F309205

General Info

Members Datasets Scaffolds Average Seq Length
201 111 402 134

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939664404|2939664434
Length 152
Sequence EQIVAGKEMINCYFCCMVPVKEDILKAVSFKTSRSGGKGGQNVNKVSSKVELIFHLANADFFDEQQKTLLRERLAGRLDQEGNLHVVSQEDRSQLLNKEKTIAKLIALLKSALHVQKKRKPTKVPKAIIRKRLADKQSVAQKKESRRKPQVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
14 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
24 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
47 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
48 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
49 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
53 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
54 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
55 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
56 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
57 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
58 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
59 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
64 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
65 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
66 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
67 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
68 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
69 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
70 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
71 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
72 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
73 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
74 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
75 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
76 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
77 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
78 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
79 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
80 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
81 2738541283 Pedobacter sp. OK701 Isolate Unclassified
82 2738541284 Pedobacter sp. YR016 Isolate Unclassified
83 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
84 2738541302 Pedobacter sp. CF074 Isolate Unclassified
85 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
86 2738543023 Pedobacter sp. OK628 Isolate Unclassified
87 2739367651 Pedobacter sp. OK291 Isolate Unclassified
88 2739367656 Pedobacter sp. CF523 Isolate Unclassified
89 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
90 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
91 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
92 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
93 2818991437 Pedobacter terrae 518 Isolate Unclassified
94 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
95 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
96 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
97 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
98 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
99 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
100 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
101 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
102 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
103 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
104 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
105 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
106 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
107 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
108 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
109 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
110 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
111 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.59
Metatranscriptomes 0
Isolates 18.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0
Rhizoplane 1.99
Rhizosphere 71.64
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1283784 2162886007 Bacteria 1715
2 SwRhRL2b_contig_235932 2162886007 Bacteria 2224
3 SwRhRL2b_contig_2360950 2162886007 Bacteria 2836
4 SwRhRL2b_contig_3708819 2162886007 Bacteria 9197
5 JGI25152J39213_1000160 3300002773 Bacteria 45741
6 JGI25150J39212_1000002 3300002774 Bacteria 537631
7 JGI25151J46595_10000003 3300003187 Bacteria 715330
8 JGI25153J46596_10000003 3300003215 Bacteria 553253
9 Ga0055530_10002693 3300003791 Bacteria 11059
10 Ga0065714_10002536 3300005288 Bacteria 20360
11 Ga0065714_10002974 3300005288 Bacteria 16891
12 Ga0065714_10064993 3300005288 Bacteria 14329
13 Ga0065714_10122845 3300005288 Bacteria 1328
14 Ga0065714_10341763 3300005288 Bacteria 645
15 Ga0065704_10070358 3300005289 Bacteria 30366
16 Ga0065704_10072726 3300005289 Bacteria 8091
17 Ga0065704_10079018 3300005289 Bacteria 4280
18 Ga0065704_10081542 3300005289 Bacteria 3742
19 Ga0065704_10088379 3300005289 Bacteria 2944
20 Ga0065704_10174391 3300005289 Bacteria 1272
21 Ga0065704_10509657 3300005289 Bacteria 661
22 Ga0065715_10823415 3300005293 Bacteria 601
23 Ga0070693_100016008 3300005547 Bacteria 3874
24 Ga0105244_10059354 3300009036 Bacteria 1928
25 Ga0105237_10003157 3300009545 Bacteria 19816
26 Ga0157373_10000026 3300013100 Bacteria 139930
27 Ga0157373_10001010 3300013100 Bacteria 21720
28 Ga0157373_10060689 3300013100 Bacteria 2678
29 Ga0157371_10001945 3300013102 Bacteria 20538
30 Ga0157371_10003231 3300013102 Bacteria 14955
31 Ga0157371_10006449 3300013102 Bacteria 9674
32 Ga0157370_10001636 3300013104 Bacteria 27645
33 Ga0157370_10006381 3300013104 Bacteria 13014
34 Ga0157370_10006465 3300013104 Bacteria 12923
35 Ga0157370_10009076 3300013104 Bacteria 10664
36 Ga0157370_10010549 3300013104 Bacteria 9730
37 Ga0157370_10016108 3300013104 Bacteria 7578
38 Ga0157370_10026288 3300013104 Bacteria 5749
39 Ga0157370_10041735 3300013104 Bacteria 4423
40 Ga0157370_10099097 3300013104 Bacteria 2732
41 Ga0157370_10235881 3300013104 Bacteria 1693
42 Ga0157370_10312876 3300013104 Bacteria 1449
43 Ga0157370_10320905 3300013104 Bacteria 1429
44 Ga0157370_11578892 3300013104 Bacteria 590
45 Ga0157369_10000441 3300013105 Bacteria 55264
46 Ga0157369_10279306 3300013105 Bacteria 1739
47 Ga0163162_10001751 3300013306 Bacteria 20347
48 Ga0163162_10088167 3300013306 Bacteria 3182
49 Ga0182008_10000017 3300014497 Bacteria 235130
50 Ga0182008_10000043 3300014497 Bacteria 117076
51 Ga0182008_10000934 3300014497 Bacteria 20353
52 Ga0182008_10031329 3300014497 Bacteria 2677
53 Ga0182008_10265384 3300014497 Bacteria 889
54 Ga0182008_10756915 3300014497 Bacteria 560
55 Ga0182006_1000128 3300015261 Bacteria 81425
56 Ga0182006_1001058 3300015261 Bacteria 17753
57 Ga0182006_1002456 3300015261 Bacteria 10130
58 Ga0182006_1026274 3300015261 Bacteria 2384
59 Ga0182007_10000054 3300015262 Bacteria 91906
60 Ga0182007_10085987 3300015262 Bacteria 1033
61 Ga0182007_10358020 3300015262 Bacteria 549
62 Ga0183373_1015 3300015682 Bacteria 63862
63 Ga0163161_10001077 3300017792 Bacteria 20663
64 Ga0163161_10001415 3300017792 Bacteria 17712
65 Ga0163161_10003355 3300017792 Bacteria 11229
66 Ga0163161_10021844 3300017792 Bacteria 4501
67 Ga0163161_10022451 3300017792 Bacteria 4445
68 Ga0163161_10030045 3300017792 Bacteria 3865
69 Ga0163161_10109805 3300017792 Bacteria 2061
70 Ga0163161_10169846 3300017792 Bacteria 1667
71 Ga0163161_10278976 3300017792 Bacteria 1310
72 Ga0163161_10951727 3300017792 Bacteria 730
73 Ga0207425_1000004 3300025245 Bacteria 1092421
74 Ga0209129_1000005 3300025258 Bacteria 777812
75 Ga0209676_1000058 3300025292 Bacteria 345185
76 Ga0209025_1000009 3300025294 Bacteria 1092561
77 Ga0209758_1000010 3300025297 Bacteria 1092782
78 Ga0209050_1000054 3300025298 Bacteria 345186
79 Ga0207655_1101838 3300025728 Bacteria 987
80 Ga0207671_10055827 3300025914 Bacteria 2926
81 Ga0307515_10159200 3300028794 Bacteria 2313
82 Ga0316179_1086875 3300030734 Bacteria 743
83 Ga0307408_101458769 3300031548 Bacteria 646
84 Ga0307405_10000001 3300031731 Bacteria 1731270
85 Ga0307405_10000481 3300031731 Bacteria 14975
86 Ga0307405_10859263 3300031731 Bacteria 764
87 Ga0307413_10001327 3300031824 Bacteria 9234
88 Ga0307413_10427078 3300031824 Bacteria 1045
89 Ga0307410_10000087 3300031852 Bacteria 30911
90 Ga0307410_11416115 3300031852 Bacteria 610
91 Ga0307406_10000053 3300031901 Bacteria 63933
92 Ga0307406_10022341 3300031901 Bacteria 3752
93 Ga0307407_10000041 3300031903 Bacteria 65180
94 Ga0307407_10001370 3300031903 Bacteria 8782
95 Ga0307412_10000142 3300031911 Bacteria 51770
96 Ga0307412_10206739 3300031911 Unclassified 1495
97 Ga0307412_10529909 3300031911 Bacteria 986
98 Ga0307412_10565215 3300031911 Bacteria 957
99 Ga0307412_12026973 3300031911 Unclassified 533
100 Ga0307409_100438373 3300031995 Bacteria 1258
101 Ga0307416_100000029 3300032002 Bacteria 164815
102 Ga0307414_10000314 3300032004 Bacteria 27951
103 Ga0307414_10000504 3300032004 Bacteria 20317
104 Ga0307414_10001436 3300032004 Bacteria 12368
105 Ga0307414_10010514 3300032004 Bacteria 5376
106 Ga0307414_10011359 3300032004 Bacteria 5218
107 Ga0307414_10011832 3300032004 Bacteria 5137
108 Ga0307414_10071583 3300032004 Bacteria 2501
109 Ga0307414_10160674 3300032004 Bacteria 1784
110 Ga0307414_10273534 3300032004 Bacteria 1416
111 Ga0307414_10299044 3300032004 Bacteria 1360
112 Ga0307414_10331386 3300032004 Bacteria 1299
113 Ga0307414_10384994 3300032004 Bacteria 1214
114 Ga0307414_10538261 3300032004 Bacteria 1039
115 Ga0307414_10987618 3300032004 Bacteria 774
116 Ga0307411_10000002 3300032005 Bacteria 534807
117 Ga0307411_10042362 3300032005 Bacteria 2904
118 Ga0307510_10010426 3300033180 Bacteria 11037
119 Ga0316574_0146623 3300035398 Bacteria 1521
120 Ga0316574_0789158 3300035398 Bacteria 579
121 Ga0439447_000226 3300041407 Bacteria 19887
122 Ga0439466_0001613 3300041411 Bacteria 8804
123 Ga0439466_0123911 3300041411 Bacteria 797
124 Ga0451807_0598672 3300041486 Bacteria 1066
125 Ga0451807_2360370 3300041486 Bacteria 715
126 Ga0451843_0628331 3300041509 Bacteria 1446
127 Ga0453684_0182525 3300044712 Unclassified 2462
128 Ga0495627_000942 3300046453 Bacteria 20011
129 Ga0495627_033327 3300046453 Bacteria 1615
130 Ga0495607_0044733 3300046501 Bacteria 2608
131 Ga0495606_0013581 3300046507 Bacteria 6423
132 Ga0495606_0014575 3300046507 Bacteria 6119
133 Ga0495606_0137782 3300046507 Bacteria 1444
134 Ga0495610_0000093 3300046512 Bacteria 105873
135 Ga0495610_0002547 3300046512 Bacteria 15174
136 Ga0495610_0102267 3300046512 Bacteria 1282
137 Ga0495610_0297040 3300046512 Bacteria 624
138 Ga0495632_0220838 3300046519 Bacteria 857
139 Ga0495643_0000316 3300046522 Bacteria 66852
140 Ga0495625_0016281 3300046660 Bacteria 5856
141 Ga0495625_0385933 3300046660 Bacteria 878
142 Ga0496115_0003933 3300048918 Bacteria 10706
143 Ga0496115_0164488 3300048918 Bacteria 1835
144 Ga0496122_0000479 3300048925 Bacteria 83186
145 Ga0496124_0545191 3300048927 Bacteria 767
146 Ga0496125_0000024 3300048928 Bacteria 442149
147 Ga0496125_0085272 3300048928 Bacteria 2394
148 Ga0496125_0137729 3300048928 Bacteria 1704
149 Ga0496126_0010876 3300048929 Bacteria 9482
150 Ga0496126_0202222 3300048929 Bacteria 1677
151 Ga0501238_000177 3300049671 Bacteria 9522
152 Ga0501249_000519 3300049679 Bacteria 9340
153 Ga0501241_012950 3300049758 Bacteria 1514
154 Ga0501266_000001 3300049763 Bacteria 562004
155 Ga0501269_001874 3300049766 Bacteria 2658
156 Ga0501280_000315 3300049776 Bacteria 12164
157 Ga0500646_0021109 3300053090 Bacteria 1734
158 Ga0500646_0183829 3300053090 Bacteria 710
159 Ga0500651_0000280 3300053093 Bacteria 29979
160 Ga0500566_0218206 3300053094 Bacteria 950
161 Ga0500641_0000046 3300053096 Bacteria 60650
162 Ga0500641_0000060 3300053096 Bacteria 46714
163 Ga0500658_0000001 3300053134 Bacteria 592738
164 Ga0500559_0028733 3300053136 Bacteria 2377
165 2939664434 2939664404 Bacteria 6364494
166 2513233078 2513020052 Bacteria 5120511
167 2586210493 2585427687 Bacteria 5544917
168 2644371786 2643221667 Bacteria 5627472
169 2644684319 2643221725 Bacteria 5087956
170 2738734946 2738541279 Bacteria 6149495
171 2738758040 2738541283 Bacteria 7222293
172 2738763758 2738541284 Bacteria 5199923
173 2738769089 2738541285 Bacteria 6150075
174 2738852327 2738541302 Bacteria 5944758
175 2739216528 2738543007 Bacteria 6149845
176 2739304473 2738543023 Bacteria 6767879
177 2739589783 2739367651 Bacteria 6359826
178 2739617925 2739367656 Bacteria 5152243
179 2739999824 2739367857 Bacteria 5433684
180 2740004640 2739367858 Bacteria 5432813
181 2776614895 2775506987 Bacteria 5373360
182 2802651789 2802428842 Bacteria 4926114
183 2819550303 2818991437 Bacteria 5805520
184 2833641346 2833640130 Bacteria 4858325
185 2842914590 2842909656 Bacteria 6185908
186 2849287081 2849281842 Bacteria 6065644
187 2852630012 2852627209 Bacteria 5896285
188 2857615362 2857613821 Bacteria 4917088
189 2857622831 2857618242 Bacteria 5635925
190 2857632360 2857627736 Bacteria 5625397
191 2881250499 2881247448 Bacteria 3717788
192 2904449404 2904445276 Bacteria 5310396
193 2919188299 2919186247 Bacteria 6244071
194 2919512893 2919509842 Bacteria 4104664
195 2919683679 2919683626 Bacteria 5534354
196 2929151800 2929150217 Bacteria 5462483
197 2945999442 2945997725 Bacteria 6404843
198 2954016173 2954016120 Bacteria 6446024
199 2958515832 2958512119 Bacteria 4528530
200 2977268529 2977268062 Bacteria 5243061
201 8036737238 8036736890 Bacteria 2944828
202 SwRhRL2b_contig_1283784
203 SwRhRL2b_contig_235932
204 SwRhRL2b_contig_2360950
205 SwRhRL2b_contig_3708819
206 JGI25152J39213_1000160
207 JGI25150J39212_1000002
208 JGI25151J46595_10000003
209 JGI25153J46596_10000003
210 Ga0055530_10002693
211 Ga0065714_10002536
212 Ga0065714_10002974
213 Ga0065714_10064993
214 Ga0065714_10122845
215 Ga0065714_10341763
216 Ga0065704_10070358
217 Ga0065704_10072726
218 Ga0065704_10079018
219 Ga0065704_10081542
220 Ga0065704_10088379
221 Ga0065704_10174391
222 Ga0065704_10509657
223 Ga0065715_10823415
224 Ga0070693_100016008
225 Ga0105244_10059354
226 Ga0105237_10003157
227 Ga0157373_10000026
228 Ga0157373_10001010
229 Ga0157373_10060689
230 Ga0157371_10001945
231 Ga0157371_10003231
232 Ga0157371_10006449
233 Ga0157370_10001636
234 Ga0157370_10006381
235 Ga0157370_10006465
236 Ga0157370_10009076
237 Ga0157370_10010549
238 Ga0157370_10016108
239 Ga0157370_10026288
240 Ga0157370_10041735
241 Ga0157370_10099097
242 Ga0157370_10235881
243 Ga0157370_10312876
244 Ga0157370_10320905
245 Ga0157370_11578892
246 Ga0157369_10000441
247 Ga0157369_10279306
248 Ga0163162_10001751
249 Ga0163162_10088167
250 Ga0182008_10000017
251 Ga0182008_10000043
252 Ga0182008_10000934
253 Ga0182008_10031329
254 Ga0182008_10265384
255 Ga0182008_10756915
256 Ga0182006_1000128
257 Ga0182006_1001058
258 Ga0182006_1002456
259 Ga0182006_1026274
260 Ga0182007_10000054
261 Ga0182007_10085987
262 Ga0182007_10358020
263 Ga0183373_1015
264 Ga0163161_10001077
265 Ga0163161_10001415
266 Ga0163161_10003355
267 Ga0163161_10021844
268 Ga0163161_10022451
269 Ga0163161_10030045
270 Ga0163161_10109805
271 Ga0163161_10169846
272 Ga0163161_10278976
273 Ga0163161_10951727
274 Ga0207425_1000004
275 Ga0209129_1000005
276 Ga0209676_1000058
277 Ga0209025_1000009
278 Ga0209758_1000010
279 Ga0209050_1000054
280 Ga0207655_1101838
281 Ga0207671_10055827
282 Ga0307515_10159200
283 Ga0316179_1086875
284 Ga0307408_101458769
285 Ga0307405_10000001
286 Ga0307405_10000481
287 Ga0307405_10859263
288 Ga0307413_10001327
289 Ga0307413_10427078
290 Ga0307410_10000087
291 Ga0307410_11416115
292 Ga0307406_10000053
293 Ga0307406_10022341
294 Ga0307407_10000041
295 Ga0307407_10001370
296 Ga0307412_10000142
297 Ga0307412_10206739
298 Ga0307412_10529909
299 Ga0307412_10565215
300 Ga0307412_12026973
301 Ga0307409_100438373
302 Ga0307416_100000029
303 Ga0307414_10000314
304 Ga0307414_10000504
305 Ga0307414_10001436
306 Ga0307414_10010514
307 Ga0307414_10011359
308 Ga0307414_10011832
309 Ga0307414_10071583
310 Ga0307414_10160674
311 Ga0307414_10273534
312 Ga0307414_10299044
313 Ga0307414_10331386
314 Ga0307414_10384994
315 Ga0307414_10538261
316 Ga0307414_10987618
317 Ga0307411_10000002
318 Ga0307411_10042362
319 Ga0307510_10010426
320 Ga0316574_0146623
321 Ga0316574_0789158
322 Ga0439447_000226
323 Ga0439466_0001613
324 Ga0439466_0123911
325 Ga0451807_0598672
326 Ga0451807_2360370
327 Ga0451843_0628331
328 Ga0453684_0182525
329 Ga0495627_000942
330 Ga0495627_033327
331 Ga0495607_0044733
332 Ga0495606_0013581
333 Ga0495606_0014575
334 Ga0495606_0137782
335 Ga0495610_0000093
336 Ga0495610_0002547
337 Ga0495610_0102267
338 Ga0495610_0297040
339 Ga0495632_0220838
340 Ga0495643_0000316
341 Ga0495625_0016281
342 Ga0495625_0385933
343 Ga0496115_0003933
344 Ga0496115_0164488
345 Ga0496122_0000479
346 Ga0496124_0545191
347 Ga0496125_0000024
348 Ga0496125_0085272
349 Ga0496125_0137729
350 Ga0496126_0010876
351 Ga0496126_0202222
352 Ga0501238_000177
353 Ga0501249_000519
354 Ga0501241_012950
355 Ga0501266_000001
356 Ga0501269_001874
357 Ga0501280_000315
358 Ga0500646_0021109
359 Ga0500646_0183829
360 Ga0500651_0000280
361 Ga0500566_0218206
362 Ga0500641_0000046
363 Ga0500641_0000060
364 Ga0500658_0000001
365 Ga0500559_0028733
366 2939664434
367 2513233078
368 2586210493
369 2644371786
370 2644684319
371 2738734946
372 2738758040
373 2738763758
374 2738769089
375 2738852327
376 2739216528
377 2739304473
378 2739589783
379 2739617925
380 2739999824
381 2740004640
382 2776614895
383 2802651789
384 2819550303
385 2833641346
386 2842914590
387 2849287081
388 2852630012
389 2857615362
390 2857622831
391 2857632360
392 2881250499
393 2904449404
394 2919188299
395 2919512893
396 2919683679
397 2929151800
398 2945999442
399 2954016173
400 2958515832
401 2977268529
402 8036737238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

21

151

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8299 1 98
7jt1-assembly1.cif.gz_9 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.8298 34 98
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.8285 9 99
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8215 1 98
2jva-assembly1.cif.gz_A nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211 0.7959 10 100
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8881 37 95 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.85 37 95 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8299 1 98 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8215 1 98 3.30.160.20
2jvaA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7959 10 100 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A0R2VK58-F1-model_v4 Peptide chain release factor 1 0.8881 3 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-B9THS4-F1-model_v4 Immature colon carcinoma transcript, putative 0.8715 9 89 GO:0003747
AF-A0A0R2VK58-F1-model_v4 Peptide chain release factor 1 0.8704 3 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A3D4BK31-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8689 22 110 GO:0004045
GO:0043022
GO:0072344
AF-A0A7X6A8X0-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8677 12 96 GO:0003747
GO:0004045
GO:0043022
GO:0072344

Map