F310342

General Info

Members Datasets Scaffolds Average Seq Length
202 144 404 273

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0251805|Ga0495602_0251805_155_1048
Length 297
Sequence MLTGVDGSIRVGELPMPASSIPTTTLPSGEAVPRLGQGTWRLGESRRLREEEIGALKLGLGLGMTLIDTAEMYGDGGAEQIVAEVVAGRRDEVFLVSKVLPENSSRAGTIAACERSLKRLHIDRIDLYLLHWRGPYPLKATLAGFQALMDRGLIRSWGVSNFDVDDMEELAALPGGEAVAANQVLYNLARRGIEADLLPWCRDRSIPIMAYSPVDQGRILRNRALANVAARHGATPAQIALAFVLLQEDMMVIPKAVSEAHVRENRAALDITLTEADLAELRHAYPPPRGAQPLEML

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
136 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
137 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
138 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
139 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
140 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
142 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
143 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
144 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.29
Nodule 1.49
Rhizoplane 0.99
Rhizosphere 70.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0251805 3300048088 Bacteria 1316
2 Ga0070676_10114912 3300005328 Bacteria 1681
3 Ga0070660_100004290 3300005339 Bacteria 9850
4 Ga0070688_100220297 3300005365 Bacteria 1337
5 Ga0070713_100026279 3300005436 Bacteria 4568
6 Ga0070708_100511674 3300005445 Bacteria 1132
7 Ga0070678_100022419 3300005456 Bacteria 4185
8 Ga0070707_100409947 3300005468 Bacteria 1315
9 Ga0070698_100000915 3300005471 Bacteria 32284
10 Ga0070698_100632386 3300005471 Bacteria 1011
11 Ga0070696_100098085 3300005546 Bacteria 2096
12 Ga0070665_100108500 3300005548 Bacteria 2778
13 Ga0068860_100089304 3300005843 Bacteria 2934
14 Ga0068862_100131157 3300005844 Bacteria 2217
15 Ga0081455_10000710 3300005937 Bacteria 43255
16 Ga0081455_10127676 3300005937 Bacteria 1993
17 Ga0081539_10006327 3300005985 Bacteria 11429
18 Ga0081539_10007591 3300005985 Bacteria 9800
19 Ga0075365_10021826 3300006038 Bacteria 4000
20 Ga0075365_10215712 3300006038 Bacteria 1346
21 Ga0075365_10288007 3300006038 Bacteria 1156
22 Ga0075368_10023777 3300006042 Bacteria 2344
23 Ga0075363_100078221 3300006048 Bacteria 1805
24 Ga0075363_100087713 3300006048 Bacteria 1709
25 Ga0075432_10034319 3300006058 Bacteria 1762
26 Ga0075362_10037319 3300006177 Bacteria 2129
27 Ga0075362_10062387 3300006177 Bacteria 1688
28 Ga0075362_10114270 3300006177 Bacteria 1273
29 Ga0075362_10151253 3300006177 Bacteria 1113
30 Ga0075367_10009071 3300006178 Bacteria 5181
31 Ga0075367_10171751 3300006178 Bacteria 1350
32 Ga0075367_10189762 3300006178 Bacteria 1282
33 Ga0075369_10001682 3300006186 Bacteria 7634
34 Ga0075369_10063167 3300006186 Bacteria 1619
35 Ga0075366_10053796 3300006195 Bacteria 2391
36 Ga0075370_10027958 3300006353 Bacteria 3132
37 Ga0075370_10030492 3300006353 Bacteria 3009
38 Ga0075370_10149458 3300006353 Bacteria 1369
39 Ga0075430_100001207 3300006846 Bacteria 20784
40 Ga0099794_10056722 3300007265 Bacteria 1896
41 Ga0105240_10251162 3300009093 Bacteria 2045
42 Ga0111539_10457617 3300009094 Bacteria 1486
43 Ga0111539_10531692 3300009094 Bacteria 1370
44 Ga0114129_10242706 3300009147 Bacteria 2421
45 Ga0105242_10442510 3300009176 Bacteria 1223
46 Ga0105249_10132348 3300009553 Bacteria 2382
47 Ga0105239_10055602 3300010375 Bacteria 4340
48 Ga0163162_10225687 3300013306 Bacteria 2003
49 Ga0157375_10249517 3300013308 Bacteria 1936
50 Ga0213873_10071470 3300021358 Bacteria 957
51 Ga0213875_10022768 3300021388 Bacteria 2996
52 Ga0213871_10005047 3300021441 Bacteria 2694
53 Ga0207426_1016788 3300025302 Bacteria 2616
54 Ga0207662_10108650 3300025918 Bacteria 1727
55 Ga0207659_10199235 3300025926 Bacteria 1598
56 Ga0207700_10078589 3300025928 Bacteria 2567
57 Ga0207669_10165507 3300025937 Bacteria 1568
58 Ga0207703_10134427 3300026035 Bacteria 2139
59 Ga0207639_10377188 3300026041 Bacteria 1273
60 Ga0207675_100332683 3300026118 Bacteria 1485
61 Ga0207683_10028556 3300026121 Bacteria 4824
62 Ga0209813_10019114 3300027866 Bacteria 1901
63 Ga0209813_10027784 3300027866 Bacteria 1645
64 Ga0207428_10268630 3300027907 Bacteria 1269
65 Ga0268266_10013774 3300028379 Bacteria 6963
66 Ga0268266_10204087 3300028379 Bacteria 1810
67 Ga0268266_10340436 3300028379 Bacteria 1408
68 Ga0268265_10314391 3300028380 Bacteria 1416
69 Ga0265334_10001215 3300028573 Bacteria 12600
70 Ga0307405_10136080 3300031731 Bacteria 1706
71 Ga0307410_10675206 3300031852 Bacteria 869
72 Ga0307416_100272556 3300032002 Bacteria 1663
73 Ga0373935_0194391 3300035692 Bacteria 1399
74 Ga0373947_0011276 3300035725 Bacteria 5129
75 Ga0373937_0205698 3300036401 Bacteria 1851
76 Ga0373937_0444460 3300036401 Bacteria 1231
77 Ga0373937_0727398 3300036401 Bacteria 939
78 Ga0373925_0030487 3300037068 Bacteria 3959
79 Ga0373925_0055484 3300037068 Bacteria 2966
80 Ga0373925_0187926 3300037068 Bacteria 1638
81 Ga0373925_0518153 3300037068 Bacteria 980
82 Ga0436364_0345692 3300037853 Bacteria 15689
83 Ga0436364_0600240 3300037853 Bacteria 1879
84 Ga0436365_1334705 3300039437 Bacteria 4978
85 Ga0436360_0261706 3300039438 Bacteria 2693
86 Ga0436361_0170625 3300039447 Bacteria 5467
87 Ga0436361_1132146 3300039447 Bacteria 1322
88 Ga0436362_0605040 3300039453 Bacteria 1368
89 Ga0436362_1040692 3300039453 Bacteria 1046
90 Ga0451577_0205024 3300042876 Bacteria 1780
91 Ga0466963_0065894 3300044694 Bacteria 2429
92 Ga0453684_1013653 3300044712 Bacteria 882
93 Ga0466967_0409701 3300045976 Bacteria 1320
94 Ga0495617_042038 3300046452 Bacteria 1528
95 Ga0495603_0000078 3300046455 Bacteria 43255
96 Ga0495629_0006981 3300046459 Bacteria 8326
97 Ga0495580_0002921 3300046472 Bacteria 14684
98 Ga0495582_0001209 3300046473 Bacteria 14521
99 Ga0495639_0030857 3300046475 Bacteria 2383
100 Ga0495662_0227634 3300046476 Bacteria 919
101 Ga0495666_0020726 3300046526 Bacteria 3255
102 Ga0495587_0295863 3300046536 Bacteria 906
103 Ga0495622_0003568 3300046557 Bacteria 7310
104 Ga0495634_0009093 3300046642 Bacteria 7342
105 Ga0495588_0191436 3300046674 Bacteria 1080
106 Ga0495647_0001508 3300046681 Bacteria 7207
107 Ga0495658_0007260 3300046683 Bacteria 5475
108 Ga0495613_0001577 3300046689 Bacteria 17290
109 Ga0495581_0013264 3300047315 Bacteria 4777
110 Ga0495604_0409024 3300047317 Bacteria 892
111 Ga0495674_0180221 3300047319 Bacteria 1759
112 Ga0496102_0114034 3300048905 Bacteria 2521
113 Ga0496110_0185811 3300048913 Bacteria 1887
114 Ga0496126_0009885 3300048929 Bacteria 10087
115 Ga0501031_0000002 3300049568 Bacteria 217588
116 Ga0501031_0047794 3300049568 Bacteria 2789
117 Ga0501032_0000004 3300049569 Bacteria 310855
118 Ga0501032_0036857 3300049569 Bacteria 3337
119 Ga0501033_0000016 3300049570 Bacteria 217458
120 Ga0501033_0095536 3300049570 Bacteria 2172
121 Ga0501034_0000011 3300049571 Bacteria 310855
122 Ga0501034_0002005 3300049571 Bacteria 25731
123 Ga0501034_0003521 3300049571 Bacteria 17775
124 Ga0501036_0000001 3300049572 Bacteria 310855
125 Ga0501036_0159488 3300049572 Bacteria 1902
126 Ga0501036_0532232 3300049572 Bacteria 977
127 Ga0501037_0000006 3300049573 Bacteria 217461
128 Ga0501038_0000003 3300049574 Bacteria 310855
129 Ga0501038_0361098 3300049574 Bacteria 1129
130 Ga0501039_0000004 3300049575 Bacteria 310855
131 Ga0501039_0142250 3300049575 Bacteria 1884
132 Ga0501040_0000812 3300049576 Bacteria 19463
133 Ga0501040_0071595 3300049576 Bacteria 2393
134 Ga0501040_0076359 3300049576 Bacteria 2316
135 Ga0501042_0153487 3300049578 Bacteria 1660
136 Ga0501042_0198652 3300049578 Bacteria 1446
137 Ga0501043_0000155 3300049579 Bacteria 62570
138 Ga0501043_0168692 3300049579 Bacteria 1708
139 Ga0501047_0001325 3300049581 Bacteria 24266
140 Ga0501048_0096832 3300049582 Bacteria 2081
141 Ga0501048_0327468 3300049582 Bacteria 1091
142 Ga0501068_0000595 3300049584 Bacteria 18400
143 Ga0501068_0014656 3300049584 Bacteria 4486
144 Ga0501070_0448184 3300049586 Bacteria 1041
145 Ga0501071_0337604 3300049587 Bacteria 1145
146 Ga0501072_0068629 3300049588 Bacteria 2798
147 Ga0501072_0096916 3300049588 Bacteria 2344
148 Ga0501074_0077162 3300049590 Bacteria 2391
149 Ga0501076_0189402 3300049592 Bacteria 1678
150 Ga0501077_0038121 3300049593 Bacteria 3059
151 Ga0501077_0081381 3300049593 Bacteria 2051
152 Ga0501079_0072181 3300049741 Bacteria 2667
153 Ga0501080_0231381 3300049742 Bacteria 1689
154 Ga0501081_0090895 3300049743 Bacteria 2146
155 Ga0501081_0267281 3300049743 Bacteria 1250
156 Ga0501083_0102636 3300049744 Bacteria 1885
157 Ga0501035_0000009 3300049822 Bacteria 310827
158 Ga0501035_0305127 3300049822 Bacteria 1340
159 Ga0501044_0000005 3300049823 Bacteria 310855
160 Ga0501044_0026159 3300049823 Bacteria 6180
161 nmdc:mga03683_123303_c1 3300050489 Bacteria 1154
162 nmdc:mga03683_3032_c2 3300050489 Bacteria 4446
163 nmdc:mga03683_88331_c1 3300050489 Bacteria 1348
164 nmdc:mga03n38_38487_c1 3300050490 Bacteria 2069
165 nmdc:mga00v17_283369_c1 3300050491 Bacteria 1076
166 nmdc:mga0yw44_40055_c1 3300050492 Bacteria 2781
167 nmdc:mga06z11_152505_c1 3300050494 Bacteria 1315
168 nmdc:mga06z11_199459_c1 3300050494 Bacteria 1161
169 nmdc:mga06z11_85036_c1 3300050494 Bacteria 1706
170 nmdc:mga04h51_18864_c1 3300050495 Bacteria 2037
171 nmdc:mga04h51_18986_c1 3300050495 Bacteria 2033
172 nmdc:mga07m45_115876_c1 3300050496 Bacteria 1545
173 nmdc:mga07m45_15865_c1 3300050496 Bacteria 4027
174 nmdc:mga07m45_181868_c1 3300050496 Bacteria 1222
175 nmdc:mga05p37_239881_c1 3300050507 Bacteria 2180
176 nmdc:mga05p37_589189_c1 3300050507 Bacteria 1257
177 nmdc:mga0qj67_88_c1 3300050509 Bacteria 62377
178 nmdc:mga08y16_154544_c1 3300050511 Bacteria 2384
179 nmdc:mga08y16_310003_c1 3300050511 Bacteria 1625
180 nmdc:mga0sz30_114_c1 3300050516 Bacteria 30491
181 nmdc:mga0sz30_116881_c1 3300050516 Bacteria 1171
182 nmdc:mga0sz30_19680_c1 3300050516 Bacteria 2716
183 Ga0495601_0011178 3300053077 Bacteria 5362
184 Ga0495619_0009922 3300053085 Bacteria 5998
185 Ga0500647_0143749 3300053091 Bacteria 1117
186 Ga0500651_0256258 3300053093 Bacteria 1015
187 Ga0500641_0014982 3300053096 Bacteria 2869
188 Ga0500616_0007032 3300053153 Bacteria 7226
189 Ga0501084_0147678 3300054114 Bacteria 1980
190 Ga0501082_0156525 3300060353 Bacteria 1979
191 Ga0530510_0011414 3300061734 Bacteria 6233
192 Ga0530510_0147892 3300061734 Bacteria 1733
193 2643770284 2643221550 Bacteria 4619371
194 2657681494 2657244999 Bacteria 5946535
195 2784473482 2784132109 Bacteria 3141763
196 2792585196 2791355082 Bacteria 5973319
197 2792620846 2791355091 Bacteria 6135441
198 2804752686 2802429268 Bacteria 6094027
199 2829747865 2829745981 Bacteria 5406054
200 2842699656 2842698319 Bacteria 5190321
201 2870805966 2870804320 Bacteria 2552467
202 8049295251 8049293176 Bacteria 6128433
203 Ga0495602_0251805
204 Ga0070676_10114912
205 Ga0070660_100004290
206 Ga0070688_100220297
207 Ga0070713_100026279
208 Ga0070708_100511674
209 Ga0070678_100022419
210 Ga0070707_100409947
211 Ga0070698_100000915
212 Ga0070698_100632386
213 Ga0070696_100098085
214 Ga0070665_100108500
215 Ga0068860_100089304
216 Ga0068862_100131157
217 Ga0081455_10000710
218 Ga0081455_10127676
219 Ga0081539_10006327
220 Ga0081539_10007591
221 Ga0075365_10021826
222 Ga0075365_10215712
223 Ga0075365_10288007
224 Ga0075368_10023777
225 Ga0075363_100078221
226 Ga0075363_100087713
227 Ga0075432_10034319
228 Ga0075362_10037319
229 Ga0075362_10062387
230 Ga0075362_10114270
231 Ga0075362_10151253
232 Ga0075367_10009071
233 Ga0075367_10171751
234 Ga0075367_10189762
235 Ga0075369_10001682
236 Ga0075369_10063167
237 Ga0075366_10053796
238 Ga0075370_10027958
239 Ga0075370_10030492
240 Ga0075370_10149458
241 Ga0075430_100001207
242 Ga0099794_10056722
243 Ga0105240_10251162
244 Ga0111539_10457617
245 Ga0111539_10531692
246 Ga0114129_10242706
247 Ga0105242_10442510
248 Ga0105249_10132348
249 Ga0105239_10055602
250 Ga0163162_10225687
251 Ga0157375_10249517
252 Ga0213873_10071470
253 Ga0213875_10022768
254 Ga0213871_10005047
255 Ga0207426_1016788
256 Ga0207662_10108650
257 Ga0207659_10199235
258 Ga0207700_10078589
259 Ga0207669_10165507
260 Ga0207703_10134427
261 Ga0207639_10377188
262 Ga0207675_100332683
263 Ga0207683_10028556
264 Ga0209813_10019114
265 Ga0209813_10027784
266 Ga0207428_10268630
267 Ga0268266_10013774
268 Ga0268266_10204087
269 Ga0268266_10340436
270 Ga0268265_10314391
271 Ga0265334_10001215
272 Ga0307405_10136080
273 Ga0307410_10675206
274 Ga0307416_100272556
275 Ga0373935_0194391
276 Ga0373947_0011276
277 Ga0373937_0205698
278 Ga0373937_0444460
279 Ga0373937_0727398
280 Ga0373925_0030487
281 Ga0373925_0055484
282 Ga0373925_0187926
283 Ga0373925_0518153
284 Ga0436364_0345692
285 Ga0436364_0600240
286 Ga0436365_1334705
287 Ga0436360_0261706
288 Ga0436361_0170625
289 Ga0436361_1132146
290 Ga0436362_0605040
291 Ga0436362_1040692
292 Ga0451577_0205024
293 Ga0466963_0065894
294 Ga0453684_1013653
295 Ga0466967_0409701
296 Ga0495617_042038
297 Ga0495603_0000078
298 Ga0495629_0006981
299 Ga0495580_0002921
300 Ga0495582_0001209
301 Ga0495639_0030857
302 Ga0495662_0227634
303 Ga0495666_0020726
304 Ga0495587_0295863
305 Ga0495622_0003568
306 Ga0495634_0009093
307 Ga0495588_0191436
308 Ga0495647_0001508
309 Ga0495658_0007260
310 Ga0495613_0001577
311 Ga0495581_0013264
312 Ga0495604_0409024
313 Ga0495674_0180221
314 Ga0496102_0114034
315 Ga0496110_0185811
316 Ga0496126_0009885
317 Ga0501031_0000002
318 Ga0501031_0047794
319 Ga0501032_0000004
320 Ga0501032_0036857
321 Ga0501033_0000016
322 Ga0501033_0095536
323 Ga0501034_0000011
324 Ga0501034_0002005
325 Ga0501034_0003521
326 Ga0501036_0000001
327 Ga0501036_0159488
328 Ga0501036_0532232
329 Ga0501037_0000006
330 Ga0501038_0000003
331 Ga0501038_0361098
332 Ga0501039_0000004
333 Ga0501039_0142250
334 Ga0501040_0000812
335 Ga0501040_0071595
336 Ga0501040_0076359
337 Ga0501042_0153487
338 Ga0501042_0198652
339 Ga0501043_0000155
340 Ga0501043_0168692
341 Ga0501047_0001325
342 Ga0501048_0096832
343 Ga0501048_0327468
344 Ga0501068_0000595
345 Ga0501068_0014656
346 Ga0501070_0448184
347 Ga0501071_0337604
348 Ga0501072_0068629
349 Ga0501072_0096916
350 Ga0501074_0077162
351 Ga0501076_0189402
352 Ga0501077_0038121
353 Ga0501077_0081381
354 Ga0501079_0072181
355 Ga0501080_0231381
356 Ga0501081_0090895
357 Ga0501081_0267281
358 Ga0501083_0102636
359 Ga0501035_0000009
360 Ga0501035_0305127
361 Ga0501044_0000005
362 Ga0501044_0026159
363 nmdc:mga03683_123303_c1
364 nmdc:mga03683_3032_c2
365 nmdc:mga03683_88331_c1
366 nmdc:mga03n38_38487_c1
367 nmdc:mga00v17_283369_c1
368 nmdc:mga0yw44_40055_c1
369 nmdc:mga06z11_152505_c1
370 nmdc:mga06z11_199459_c1
371 nmdc:mga06z11_85036_c1
372 nmdc:mga04h51_18864_c1
373 nmdc:mga04h51_18986_c1
374 nmdc:mga07m45_115876_c1
375 nmdc:mga07m45_15865_c1
376 nmdc:mga07m45_181868_c1
377 nmdc:mga05p37_239881_c1
378 nmdc:mga05p37_589189_c1
379 nmdc:mga0qj67_88_c1
380 nmdc:mga08y16_154544_c1
381 nmdc:mga08y16_310003_c1
382 nmdc:mga0sz30_114_c1
383 nmdc:mga0sz30_116881_c1
384 nmdc:mga0sz30_19680_c1
385 Ga0495601_0011178
386 Ga0495619_0009922
387 Ga0500647_0143749
388 Ga0500651_0256258
389 Ga0500641_0014982
390 Ga0500616_0007032
391 Ga0501084_0147678
392 Ga0501082_0156525
393 Ga0530510_0011414
394 Ga0530510_0147892
395 2643770284
396 2657681494
397 2784473482
398 2792585196
399 2792620846
400 2804752686
401 2829747865
402 2842699656
403 2870805966
404 8049295251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

34

286

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.968 1 276
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9646 1 276
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.961 3 276
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.9562 2 276
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9509 3 276
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.968 1 276 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9646 1 276 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9409 1 261 3.20.20.100
af_Q2FW57_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9261 1 262 3.20.20.100
3wbyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9187 2 262 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6M1S8U5-F1-model_v4 Aldo/keto reductase 0.993 16 108
AF-A0A530BKF2-F1-model_v4 Aldo/keto reductase 0.9798 74 276 GO:0016491
AF-A0A3L7B7F9-F1-model_v4 deleted 0.9786 47 195
AF-A0A435SXR0-F1-model_v4 deleted 0.9781 37 276
AF-A0A7X4RVE0-F1-model_v4 Aldo/keto reductase 0.9771 1 276 GO:0016491

Map