F310244

General Info

Members Datasets Scaffolds Average Seq Length
202 81 404 230

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0012288|Ga0451576_0012288_1751_2527
Length 258
Sequence MYLFAQKDTDFTNLMTNQVGDIITSMSKHILLVDDDALMRRSLAFNLEQAGFRASSAANAEDALALARQNPPSLVLLDIGLPGMDGLDAIKRFKEQFHVPVIFVTARRRNLDEVVGLELGADDYITKPFDVDVLIAHIKAVLRRSESSSEAPQPAHASPLKVGDLTLDPAAHTVSVAGRPVELSPKEFSLLHALALEPNRVRSVDDLLASVWGAEFMGQPQVVYVHIRWLREKLETDPEHPKRIMTVRGVGYKLVGGE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
4 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
5 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
6 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
7 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
8 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
12 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
13 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
14 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
19 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
20 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
21 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
22 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
23 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
24 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
25 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
26 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
27 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
28 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
29 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
30 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
31 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
32 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
33 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
36 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
37 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
40 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
45 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
46 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
47 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
48 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
49 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
50 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
51 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
52 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
53 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
56 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
59 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
60 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
61 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
62 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
63 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
64 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
65 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
66 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
69 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
70 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 0.99
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0012288 3300045051 Bacteria 9631
2 Ga0070689_100281362 3300005340 Bacteria 1380
3 Ga0070700_100610927 3300005441 Bacteria 856
4 Ga0070704_100574420 3300005549 Bacteria 988
5 Ga0068859_100278108 3300005617 Bacteria 1766
6 Ga0068862_100268283 3300005844 Bacteria 1560
7 Ga0075429_100363199 3300006880 Bacteria 1268
8 Ga0068865_100047519 3300006881 Bacteria 2950
9 Ga0105245_10100420 3300009098 Bacteria 2676
10 Ga0114129_10070437 3300009147 Bacteria 4876
11 Ga0114129_10198148 3300009147 Bacteria 2722
12 Ga0157374_10011156 3300013296 Bacteria 7767
13 Ga0157374_10215725 3300013296 Bacteria 1882
14 Ga0157379_10167499 3300014968 Bacteria 1983
15 Ga0213875_10081035 3300021388 Bacteria 1514
16 Ga0207687_10186760 3300025927 Bacteria 1610
17 Ga0207703_10406350 3300026035 Bacteria 1264
18 Ga0207648_10249484 3300026089 Bacteria 1582
19 Ga0268265_10122530 3300028380 Bacteria 2145
20 Ga0316575_10018452 3300031665 Bacteria 2660
21 Ga0316575_10037682 3300031665 Bacteria 1905
22 Ga0316575_10040824 3300031665 Bacteria 1834
23 Ga0316575_10041602 3300031665 Bacteria 1818
24 Ga0316575_10105017 3300031665 Bacteria 1150
25 Ga0316579_10000644 3300031691 Bacteria 11847
26 Ga0316579_10025194 3300031691 Bacteria 2684
27 Ga0316579_10096251 3300031691 Bacteria 1415
28 Ga0316579_10114692 3300031691 Bacteria 1293
29 Ga0316579_10176301 3300031691 Bacteria 1033
30 Ga0316579_10213659 3300031691 Bacteria 933
31 Ga0316576_10023200 3300031727 Unclassified 4318
32 Ga0316576_10070854 3300031727 Bacteria 2571
33 Ga0316576_10245490 3300031727 Bacteria 1345
34 Ga0316576_10423595 3300031727 Bacteria 985
35 Ga0316578_10012892 3300031728 Bacteria 4417
36 Ga0316578_10030423 3300031728 Bacteria 3069
37 Ga0316578_10048354 3300031728 Unclassified 2483
38 Ga0316578_10083752 3300031728 Bacteria 1900
39 Ga0316578_10147050 3300031728 Bacteria 1419
40 Ga0316578_10168259 3300031728 Bacteria 1321
41 Ga0316577_10007361 3300031733 Bacteria 5871
42 Ga0316577_10021896 3300031733 Bacteria 3547
43 Ga0316577_10022105 3300031733 Bacteria 3531
44 Ga0316577_10069069 3300031733 Bacteria 1973
45 Ga0316577_10094239 3300031733 Unclassified 1676
46 Ga0316577_10110037 3300031733 Bacteria 1546
47 Ga0316577_10246801 3300031733 Bacteria 1010
48 Ga0316577_10255184 3300031733 Bacteria 992
49 Ga0316577_10256701 3300031733 Bacteria 989
50 Ga0316577_10348180 3300031733 Bacteria 841
51 Ga0316583_10010122 3300032133 Bacteria 3397
52 Ga0316585_10007950 3300032137 Bacteria 3067
53 Ga0316585_10008542 3300032137 Unclassified 2974
54 Ga0316585_10029065 3300032137 Bacteria 1731
55 Ga0316580_10015260 3300032139 Bacteria 2349
56 Ga0316580_10047081 3300032139 Bacteria 1329
57 Ga0373923_0097747 3300035111 Bacteria 1291
58 Ga0373954_0023958 3300035118 Bacteria 2781
59 Ga0373957_0188738 3300035120 Bacteria 856
60 Ga0373955_0013040 3300035172 Bacteria 4009
61 Ga0316574_0009068 3300035398 Bacteria 5559
62 Ga0316574_0022181 3300035398 Bacteria 3779
63 Ga0316574_0022894 3300035398 Bacteria 3725
64 Ga0316574_0176473 3300035398 Bacteria 1375
65 Ga0373924_0006287 3300035410 Bacteria 4249
66 Ga0373927_0004422 3300035695 Bacteria 9847
67 Ga0373947_0007991 3300035725 Bacteria 6101
68 Ga0373937_0046923 3300036401 Bacteria 3951
69 Ga0373937_0238259 3300036401 Bacteria 1714
70 Ga0373937_0573863 3300036401 Bacteria 1071
71 Ga0316582_0002014 3300036647 Bacteria 9330
72 Ga0316582_0008143 3300036647 Bacteria 5618
73 Ga0316582_0010365 3300036647 Bacteria 5101
74 Ga0316582_0053237 3300036647 Bacteria 2574
75 Ga0316582_0054272 3300036647 Bacteria 2551
76 Ga0316582_0059939 3300036647 Bacteria 2439
77 Ga0316582_0075556 3300036647 Bacteria 2189
78 Ga0316582_0253984 3300036647 Bacteria 1205
79 Ga0316582_0260760 3300036647 Bacteria 1188
80 Ga0316582_0396169 3300036647 Bacteria 951
81 Ga0316584_0013394 3300036712 Bacteria 5804
82 Ga0316584_0018767 3300036712 Bacteria 4992
83 Ga0316584_0018792 3300036712 Bacteria 4989
84 Ga0316584_0042640 3300036712 Bacteria 3382
85 Ga0316584_0060811 3300036712 Bacteria 2830
86 Ga0316584_0078988 3300036712 Bacteria 2465
87 Ga0316584_0089634 3300036712 Bacteria 2303
88 Ga0316584_0151848 3300036712 Bacteria 1724
89 Ga0316584_0291677 3300036712 Bacteria 1183
90 Ga0316584_0433243 3300036712 Bacteria 932
91 Ga0316584_0572211 3300036712 Bacteria 786
92 Ga0316581_0003929 3300037588 Bacteria 3748
93 Ga0316581_0028902 3300037588 Bacteria 1663
94 Ga0316581_0041766 3300037588 Bacteria 1398
95 Ga0316581_0089120 3300037588 Bacteria 950
96 Ga0436364_0449996 3300037853 Bacteria 12687
97 Ga0400484_40529 3300038725 Bacteria 1127
98 Ga0400489_31372 3300039093 Bacteria 2596
99 Ga0451577_0001127 3300042876 Bacteria 37913
100 Ga0451577_0091872 3300042876 Bacteria 2710
101 Ga0451577_0115774 3300042876 Bacteria 2400
102 Ga0451577_0350682 3300042876 Bacteria 1339
103 Ga0453683_0377246 3300044673 Bacteria 913
104 Ga0453684_0000003 3300044712 Bacteria 1481694
105 Ga0453684_0000203 3300044712 Bacteria 258635
106 Ga0453684_0000505 3300044712 Bacteria 152407
107 Ga0453684_0001235 3300044712 Bacteria 77963
108 Ga0453684_0023054 3300044712 Bacteria 9196
109 Ga0453684_0029953 3300044712 Bacteria 7705
110 Ga0453684_0094716 3300044712 Bacteria 3672
111 Ga0453684_0164071 3300044712 Bacteria 2625
112 Ga0453684_0178522 3300044712 Bacteria 2495
113 Ga0453684_0229444 3300044712 Bacteria 2144
114 Ga0453684_0330782 3300044712 Bacteria 1723
115 Ga0453684_0518813 3300044712 Bacteria 1317
116 Ga0453684_0661246 3300044712 Bacteria 1139
117 Ga0453684_0702877 3300044712 Bacteria 1098
118 Ga0453684_0742064 3300044712 Bacteria 1063
119 Ga0453684_0824176 3300044712 Bacteria 999
120 Ga0451576_0000073 3300045051 Bacteria 253094
121 Ga0451576_0041174 3300045051 Bacteria 4885
122 Ga0495592_0030654 3300046454 Unclassified 4068
123 Ga0495592_0033891 3300046454 Bacteria 3851
124 Ga0495651_0002060 3300046462 Bacteria 15535
125 Ga0495651_0002690 3300046462 Bacteria 13790
126 Ga0495651_0004224 3300046462 Bacteria 11005
127 Ga0495651_0016088 3300046462 Bacteria 5793
128 Ga0495653_0011903 3300046463 Bacteria 7107
129 Ga0495653_0066639 3300046463 Bacteria 2708
130 Ga0495580_0005758 3300046472 Bacteria 10177
131 Ga0495664_0040002 3300046477 Bacteria 2771
132 Ga0495594_0083771 3300046499 Bacteria 1783
133 Ga0495608_0031441 3300046511 Bacteria 3590
134 Ga0495608_0082861 3300046511 Bacteria 2082
135 Ga0495608_0098192 3300046511 Bacteria 1890
136 Ga0495608_0386214 3300046511 Bacteria 858
137 Ga0495618_0036825 3300046514 Bacteria 3071
138 Ga0495628_0001516 3300046516 Bacteria 21275
139 Ga0495628_0027214 3300046516 Bacteria 4656
140 Ga0495628_0041144 3300046516 Bacteria 3690
141 Ga0495628_0757299 3300046516 Bacteria 682
142 Ga0495630_0005643 3300046517 Bacteria 8840
143 Ga0495630_0021948 3300046517 Bacteria 4715
144 Ga0495630_0154223 3300046517 Bacteria 1748
145 Ga0495630_0557965 3300046517 Bacteria 878
146 Ga0495630_0645761 3300046517 Bacteria 810
147 Ga0495666_0016793 3300046526 Bacteria 3645
148 Ga0495652_0007031 3300046529 Bacteria 10400
149 Ga0495652_0376128 3300046529 Bacteria 1011
150 Ga0495665_0005604 3300046531 Bacteria 6765
151 Ga0495586_0003607 3300046535 Bacteria 8294
152 Ga0495586_0107880 3300046535 Bacteria 1549
153 Ga0495586_0224473 3300046535 Unclassified 1068
154 Ga0495586_0389857 3300046535 Bacteria 801
155 Ga0495587_0004577 3300046536 Bacteria 9087
156 Ga0495598_0005050 3300046537 Bacteria 2901
157 Ga0495645_0009831 3300046543 Bacteria 6692
158 Ga0495645_0071428 3300046543 Unclassified 2503
159 Ga0495667_0004972 3300046559 Bacteria 8990
160 Ga0495667_0010900 3300046559 Bacteria 6146
161 Ga0495667_0030536 3300046559 Bacteria 3621
162 Ga0495667_0066577 3300046559 Bacteria 2355
163 Ga0495635_0031888 3300046663 Unclassified 3657
164 Ga0495635_0043235 3300046663 Bacteria 3109
165 Ga0495657_0064296 3300046675 Bacteria 2417
166 Ga0495657_0091754 3300046675 Unclassified 1947
167 Ga0495657_0121159 3300046675 Bacteria 1647
168 Ga0495599_0020205 3300046678 Unclassified 4149
169 Ga0495599_0090835 3300046678 Bacteria 1905
170 Ga0495623_0062531 3300046679 Bacteria 2333
171 Ga0495646_0003406 3300046680 Bacteria 9880
172 Ga0495646_0151249 3300046680 Bacteria 1291
173 Ga0495613_0072230 3300046689 Bacteria 2515
174 Ga0495613_0149128 3300046689 Bacteria 1669
175 Ga0495613_0389901 3300046689 Bacteria 951
176 Ga0495624_0028802 3300046690 Bacteria 3626
177 Ga0495600_0001331 3300046809 Bacteria 13636
178 Ga0495600_0079149 3300046809 Bacteria 2146
179 Ga0495674_0015484 3300047319 Bacteria 7125
180 Ga0495674_0141200 3300047319 Bacteria 2024
181 Ga0495674_0162465 3300047319 Bacteria 1868
182 Ga0495674_0266897 3300047319 Bacteria 1405
183 Ga0495676_0257943 3300047321 Bacteria 1187
184 Ga0495676_0288764 3300047321 Bacteria 1109
185 Ga0495680_0000985 3300047322 Bacteria 31711
186 Ga0495680_0051873 3300047322 Unclassified 3200
187 Ga0495680_0131476 3300047322 Bacteria 1839
188 Ga0495680_0178868 3300047322 Bacteria 1532
189 Ga0495675_0000011 3300047444 Bacteria 152733
190 Ga0495675_0031884 3300047444 Bacteria 3365
191 Ga0495675_0046137 3300047444 Bacteria 2774
192 Ga0495675_0096235 3300047444 Bacteria 1856
193 Ga0495684_0044136 3300047471 Bacteria 3413
194 Ga0495684_0141123 3300047471 Bacteria 1806
195 Ga0495593_0012748 3300047673 Bacteria 4799
196 Ga0495602_0053662 3300048088 Bacteria 3567
197 Ga0496104_0301449 3300048907 Bacteria 1515
198 Ga0496112_0095884 3300048915 Bacteria 2937
199 nmdc:mga0k408_278151_c1 3300050493 Bacteria 999
200 nmdc:mga05p37_497361_c1 3300050507 Bacteria 1400
201 nmdc:mga05p37_698422_c1 3300050507 Unclassified 1127
202 nmdc:mga0a205_121226_c1 3300050515 Bacteria 2514
203 Ga0451576_0012288
204 Ga0070689_100281362
205 Ga0070700_100610927
206 Ga0070704_100574420
207 Ga0068859_100278108
208 Ga0068862_100268283
209 Ga0075429_100363199
210 Ga0068865_100047519
211 Ga0105245_10100420
212 Ga0114129_10070437
213 Ga0114129_10198148
214 Ga0157374_10011156
215 Ga0157374_10215725
216 Ga0157379_10167499
217 Ga0213875_10081035
218 Ga0207687_10186760
219 Ga0207703_10406350
220 Ga0207648_10249484
221 Ga0268265_10122530
222 Ga0316575_10018452
223 Ga0316575_10037682
224 Ga0316575_10040824
225 Ga0316575_10041602
226 Ga0316575_10105017
227 Ga0316579_10000644
228 Ga0316579_10025194
229 Ga0316579_10096251
230 Ga0316579_10114692
231 Ga0316579_10176301
232 Ga0316579_10213659
233 Ga0316576_10023200
234 Ga0316576_10070854
235 Ga0316576_10245490
236 Ga0316576_10423595
237 Ga0316578_10012892
238 Ga0316578_10030423
239 Ga0316578_10048354
240 Ga0316578_10083752
241 Ga0316578_10147050
242 Ga0316578_10168259
243 Ga0316577_10007361
244 Ga0316577_10021896
245 Ga0316577_10022105
246 Ga0316577_10069069
247 Ga0316577_10094239
248 Ga0316577_10110037
249 Ga0316577_10246801
250 Ga0316577_10255184
251 Ga0316577_10256701
252 Ga0316577_10348180
253 Ga0316583_10010122
254 Ga0316585_10007950
255 Ga0316585_10008542
256 Ga0316585_10029065
257 Ga0316580_10015260
258 Ga0316580_10047081
259 Ga0373923_0097747
260 Ga0373954_0023958
261 Ga0373957_0188738
262 Ga0373955_0013040
263 Ga0316574_0009068
264 Ga0316574_0022181
265 Ga0316574_0022894
266 Ga0316574_0176473
267 Ga0373924_0006287
268 Ga0373927_0004422
269 Ga0373947_0007991
270 Ga0373937_0046923
271 Ga0373937_0238259
272 Ga0373937_0573863
273 Ga0316582_0002014
274 Ga0316582_0008143
275 Ga0316582_0010365
276 Ga0316582_0053237
277 Ga0316582_0054272
278 Ga0316582_0059939
279 Ga0316582_0075556
280 Ga0316582_0253984
281 Ga0316582_0260760
282 Ga0316582_0396169
283 Ga0316584_0013394
284 Ga0316584_0018767
285 Ga0316584_0018792
286 Ga0316584_0042640
287 Ga0316584_0060811
288 Ga0316584_0078988
289 Ga0316584_0089634
290 Ga0316584_0151848
291 Ga0316584_0291677
292 Ga0316584_0433243
293 Ga0316584_0572211
294 Ga0316581_0003929
295 Ga0316581_0028902
296 Ga0316581_0041766
297 Ga0316581_0089120
298 Ga0436364_0449996
299 Ga0400484_40529
300 Ga0400489_31372
301 Ga0451577_0001127
302 Ga0451577_0091872
303 Ga0451577_0115774
304 Ga0451577_0350682
305 Ga0453683_0377246
306 Ga0453684_0000003
307 Ga0453684_0000203
308 Ga0453684_0000505
309 Ga0453684_0001235
310 Ga0453684_0023054
311 Ga0453684_0029953
312 Ga0453684_0094716
313 Ga0453684_0164071
314 Ga0453684_0178522
315 Ga0453684_0229444
316 Ga0453684_0330782
317 Ga0453684_0518813
318 Ga0453684_0661246
319 Ga0453684_0702877
320 Ga0453684_0742064
321 Ga0453684_0824176
322 Ga0451576_0000073
323 Ga0451576_0041174
324 Ga0495592_0030654
325 Ga0495592_0033891
326 Ga0495651_0002060
327 Ga0495651_0002690
328 Ga0495651_0004224
329 Ga0495651_0016088
330 Ga0495653_0011903
331 Ga0495653_0066639
332 Ga0495580_0005758
333 Ga0495664_0040002
334 Ga0495594_0083771
335 Ga0495608_0031441
336 Ga0495608_0082861
337 Ga0495608_0098192
338 Ga0495608_0386214
339 Ga0495618_0036825
340 Ga0495628_0001516
341 Ga0495628_0027214
342 Ga0495628_0041144
343 Ga0495628_0757299
344 Ga0495630_0005643
345 Ga0495630_0021948
346 Ga0495630_0154223
347 Ga0495630_0557965
348 Ga0495630_0645761
349 Ga0495666_0016793
350 Ga0495652_0007031
351 Ga0495652_0376128
352 Ga0495665_0005604
353 Ga0495586_0003607
354 Ga0495586_0107880
355 Ga0495586_0224473
356 Ga0495586_0389857
357 Ga0495587_0004577
358 Ga0495598_0005050
359 Ga0495645_0009831
360 Ga0495645_0071428
361 Ga0495667_0004972
362 Ga0495667_0010900
363 Ga0495667_0030536
364 Ga0495667_0066577
365 Ga0495635_0031888
366 Ga0495635_0043235
367 Ga0495657_0064296
368 Ga0495657_0091754
369 Ga0495657_0121159
370 Ga0495599_0020205
371 Ga0495599_0090835
372 Ga0495623_0062531
373 Ga0495646_0003406
374 Ga0495646_0151249
375 Ga0495613_0072230
376 Ga0495613_0149128
377 Ga0495613_0389901
378 Ga0495624_0028802
379 Ga0495600_0001331
380 Ga0495600_0079149
381 Ga0495674_0015484
382 Ga0495674_0141200
383 Ga0495674_0162465
384 Ga0495674_0266897
385 Ga0495676_0257943
386 Ga0495676_0288764
387 Ga0495680_0000985
388 Ga0495680_0051873
389 Ga0495680_0131476
390 Ga0495680_0178868
391 Ga0495675_0000011
392 Ga0495675_0031884
393 Ga0495675_0046137
394 Ga0495675_0096235
395 Ga0495684_0044136
396 Ga0495684_0141123
397 Ga0495593_0012748
398 Ga0495602_0053662
399 Ga0496104_0301449
400 Ga0496112_0095884
401 nmdc:mga0k408_278151_c1
402 nmdc:mga05p37_497361_c1
403 nmdc:mga05p37_698422_c1
404 nmdc:mga0a205_121226_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

30

139

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

178

254

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9827 1 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9744 1 121
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9714 1 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.969 2 124
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9677 2 121
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9918 1 83 3.40.50.2300
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.984 128 224 1.10.10.10
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9775 1 83 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9714 1 122 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9679 2 121 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y2JMA7-F1-model_v4 DNA-binding response regulator 0.9696 128 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A317JMI3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9672 2 119 GO:0000155
AF-A0A847J0D0-F1-model_v4 Response regulator transcription factor 0.9608 2 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A800AYF3-F1-model_v4 Winged helix family transcriptional regulator 0.9528 124 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2S9GE60-F1-model_v4 DNA-binding response regulator 0.9525 128 211 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map