F309986

General Info

Members Datasets Scaffolds Average Seq Length
202 135 404 298

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10067271|Ga0207674_100672713
Length 304
Sequence MNPSAPNQQFQPGAVPAPPQPPVHQGYTPGSAQDAPEAFSFQNGQTLHYQSQHTAPGAQAPAVTVAQATGVPTAPQTRSNPNSTQNTLQIAEVRDGIVIMNDGSYRSVVMVKSINFDLMSPQEQEAVEYSYQGFLNSLYFPIQIFIRSQKVDLQPYIAKLDKIRTEHDNMLLAVLMEDYIGYIDQLSQQTNIMDKRFYVVVPYNPGTEGQKVIAEQHVTINEADLEKAKTELRNRVQAVLAGLMQCGVQGLPLDTQELIELYYDTYNPDTATRQQLKNINDLTADIITKGQGTAPQAHLQRELQ

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
125 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
126 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
127 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
135 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.26
Nodule 0
Rhizoplane 0
Rhizosphere 74.75
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10067271 3300026116 Bacteria 3607
2 JGI24737J22298_10000008 3300001990 Bacteria 59168
3 JGI24735J21928_10000025 3300002067 Bacteria 88931
4 JGI24742J22300_10001214 3300002244 Bacteria 4033
5 rootH2_10324650 3300003320 Bacteria 1657
6 rootL2_10081667 3300003322 Bacteria 11226
7 Ga0070658_10000366 3300005327 Bacteria 39386
8 Ga0070658_10001692 3300005327 Bacteria 18638
9 Ga0070658_10006083 3300005327 Bacteria 9788
10 Ga0070658_10102688 3300005327 Unclassified 2364
11 Ga0070676_10144697 3300005328 Bacteria 1516
12 Ga0070690_100012581 3300005330 Bacteria 4980
13 Ga0068869_100109983 3300005334 Bacteria 2095
14 Ga0070660_100000180 3300005339 Bacteria 41683
15 Ga0070660_100001020 3300005339 Bacteria 18818
16 Ga0070660_100038197 3300005339 Bacteria 3643
17 Ga0070691_10004000 3300005341 Bacteria 6672
18 Ga0070668_100122129 3300005347 Bacteria 2083
19 Ga0070674_100036815 3300005356 Bacteria 3288
20 Ga0070673_100000034 3300005364 Bacteria 59468
21 Ga0070659_100001357 3300005366 Bacteria 17624
22 Ga0070678_100009158 3300005456 Bacteria 5980
23 Ga0070685_10001708 3300005466 Bacteria 11519
24 Ga0070679_100053502 3300005530 Bacteria 4019
25 Ga0070672_100069318 3300005543 Bacteria 2799
26 Ga0070686_100028526 3300005544 Unclassified 3386
27 Ga0070686_100132589 3300005544 Unclassified 1725
28 Ga0068855_100000001 3300005563 Bacteria 818777
29 Ga0068855_100001179 3300005563 Bacteria 32472
30 Ga0068855_100001246 3300005563 Bacteria 31579
31 Ga0068855_100023132 3300005563 Bacteria 7445
32 Ga0068855_100298023 3300005563 Bacteria 1786
33 Ga0070664_100387639 3300005564 Unclassified 1276
34 Ga0068857_100000001 3300005577 Bacteria 254081
35 Ga0068857_100113509 3300005577 Unclassified 2436
36 Ga0068862_100141933 3300005844 Bacteria 2132
37 Ga0081455_10000020 3300005937 Bacteria 172997
38 Ga0075365_10000012 3300006038 Bacteria 82049
39 Ga0075365_10030784 3300006038 Bacteria 3440
40 Ga0075365_10041213 3300006038 Bacteria 3016
41 Ga0075365_10175334 3300006038 Bacteria 1497
42 Ga0075368_10000029 3300006042 Bacteria 33477
43 Ga0075363_100000838 3300006048 Bacteria 10696
44 Ga0075363_100112808 3300006048 Bacteria 1512
45 Ga0075364_10005349 3300006051 Bacteria 7455
46 Ga0075364_10055218 3300006051 Bacteria 2598
47 Ga0075362_10115443 3300006177 Unclassified 1267
48 Ga0075369_10000075 3300006186 Bacteria 25614
49 Ga0075366_10000045 3300006195 Bacteria 44721
50 Ga0075366_10000052 3300006195 Bacteria 41900
51 Ga0075366_10008062 3300006195 Bacteria 5836
52 Ga0097621_100000005 3300006237 Bacteria 143888
53 Ga0075370_10000419 3300006353 Bacteria 15706
54 Ga0075370_10136299 3300006353 Bacteria 1434
55 Ga0068871_100000003 3300006358 Bacteria 141580
56 Ga0075428_100011617 3300006844 Bacteria 9799
57 Ga0075430_100012764 3300006846 Bacteria 7157
58 Ga0105240_10000003 3300009093 Bacteria 1183681
59 Ga0105245_10000001 3300009098 Bacteria 939270
60 Ga0105245_10000007 3300009098 Bacteria 312285
61 Ga0105245_10000660 3300009098 Bacteria 31205
62 Ga0105245_10007643 3300009098 Bacteria 9468
63 Ga0105243_10000001 3300009148 Bacteria 1156578
64 Ga0105241_10000870 3300009174 Bacteria 22897
65 Ga0105242_10000001 3300009176 Bacteria 574039
66 Ga0105242_10246335 3300009176 Bacteria 1609
67 Ga0105248_10194727 3300009177 Unclassified 2284
68 Ga0105238_10154551 3300009551 Unclassified 2269
69 Ga0105238_10172214 3300009551 Bacteria 2141
70 Ga0105239_10005193 3300010375 Bacteria 15322
71 Ga0105239_10041795 3300010375 Bacteria 5024
72 Ga0157369_10000644 3300013105 Bacteria 45058
73 Ga0157369_10023055 3300013105 Bacteria 6939
74 Ga0157369_10469359 3300013105 Unclassified 1303
75 Ga0157374_10000014 3300013296 Bacteria 396846
76 Ga0157374_10000056 3300013296 Bacteria 117163
77 Ga0157374_10278295 3300013296 Bacteria 1652
78 Ga0157378_10207600 3300013297 Bacteria 1856
79 Ga0163162_10113117 3300013306 Bacteria 2813
80 Ga0157377_10122479 3300014745 Bacteria 1578
81 Ga0157376_10000001 3300014969 Bacteria 842910
82 Ga0207647_10007724 3300025904 Bacteria 7741
83 Ga0207645_10007233 3300025907 Bacteria 7860
84 Ga0207645_10144138 3300025907 Bacteria 1552
85 Ga0207705_10000019 3300025909 Bacteria 317770
86 Ga0207705_10000057 3300025909 Bacteria 157369
87 Ga0207705_10000414 3300025909 Bacteria 37511
88 Ga0207705_10001881 3300025909 Bacteria 16469
89 Ga0207705_10025384 3300025909 Bacteria 4230
90 Ga0207654_10000002 3300025911 Bacteria 1460142
91 Ga0207654_10000753 3300025911 Bacteria 17930
92 Ga0207695_10000005 3300025913 Bacteria 1196715
93 Ga0207671_10109670 3300025914 Bacteria 2099
94 Ga0207660_10004227 3300025917 Bacteria 9355
95 Ga0207657_10000265 3300025919 Bacteria 55647
96 Ga0207657_10004115 3300025919 Bacteria 15445
97 Ga0207657_10033613 3300025919 Bacteria 4621
98 Ga0207652_10007904 3300025921 Bacteria 8536
99 Ga0207652_10016305 3300025921 Bacteria 6063
100 Ga0207687_10000001 3300025927 Bacteria 1130810
101 Ga0207687_10000004 3300025927 Bacteria 841177
102 Ga0207687_10000008 3300025927 Bacteria 497738
103 Ga0207687_10000341 3300025927 Bacteria 31215
104 Ga0207687_10004081 3300025927 Bacteria 9792
105 Ga0207690_10000624 3300025932 Bacteria 22901
106 Ga0207686_10000001 3300025934 Bacteria 1169580
107 Ga0207709_10000002 3300025935 Bacteria 1171536
108 Ga0207669_10106258 3300025937 Bacteria 1869
109 Ga0207691_10086939 3300025940 Bacteria 2805
110 Ga0207711_10128681 3300025941 Unclassified 2268
111 Ga0207667_10000003 3300025949 Bacteria 822935
112 Ga0207667_10007868 3300025949 Bacteria 12730
113 Ga0207667_10009544 3300025949 Bacteria 11418
114 Ga0207667_10020013 3300025949 Bacteria 7455
115 Ga0207651_10029252 3300025960 Bacteria 3488
116 Ga0207712_10144446 3300025961 Unclassified 1830
117 Ga0207703_10003686 3300026035 Bacteria 12759
118 Ga0207678_10437711 3300026067 Bacteria 1135
119 Ga0207702_10000001 3300026078 Bacteria 895738
120 Ga0207674_10000021 3300026116 Bacteria 161986
121 Ga0207683_10018239 3300026121 Bacteria 5986
122 Ga0209813_10000003 3300027866 Bacteria 207060
123 Ga0207428_10006527 3300027907 Bacteria 10759
124 Ga0268265_10081804 3300028380 Bacteria 2551
125 Ga0265338_10000168 3300028800 Bacteria 120297
126 Ga0265338_10044645 3300028800 Bacteria 4088
127 Ga0265338_10065018 3300028800 Bacteria 3167
128 Ga0265338_10101530 3300028800 Unclassified 2342
129 Ga0265327_10000025 3300031251 Bacteria 380054
130 Ga0265327_10101615 3300031251 Bacteria 1387
131 Ga0395899_0208729 3300037312 Unclassified 1358
132 Ga0395900_0000245 3300037418 Bacteria 85245
133 Ga0395900_0004101 3300037418 Bacteria 15529
134 Ga0395900_0073700 3300037418 Bacteria 3510
135 Ga0395900_0185640 3300037418 Bacteria 2111
136 Ga0395900_0239419 3300037418 Unclassified 1821
137 Ga0395898_0001455 3300037466 Bacteria 33509
138 Ga0395898_0002155 3300037466 Bacteria 24159
139 Ga0395898_0227111 3300037466 Bacteria 1781
140 Ga0395905_0003991 3300037471 Bacteria 15516
141 Ga0395905_0006598 3300037471 Bacteria 11644
142 Ga0395901_0006173 3300038443 Bacteria 12143
143 Ga0395901_0038455 3300038443 Bacteria 4949
144 Ga0495622_0000008 3300046557 Bacteria 232461
145 Ga0495588_0000357 3300046674 Bacteria 28610
146 Ga0495658_0000826 3300046683 Bacteria 16597
147 Ga0495600_0002858 3300046809 Bacteria 10053
148 Ga0495593_0050737 3300047673 Unclassified 2197
149 Ga0501031_0000342 3300049568 Bacteria 27065
150 Ga0501032_0000553 3300049569 Bacteria 30300
151 Ga0501034_0001898 3300049571 Bacteria 26490
152 Ga0501036_0014054 3300049572 Bacteria 6653
153 Ga0501037_0000215 3300049573 Bacteria 50987
154 Ga0501038_0000201 3300049574 Bacteria 51285
155 Ga0501042_0110905 3300049578 Bacteria 1975
156 Ga0501043_0002217 3300049579 Bacteria 16579
157 Ga0501046_0000085 3300049580 Bacteria 100298
158 Ga0501047_0000252 3300049581 Bacteria 63507
159 Ga0501048_0000002 3300049582 Bacteria 108048
160 Ga0501069_0061828 3300049585 Bacteria 2091
161 Ga0501070_0029365 3300049586 Unclassified 4611
162 Ga0501071_0090941 3300049587 Bacteria 2242
163 Ga0501073_0017260 3300049589 Bacteria 5228
164 Ga0501073_0039709 3300049589 Bacteria 3333
165 Ga0501080_0000007 3300049742 Bacteria 135749
166 Ga0501083_0010699 3300049744 Bacteria 6454
167 Ga0501035_0001818 3300049822 Bacteria 21557
168 Ga0501044_0017694 3300049823 Bacteria 7645
169 nmdc:mga03683_1308_c1 3300050489 Bacteria 7355
170 nmdc:mga03n38_66655_c1 3300050490 Bacteria 1654
171 nmdc:mga00v17_20579_c1 3300050491 Bacteria 3782
172 nmdc:mga00v17_42389_c1 3300050491 Bacteria 2737
173 nmdc:mga00v17_7862_c1 3300050491 Bacteria 5719
174 nmdc:mga0yw44_23771_c1 3300050492 Bacteria 3457
175 nmdc:mga0yw44_263145_c1 3300050492 Unclassified 1150
176 nmdc:mga0yw44_3100_c1 3300050492 Bacteria 7287
177 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
178 nmdc:mga0k408_11_c1 3300050493 Bacteria 130371
179 nmdc:mga0k408_15_c1 3300050493 Bacteria 124193
180 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
181 nmdc:mga0k408_59_c2 3300050493 Bacteria 15469
182 nmdc:mga07m45_59031_c1 3300050496 Bacteria 2170
183 nmdc:mga0qj67_46840_c1 3300050509 Bacteria 3414
184 nmdc:mga08y16_218_c1 3300050511 Bacteria 51574
185 nmdc:mga0sz30_12_c1 3300050516 Bacteria 96867
186 Ga0500610_0000011 3300053079 Bacteria 91172
187 Ga0500643_000009 3300053087 Bacteria 444150
188 Ga0500644_0000874 3300053088 Bacteria 9868
189 Ga0500646_0000093 3300053090 Bacteria 25162
190 Ga0500583_0029296 3300053092 Bacteria 2398
191 Ga0500566_0000001 3300053094 Bacteria 1101031
192 Ga0500650_0000018 3300053098 Bacteria 70093
193 Ga0500555_000002 3300053103 Bacteria 1314346
194 Ga0500562_005398 3300053108 Unclassified 3211
195 Ga0500594_0000001 3300053118 Bacteria 1178472
196 Ga0500614_000001 3300053123 Bacteria 1274484
197 Ga0500652_013454 3300053131 Bacteria 2898
198 Ga0500655_006787 3300053133 Bacteria 2060
199 Ga0500577_0001704 3300053142 Bacteria 5621
200 Ga0500616_0000005 3300053153 Bacteria 961725
201 Ga0500649_000003 3300053722 Bacteria 140482
202 Ga0500611_000918 3300053727 Unclassified 3088
203 Ga0207674_10067271
204 JGI24737J22298_10000008
205 JGI24735J21928_10000025
206 JGI24742J22300_10001214
207 rootH2_10324650
208 rootL2_10081667
209 Ga0070658_10000366
210 Ga0070658_10001692
211 Ga0070658_10006083
212 Ga0070658_10102688
213 Ga0070676_10144697
214 Ga0070690_100012581
215 Ga0068869_100109983
216 Ga0070660_100000180
217 Ga0070660_100001020
218 Ga0070660_100038197
219 Ga0070691_10004000
220 Ga0070668_100122129
221 Ga0070674_100036815
222 Ga0070673_100000034
223 Ga0070659_100001357
224 Ga0070678_100009158
225 Ga0070685_10001708
226 Ga0070679_100053502
227 Ga0070672_100069318
228 Ga0070686_100028526
229 Ga0070686_100132589
230 Ga0068855_100000001
231 Ga0068855_100001179
232 Ga0068855_100001246
233 Ga0068855_100023132
234 Ga0068855_100298023
235 Ga0070664_100387639
236 Ga0068857_100000001
237 Ga0068857_100113509
238 Ga0068862_100141933
239 Ga0081455_10000020
240 Ga0075365_10000012
241 Ga0075365_10030784
242 Ga0075365_10041213
243 Ga0075365_10175334
244 Ga0075368_10000029
245 Ga0075363_100000838
246 Ga0075363_100112808
247 Ga0075364_10005349
248 Ga0075364_10055218
249 Ga0075362_10115443
250 Ga0075369_10000075
251 Ga0075366_10000045
252 Ga0075366_10000052
253 Ga0075366_10008062
254 Ga0097621_100000005
255 Ga0075370_10000419
256 Ga0075370_10136299
257 Ga0068871_100000003
258 Ga0075428_100011617
259 Ga0075430_100012764
260 Ga0105240_10000003
261 Ga0105245_10000001
262 Ga0105245_10000007
263 Ga0105245_10000660
264 Ga0105245_10007643
265 Ga0105243_10000001
266 Ga0105241_10000870
267 Ga0105242_10000001
268 Ga0105242_10246335
269 Ga0105248_10194727
270 Ga0105238_10154551
271 Ga0105238_10172214
272 Ga0105239_10005193
273 Ga0105239_10041795
274 Ga0157369_10000644
275 Ga0157369_10023055
276 Ga0157369_10469359
277 Ga0157374_10000014
278 Ga0157374_10000056
279 Ga0157374_10278295
280 Ga0157378_10207600
281 Ga0163162_10113117
282 Ga0157377_10122479
283 Ga0157376_10000001
284 Ga0207647_10007724
285 Ga0207645_10007233
286 Ga0207645_10144138
287 Ga0207705_10000019
288 Ga0207705_10000057
289 Ga0207705_10000414
290 Ga0207705_10001881
291 Ga0207705_10025384
292 Ga0207654_10000002
293 Ga0207654_10000753
294 Ga0207695_10000005
295 Ga0207671_10109670
296 Ga0207660_10004227
297 Ga0207657_10000265
298 Ga0207657_10004115
299 Ga0207657_10033613
300 Ga0207652_10007904
301 Ga0207652_10016305
302 Ga0207687_10000001
303 Ga0207687_10000004
304 Ga0207687_10000008
305 Ga0207687_10000341
306 Ga0207687_10004081
307 Ga0207690_10000624
308 Ga0207686_10000001
309 Ga0207709_10000002
310 Ga0207669_10106258
311 Ga0207691_10086939
312 Ga0207711_10128681
313 Ga0207667_10000003
314 Ga0207667_10007868
315 Ga0207667_10009544
316 Ga0207667_10020013
317 Ga0207651_10029252
318 Ga0207712_10144446
319 Ga0207703_10003686
320 Ga0207678_10437711
321 Ga0207702_10000001
322 Ga0207674_10000021
323 Ga0207683_10018239
324 Ga0209813_10000003
325 Ga0207428_10006527
326 Ga0268265_10081804
327 Ga0265338_10000168
328 Ga0265338_10044645
329 Ga0265338_10065018
330 Ga0265338_10101530
331 Ga0265327_10000025
332 Ga0265327_10101615
333 Ga0395899_0208729
334 Ga0395900_0000245
335 Ga0395900_0004101
336 Ga0395900_0073700
337 Ga0395900_0185640
338 Ga0395900_0239419
339 Ga0395898_0001455
340 Ga0395898_0002155
341 Ga0395898_0227111
342 Ga0395905_0003991
343 Ga0395905_0006598
344 Ga0395901_0006173
345 Ga0395901_0038455
346 Ga0495622_0000008
347 Ga0495588_0000357
348 Ga0495658_0000826
349 Ga0495600_0002858
350 Ga0495593_0050737
351 Ga0501031_0000342
352 Ga0501032_0000553
353 Ga0501034_0001898
354 Ga0501036_0014054
355 Ga0501037_0000215
356 Ga0501038_0000201
357 Ga0501042_0110905
358 Ga0501043_0002217
359 Ga0501046_0000085
360 Ga0501047_0000252
361 Ga0501048_0000002
362 Ga0501069_0061828
363 Ga0501070_0029365
364 Ga0501071_0090941
365 Ga0501073_0017260
366 Ga0501073_0039709
367 Ga0501080_0000007
368 Ga0501083_0010699
369 Ga0501035_0001818
370 Ga0501044_0017694
371 nmdc:mga03683_1308_c1
372 nmdc:mga03n38_66655_c1
373 nmdc:mga00v17_20579_c1
374 nmdc:mga00v17_42389_c1
375 nmdc:mga00v17_7862_c1
376 nmdc:mga0yw44_23771_c1
377 nmdc:mga0yw44_263145_c1
378 nmdc:mga0yw44_3100_c1
379 nmdc:mga0yw44_7_c1
380 nmdc:mga0k408_11_c1
381 nmdc:mga0k408_15_c1
382 nmdc:mga0k408_1_c1
383 nmdc:mga0k408_59_c2
384 nmdc:mga07m45_59031_c1
385 nmdc:mga0qj67_46840_c1
386 nmdc:mga08y16_218_c1
387 nmdc:mga0sz30_12_c1
388 Ga0500610_0000011
389 Ga0500643_000009
390 Ga0500644_0000874
391 Ga0500646_0000093
392 Ga0500583_0029296
393 Ga0500566_0000001
394 Ga0500650_0000018
395 Ga0500555_000002
396 Ga0500562_005398
397 Ga0500594_0000001
398 Ga0500614_000001
399 Ga0500652_013454
400 Ga0500655_006787
401 Ga0500577_0001704
402 Ga0500616_0000005
403 Ga0500649_000003
404 Ga0500611_000918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o43-assembly1.cif.gz_B trwk/virb4unbound dimer complex from r388 type iv secretion system determined by cryo-em. 0.6431 47 233
7o41-assembly1.cif.gz_A-1 hexameric composite model of the inner membrane complex (imc) with the arches from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.5871 47 227
5w1s-assembly1.cif.gz_D x-ray crystal structure of escherichia coli rna polymerase and trar complex 0.584 106 162
7o41-assembly1.cif.gz_B-1 hexameric composite model of the inner membrane complex (imc) with the arches from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.5745 47 211
7o43-assembly1.cif.gz_A trwk/virb4unbound dimer complex from r388 type iv secretion system determined by cryo-em. 0.5613 40 211
ID Description Score Start End Superfamily
4flyA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.6928 84 145 1.10.287.690
af_Q2G0D9_1_180_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6109 79 146 1.10.287.130
af_Q5RII9_1_78_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5686 75 146 1.20.58.80
4flyA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5613 84 145 1.10.287.690
af_A0A2R8QMD9_132_235_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.5311 76 146 1.20.81.10
ID Description Score Start End GO Terms
AF-A0A2M7HZP4-F1-model_v4 Uncharacterized protein 0.8594 49 162
AF-A0A894KJ70-F1-model_v4 Uncharacterized protein 0.8525 59 243
AF-A0A2M7HZP4-F1-model_v4 Uncharacterized protein 0.8337 49 162
AF-A0A0G0QJ43-F1-model_v4 Uncharacterized protein 0.8176 34 242
AF-A0A1F5K292-F1-model_v4 Uncharacterized protein 0.8172 41 239

Map