017792 Ga0163161_10031414 Ga0163161_100314143 296
75 3300025735 Ga0207713_1036545 Ga0207713_10365453 296
76 3300025932 Ga0207690_10155851 Ga0207690_101558512 296
77 3300041405 Ga0439438_010279 Ga0439438_010279_1355_2284 296
78 3300046458 Ga0495591_000874 Ga0495591_000874_16595_17545 296
79 3300046506 Ga0495583_0004434 Ga0495583_0004434_4027_4947 296
80 3300046507 Ga0495606_0023636 Ga0495606_0023636_381_1331 296
81 3300046524 Ga0495648_0000356 Ga0495648_0000356_28694_29614 296
82 3300046530 Ga0495654_0000528 Ga0495654_0000528_9938_10846 296
83 3300046694 Ga0495649_0000278 Ga0495649_0000278_6047_6967 296
84 3300046694 Ga0495649_0003871 Ga0495649_0003871_3737_4657 296
85 3300046810 Ga0495660_0000316 Ga0495660_0000316_13997_14905 296
86 iso_pu_bacteria 2596583598 2597032590 296
87 iso_pu_bacteria 2600255067 2600813890 296
88 iso_pu_bacteria 2643221658 2644326033 296
89 iso_pu_bacteria 2816332253 2817260663 296
90 iso_pu_bacteria 2902682994 2902688954 296
91 iso_pu_bacteria 2919527303 2919531988 296
92 iso_pu_bacteria 2928536128 2928541327 296
93 iso_pu_bacteria 8018845410 8018853547 296
94 iso_pu_bacteria 8020945358 8020946936 296
95 iso_pu_bacteria 8020945358 8020947663 296
96 3300002738 JGI25154J39366_1000819 JGI25154J39366_100081912 297
97 3300003762 Ga0055542_1001105 Ga0055542_10011052 297
98 3300003841 Ga0055541_1006811 Ga0055541_10068112 297
99 3300025224 Ga0209784_100289 Ga0209784_10028924 297
100 3300025225 Ga0209566_100241 Ga0209566_10024122 297
101 3300025226 Ga0209674_100189 Ga0209674_10018944 297
102 3300025246 Ga0209646_1000119 Ga0209646_100011934 297
103 3300025250 Ga0209026_1001633 Ga0209026_10016337 297
104 3300025253 Ga0209677_110587 Ga0209677_1105871 297
105 3300025254 Ga0209148_1000166 Ga0209148_100016696 297
106 3300025256 Ga0209759_1000872 Ga0209759_100087220 297
107 3300041407 Ga0439447_001733 Ga0439447_001733_1800_2711 297
108 3300046463 Ga0495653_0000560 Ga0495653_0000560_15392_16303 297
109 3300046520 Ga0495637_0000501 Ga0495637_0000501_24256_25167 297
110 3300046524 Ga0495648_0000712 Ga0495648_0000712_22109_23014 297
111 3300046665 Ga0495661_0050462 Ga0495661_0050462_1234_2139 297
112 3300046694 Ga0495649_0001459 Ga0495649_0001459_7776_8687 297
113 3300048925 Ga0496122_0001078 Ga0496122_0001078_11330_12241 297
114 3300048928 Ga0496125_0247312 Ga0496125_0247312_107_1018 297
115 3300003751 Ga0055538_1000344 Ga0055538_100034421 298
116 3300003841 Ga0055541_1000125 Ga0055541_100012530 298
117 3300005288 Ga0065714_10002363 Ga0065714_100023632 298
118 3300006944 Ga0099823_1012610 Ga0099823_10126103 298
119 3300013306 Ga0163162_10000749 Ga0163162_100007496 298
120 3300013308 Ga0157375_10000600 Ga0157375_1000060018 298
121 3300014497 Ga0182008_10003365 Ga0182008_100033656 298
122 3300015262 Ga0182007_10000217 Ga0182007_1000021723 298
123 3300015262 Ga0182007_10000707 Ga0182007_1000070710 298
124 3300015262 Ga0182007_10002514 Ga0182007_100025148 298
125 3300025224 Ga0209784_100162 Ga0209784_10016223 298
126 3300025225 Ga0209566_100225 Ga0209566_10022527 298
127 3300025226 Ga0209674_100774 Ga0209674_1007746 298
128 3300025728 Ga0207655_1000319 Ga0207655_100031922 298
129 3300027296 Ga0209389_1030837 Ga0209389_10308376 298
130 3300041407 Ga0439447_000087 Ga0439447_000087_20652_21572 298
131 3300042006 Ga0439432_000018 Ga0439432_000018_23374_24291 298
132 3300042010 Ga0439452_000289 Ga0439452_000289_20662_21582 298
133 3300042139 Ga0450904_000974 Ga0450904_000974_305_1225 298
134 3300046453 Ga0495627_003243 Ga0495627_003243_101_1021 298
135 3300046463 Ga0495653_0000200 Ga0495653_0000200_34631_35551 298
136 3300046491 Ga0495584_0000068 Ga0495584_0000068_58922_59842 298
137 3300046491 Ga0495584_0000222 Ga0495584_0000222_22581_23501 298
138 3300046506 Ga0495583_0000181 Ga0495583_0000181_93038_93958 298
139 3300046512 Ga0495610_0008780 Ga0495610_0008780_2853_3773 298
140 3300046512 Ga0495610_0042732 Ga0495610_0042732_940_1860 298
141 3300046512 Ga0495610_0064006 Ga0495610_0064006_732_1652 298
142 3300046518 Ga0495631_0000138 Ga0495631_0000138_27221_28141 298
143 3300046519 Ga0495632_0000713 Ga0495632_0000713_20601_21521 298
144 3300046519 Ga0495632_0001709 Ga0495632_0001709_3899_4819 298
145 3300046524 Ga0495648_0000660 Ga0495648_0000660_26720_27640 298
146 3300046524 Ga0495648_0022181 Ga0495648_0022181_1191_2111 298
147 3300046542 Ga0495597_0000151 Ga0495597_0000151_14854_15774 298
148 3300046542 Ga0495597_0000871 Ga0495597_0000871_9862_10788 298
149 3300046542 Ga0495597_0016151 Ga0495597_0016151_1194_2120 298
150 3300046557 Ga0495622_0040101 Ga0495622_0040101_383_1303 298
151 3300046660 Ga0495625_0001151 Ga0495625_0001151_9231_10151 298
152 3300046665 Ga0495661_0000044 Ga0495661_0000044_52887_53807 298
153 3300046665 Ga0495661_0037632 Ga0495661_0037632_1092_2012 298
154 3300046694 Ga0495649_0009525 Ga0495649_0009525_276_1196 298
155 3300046810 Ga0495660_0000093 Ga0495660_0000093_43120_44040 298
156 3300046810 Ga0495660_0000317 Ga0495660_0000317_906_1826 298
157 3300047320 Ga0495672_0000482 Ga0495672_0000482_30357_31277 298
158 3300047320 Ga0495672_0010436 Ga0495672_0010436_20_940 298
159 3300047469 Ga0495673_0001527 Ga0495673_0001527_12560_13486 298
160 3300047469 Ga0495673_0001544 Ga0495673_0001544_8387_9307 298
161 3300047470 Ga0495681_0007686 Ga0495681_0007686_5501_6421 298
162 3300047470 Ga0495681_0045809 Ga0495681_0045809_956_1876 298
163 3300048091 Ga0495626_0000789 Ga0495626_0000789_8991_9911 298
164 3300048091 Ga0495626_0022068 Ga0495626_0022068_577_1497 298
165 3300048928 Ga0496125_0002949 Ga0496125_0002949_11178_12104 298
166 3300009545 Ga0105237_10003959 Ga0105237_100039597 299
167 3300011119 Ga0105246_10005811 Ga0105246_100058119 299
168 3300013100 Ga0157373_10001351 Ga0157373_1000135110 299
169 3300021361 Ga0213872_10002538 Ga0213872_100025387 299
170 3300025728 Ga0207655_1028818 Ga0207655_10288184 299
171 3300025914 Ga0207671_10000060 Ga0207671_10000060104 299
172 3300042013 Ga0439456_000169 Ga0439456_000169_18101_19024 299
173 3300044658 Ga0466972_0018043 Ga0466972_0018043_1297_2211 299
174 3300044684 Ga0466966_0012370 Ga0466966_0012370_991_1905 299
175 3300045049 Ga0466959_0164793 Ga0466959_0164793_402_1316 299
176 3300046458 Ga0495591_003226 Ga0495591_003226_4125_5048 299
177 3300046501 Ga0495607_0000084 Ga0495607_0000084_42368_43291 299
178 3300046512 Ga0495610_0000755 Ga0495610_0000755_6751_7674 299
179 3300046519 Ga0495632_0027219 Ga0495632_0027219_1687_2610 299
180 3300046520 Ga0495637_0000038 Ga0495637_0000038_50675_51598 299
181 3300046524 Ga0495648_0000728 Ga0495648_0000728_11418_12335 299
182 3300046530 Ga0495654_0020510 Ga0495654_0020510_2090_3013 299
183 3300046642 Ga0495634_0113556 Ga0495634_0113556_810_1727 299
184 3300046660 Ga0495625_0003149 Ga0495625_0003149_13543_14463 299
185 3300046692 Ga0495671_0008008 Ga0495671_0008008_2354_3277 299
186 3300046694 Ga0495649_0042461 Ga0495649_0042461_1200_2117 299
187 3300047319 Ga0495674_0001611 Ga0495674_0001611_972_1889 299
188 3300047469 Ga0495673_0000503 Ga0495673_0000503_28319_29242 299
189 3300048088 Ga0495602_0000809 Ga0495602_0000809_20239_21156 299
190 3300049460 Ga0495682_0000131 Ga0495682_0000131_13639_14562 299
191 3300061719 Ga0466962_0046789 Ga0466962_0046789_690_1604 299
192 3300001989 JGI24739J22299_10001012 JGI24739J22299_100010128 300
193 3300025299 Ga0209256_1001408 Ga0209256_10014083 300
194 3300025913 Ga0207695_10003439 Ga0207695_1000343918 300
195 3300025949 Ga0207667_10015272 Ga0207667_100152728 300
196 3300028800 Ga0265338_10000239 Ga0265338_1000023933 300
197 3300044693 Ga0466961_0000730 Ga0466961_0000730_14132_15049 300
198 3300046472 Ga0495580_0006196 Ga0495580_0006196_1397_2353 300
199 3300046472 Ga0495580_0013187 Ga0495580_0013187_1621_2547 300
200 3300046531 Ga0495665_0176123 Ga0495665_0176123_26_952 300
201 3300048089 Ga0495614_0004142 Ga0495614_0004142_2017_2943 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18897

Gp3-like

Recombination directionality factor-like

8

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1d-assembly1.cif.gz_D complex structure of the bovine perk luminal domain and its substrate peptide 0.4668 80 143
4z9c-assembly1.cif.gz_F ecpltab oxidized 0.458 126 210
7v6s-assembly2.cif.gz_B crystal structure of bacterial peptidase 0.454 81 120
6xu8-assembly1.cif.gz_Cd drosophila melanogaster ovary 80s ribosome 0.3955 180 214
2jdd-assembly1.cif.gz_A glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate 0.3926 180 232
ID Description Score Start End Superfamily
5gttA01 Alpha Beta;Alpha-Beta Complex;Toxin ADP-ribosyltransferase; Chain A, domain 1;Toxin ADP-ribosyltransferase; Chain A, domain 1 0.6621 182 207 3.90.176.10
af_Q13045_488_612_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.4686 181 232 3.40.20.10
af_O61206_316_394_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4125 181 207 3.30.200.20
1fn9A01 Alpha Beta;Alpha-Beta Complex;Outer-capsid protein sigma 3, small lobe;Outer-capsid protein sigma 3, small lobe 0.4112 84 114 3.90.1630.10
af_A0A0R0L6S4_8_83_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.4072 182 232 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4S8ENV1-F1-model_v4 Phage capsid protein 0.8392 77 178
AF-F2LGZ4-F1-model_v4 Uncharacterized protein 0.8292 114 252
AF-F2LGZ4-F1-model_v4 Uncharacterized protein 0.8237 114 252
AF-A0A1D9D349-F1-model_v4 Hydrolase or metal-binding protein 0.8083 21 245
AF-A0A8B5UUK2-F1-model_v4 deleted 0.8004 9 243

Feature Viewer

pLDDT pTM Quality
62.48 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map