F310448

General Info

Members Datasets Scaffolds Average Seq Length
202 135 404 427

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0066365|Ga0501073_0066365_838_2214
Length 449
Sequence MQCKVNAGRPFFIPGRSRHPISLRIFRFYFSLFRMNSFFRPLPWTADSNIYEVNLRQYTADGSFRAFEAHLPRLRDMGIEILWFMPITPISVKGRLGSLGSYYACSDYLSTNPEFGTLEDFKFLVRSAHRQGFKILIDWVANHTGLDHHWTSGHPEFYRRNAEGQFFEANGWQDVIDLNYDVPELRETMIRCMEFWVNECGIDGFRCDMAMLVPLDFWKEARTAIDRIRPLFWLAECEDPAYHEVFDATYTWKFLHSMEDYYRKQSGFSGLFDVLRFYDSNFPQQAIRAYFTSNHDENSHSGSEYERLGDAALPFAVFCSTWNGIPLIYSGQELPNRKRLKFFDKDLIEWKTPCALHDFYKTLLGLRKRNSALRAGDPSVSTFILNNSANRQVISFLRRNRQREVLVVLNLSANEVSLHLDSGEVNGEFTDAFNAIFRLKPWEYRLYEK

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0
Rhizoplane 0
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0066365 3300049589 Bacteria 2515
2 rootH2_10217686 3300003320 Bacteria 4360
3 rootH1_10251219 3300003323 Bacteria 4867
4 Ga0065704_10094714 3300005289 Unclassified 2528
5 Ga0070658_10000230 3300005327 Bacteria 49640
6 Ga0070676_10000156 3300005328 Bacteria 27179
7 Ga0070670_100112803 3300005331 Bacteria 2343
8 Ga0068869_100021861 3300005334 Bacteria 4402
9 Ga0070666_10000131 3300005335 Bacteria 52822
10 Ga0070666_10000191 3300005335 Bacteria 42149
11 Ga0070680_100000390 3300005336 Bacteria 29749
12 Ga0070682_100002004 3300005337 Bacteria 11372
13 Ga0068868_100005139 3300005338 Bacteria 9190
14 Ga0070689_100026381 3300005340 Bacteria 4373
15 Ga0070691_10000447 3300005341 Bacteria 15259
16 Ga0070668_100000872 3300005347 Bacteria 20984
17 Ga0070675_100078360 3300005354 Bacteria 2751
18 Ga0070671_100110900 3300005355 Bacteria 2305
19 Ga0070673_100000096 3300005364 Bacteria 39184
20 Ga0070673_100106898 3300005364 Bacteria 2314
21 Ga0070688_100034678 3300005365 Bacteria 3059
22 Ga0070688_100049689 3300005365 Unclassified 2611
23 Ga0070667_100000248 3300005367 Bacteria 61183
24 Ga0070667_100088153 3300005367 Bacteria 2664
25 Ga0070678_100058140 3300005456 Bacteria 2837
26 Ga0068867_100012884 3300005459 Bacteria 5916
27 Ga0070685_10003298 3300005466 Bacteria 8196
28 Ga0070698_100000219 3300005471 Bacteria 56179
29 Ga0070698_100001176 3300005471 Bacteria 29035
30 Ga0070679_100000656 3300005530 Bacteria 29462
31 Ga0068853_100018548 3300005539 Bacteria 5760
32 Ga0070672_100000033 3300005543 Bacteria 61516
33 Ga0070672_100193574 3300005543 Bacteria 1699
34 Ga0070693_100049323 3300005547 Bacteria 2401
35 Ga0070665_100000641 3300005548 Bacteria 47468
36 Ga0068855_100015914 3300005563 Bacteria 9049
37 Ga0068855_100044707 3300005563 Bacteria 5241
38 Ga0070664_100082914 3300005564 Bacteria 2765
39 Ga0068859_100001063 3300005617 Bacteria 28112
40 Ga0068859_100247260 3300005617 Bacteria 1873
41 Ga0068864_100001018 3300005618 Bacteria 23447
42 Ga0068864_100009010 3300005618 Bacteria 8227
43 Ga0068861_100007743 3300005719 Bacteria 7379
44 Ga0068851_10000366 3300005834 Bacteria 20381
45 Ga0068863_100002172 3300005841 Bacteria 19439
46 Ga0068863_100015922 3300005841 Bacteria 7213
47 Ga0068858_100000596 3300005842 Bacteria 37696
48 Ga0068858_100042815 3300005842 Bacteria 4198
49 Ga0068860_100007400 3300005843 Bacteria 10984
50 Ga0068860_100090848 3300005843 Bacteria 2909
51 Ga0068862_100039422 3300005844 Bacteria 4012
52 Ga0075366_10010055 3300006195 Bacteria 5303
53 Ga0097621_100000582 3300006237 Bacteria 25730
54 Ga0097621_100010256 3300006237 Bacteria 6844
55 Ga0097621_100015933 3300006237 Bacteria 5669
56 Ga0097621_100018518 3300006237 Bacteria 5323
57 Ga0068871_100021398 3300006358 Bacteria 4970
58 Ga0068871_100033436 3300006358 Bacteria 4072
59 Ga0075428_100009075 3300006844 Bacteria 11037
60 Ga0075431_100003792 3300006847 Bacteria 14696
61 Ga0068865_100082168 3300006881 Bacteria 2316
62 Ga0097620_100001063 3300006931 Bacteria 28112
63 Ga0097620_100247260 3300006931 Bacteria 1873
64 Ga0105240_10003315 3300009093 Bacteria 25162
65 Ga0111539_10066409 3300009094 Bacteria 4260
66 Ga0105247_10062670 3300009101 Bacteria 2307
67 Ga0105247_10131223 3300009101 Unclassified 1633
68 Ga0114129_10057523 3300009147 Bacteria 5441
69 Ga0105243_10186114 3300009148 Unclassified 1810
70 Ga0105241_10000663 3300009174 Bacteria 25854
71 Ga0105241_10000951 3300009174 Bacteria 21901
72 Ga0105242_10037231 3300009176 Bacteria 3907
73 Ga0105242_10071001 3300009176 Unclassified 2888
74 Ga0105248_10074628 3300009177 Bacteria 3812
75 Ga0105237_10006836 3300009545 Bacteria 12574
76 Ga0105237_10030065 3300009545 Bacteria 5518
77 Ga0105249_10004505 3300009553 Bacteria 12043
78 Ga0105249_10006431 3300009553 Bacteria 10213
79 Ga0105249_10053583 3300009553 Bacteria 3687
80 Ga0105249_10152361 3300009553 Bacteria 2227
81 Ga0105246_10041168 3300011119 Bacteria 3121
82 Ga0157370_10001459 3300013104 Bacteria 29237
83 Ga0157370_10155838 3300013104 Bacteria 2125
84 Ga0157369_10033474 3300013105 Bacteria 5647
85 Ga0157369_10061615 3300013105 Bacteria 4044
86 Ga0157374_10000007 3300013296 Bacteria 595643
87 Ga0157374_10000266 3300013296 Bacteria 48468
88 Ga0157374_10069691 3300013296 Bacteria 3312
89 Ga0157374_10115668 3300013296 Bacteria 2584
90 Ga0157378_10003094 3300013297 Bacteria 14794
91 Ga0157378_10007685 3300013297 Bacteria 9406
92 Ga0157378_10008492 3300013297 Bacteria 8946
93 Ga0157378_10087556 3300013297 Bacteria 2825
94 Ga0163162_10000397 3300013306 Bacteria 39878
95 Ga0163162_10012600 3300013306 Bacteria 8258
96 Ga0163162_10014943 3300013306 Bacteria 7581
97 Ga0163162_10029363 3300013306 Bacteria 5441
98 Ga0163162_10094287 3300013306 Bacteria 3079
99 Ga0163162_10173836 3300013306 Bacteria 2279
100 Ga0157372_10473400 3300013307 Bacteria 1460
101 Ga0157375_10000346 3300013308 Bacteria 41874
102 Ga0157375_10016894 3300013308 Bacteria 6573
103 Ga0157375_10018941 3300013308 Bacteria 6249
104 Ga0157375_10035590 3300013308 Bacteria 4754
105 Ga0157375_10168986 3300013308 Bacteria 2333
106 Ga0157375_10403350 3300013308 Unclassified 1534
107 Ga0163163_10008986 3300014325 Bacteria 8904
108 Ga0157380_10013892 3300014326 Bacteria 5880
109 Ga0157379_10000229 3300014968 Bacteria 43909
110 Ga0157379_10108913 3300014968 Bacteria 2488
111 Ga0157376_10000117 3300014969 Bacteria 56126
112 Ga0157376_10003332 3300014969 Bacteria 11051
113 Ga0157376_10115951 3300014969 Bacteria 2365
114 Ga0157376_10162694 3300014969 Bacteria 2025
115 Ga0163161_10054998 3300017792 Bacteria 2889
116 Ga0213876_10015759 3300021384 Bacteria 4001
117 Ga0207656_10000261 3300025321 Bacteria 18358
118 Ga0207656_10029873 3300025321 Bacteria 2248
119 Ga0207710_10037680 3300025900 Bacteria 2136
120 Ga0207680_10000211 3300025903 Bacteria 28081
121 Ga0207680_10000533 3300025903 Bacteria 18106
122 Ga0207645_10000836 3300025907 Bacteria 25657
123 Ga0207643_10005694 3300025908 Bacteria 6663
124 Ga0207705_10006262 3300025909 Bacteria 8839
125 Ga0207654_10000832 3300025911 Bacteria 16989
126 Ga0207654_10000989 3300025911 Bacteria 15563
127 Ga0207707_10001200 3300025912 Bacteria 24391
128 Ga0207695_10010277 3300025913 Bacteria 11466
129 Ga0207671_10018337 3300025914 Bacteria 5371
130 Ga0207671_10029548 3300025914 Bacteria 4092
131 Ga0207660_10000111 3300025917 Bacteria 46780
132 Ga0207662_10018718 3300025918 Bacteria 3933
133 Ga0207652_10000460 3300025921 Bacteria 42038
134 Ga0207659_10086142 3300025926 Bacteria 2335
135 Ga0207659_10107615 3300025926 Bacteria 2114
136 Ga0207687_10027495 3300025927 Bacteria 3817
137 Ga0207709_10113613 3300025935 Unclassified 1815
138 Ga0207670_10013046 3300025936 Bacteria 4886
139 Ga0207704_10007803 3300025938 Bacteria 5078
140 Ga0207704_10023916 3300025938 Bacteria 3302
141 Ga0207691_10000001 3300025940 Bacteria 220829
142 Ga0207711_10105269 3300025941 Bacteria 2502
143 Ga0207689_10004326 3300025942 Bacteria 12934
144 Ga0207689_10009728 3300025942 Bacteria 8280
145 Ga0207679_10040519 3300025945 Bacteria 3335
146 Ga0207651_10008145 3300025960 Bacteria 5639
147 Ga0207712_10003292 3300025961 Bacteria 10244
148 Ga0207712_10008099 3300025961 Bacteria 6648
149 Ga0207712_10013206 3300025961 Bacteria 5293
150 Ga0207668_10000263 3300025972 Bacteria 35099
151 Ga0207640_10116930 3300025981 Bacteria 1902
152 Ga0207658_10001591 3300025986 Bacteria 17504
153 Ga0207658_10022215 3300025986 Bacteria 4415
154 Ga0207677_10001832 3300026023 Bacteria 11222
155 Ga0207677_10011410 3300026023 Bacteria 5066
156 Ga0207677_10032635 3300026023 Bacteria 3350
157 Ga0207703_10006720 3300026035 Bacteria 9178
158 Ga0207703_10032625 3300026035 Bacteria 4122
159 Ga0207703_10145849 3300026035 Bacteria 2058
160 Ga0207708_10026533 3300026075 Bacteria 4386
161 Ga0207641_10000299 3300026088 Bacteria 62004
162 Ga0207641_10000371 3300026088 Bacteria 53368
163 Ga0207641_10000756 3300026088 Bacteria 34796
164 Ga0207641_10020641 3300026088 Bacteria 5413
165 Ga0207648_10008820 3300026089 Bacteria 9713
166 Ga0207648_10038072 3300026089 Bacteria 4234
167 Ga0207676_10006593 3300026095 Bacteria 8212
168 Ga0207675_100020031 3300026118 Bacteria 6242
169 Ga0207683_10026930 3300026121 Bacteria 4967
170 Ga0268266_10001506 3300028379 Bacteria 27540
171 Ga0268265_10029020 3300028380 Bacteria 3967
172 Ga0268264_10010767 3300028381 Bacteria 7555
173 Ga0268264_10050546 3300028381 Bacteria 3462
174 Ga0268264_10073379 3300028381 Bacteria 2904
175 Ga0307517_10002909 3300028786 Bacteria 27119
176 Ga0307515_10000024 3300028794 Bacteria 393119
177 Ga0307513_10109763 3300031456 Bacteria 2756
178 Ga0307509_10137055 3300031507 Bacteria 2391
179 Ga0307508_10028329 3300031616 Bacteria 5065
180 Ga0307516_10030906 3300031730 Bacteria 5401
181 Ga0307510_10000406 3300033180 Bacteria 41007
182 Ga0373937_0063258 3300036401 Bacteria 3403
183 Ga0436365_0577581 3300039437 Bacteria 30054
184 Ga0466972_0000003 3300044658 Bacteria 391452
185 Ga0453684_0151271 3300044712 Bacteria 2758
186 Ga0495629_0061874 3300046459 Bacteria 2616
187 Ga0495606_0029373 3300046507 Bacteria 3861
188 Ga0495611_0000121 3300046648 Bacteria 56074
189 Ga0495657_0072717 3300046675 Bacteria 2242
190 Ga0501300_006233 3300049523 Bacteria 1757
191 Ga0501034_0027801 3300049571 Bacteria 5751
192 Ga0501067_0012317 3300049583 Bacteria 4742
193 Ga0501070_0036497 3300049586 Bacteria 4104
194 Ga0501044_0058069 3300049823 Bacteria 3969
195 nmdc:mga0k408_5012_c1 3300050493 Bacteria 5364
196 nmdc:mga06r32_4027_c2 3300050510 Bacteria 9173
197 nmdc:mga08y16_234223_c1 3300050511 Bacteria 1899
198 Ga0500646_0006426 3300053090 Bacteria 2990
199 Ga0500646_0021745 3300053090 Bacteria 1711
200 Ga0500588_0001759 3300053146 Bacteria 4212
201 Ga0500616_0017385 3300053153 Bacteria 4079
202 Ga0501082_0010927 3300060353 Bacteria 7813
203 Ga0501073_0066365
204 rootH2_10217686
205 rootH1_10251219
206 Ga0065704_10094714
207 Ga0070658_10000230
208 Ga0070676_10000156
209 Ga0070670_100112803
210 Ga0068869_100021861
211 Ga0070666_10000131
212 Ga0070666_10000191
213 Ga0070680_100000390
214 Ga0070682_100002004
215 Ga0068868_100005139
216 Ga0070689_100026381
217 Ga0070691_10000447
218 Ga0070668_100000872
219 Ga0070675_100078360
220 Ga0070671_100110900
221 Ga0070673_100000096
222 Ga0070673_100106898
223 Ga0070688_100034678
224 Ga0070688_100049689
225 Ga0070667_100000248
226 Ga0070667_100088153
227 Ga0070678_100058140
228 Ga0068867_100012884
229 Ga0070685_10003298
230 Ga0070698_100000219
231 Ga0070698_100001176
232 Ga0070679_100000656
233 Ga0068853_100018548
234 Ga0070672_100000033
235 Ga0070672_100193574
236 Ga0070693_100049323
237 Ga0070665_100000641
238 Ga0068855_100015914
239 Ga0068855_100044707
240 Ga0070664_100082914
241 Ga0068859_100001063
242 Ga0068859_100247260
243 Ga0068864_100001018
244 Ga0068864_100009010
245 Ga0068861_100007743
246 Ga0068851_10000366
247 Ga0068863_100002172
248 Ga0068863_100015922
249 Ga0068858_100000596
250 Ga0068858_100042815
251 Ga0068860_100007400
252 Ga0068860_100090848
253 Ga0068862_100039422
254 Ga0075366_10010055
255 Ga0097621_100000582
256 Ga0097621_100010256
257 Ga0097621_100015933
258 Ga0097621_100018518
259 Ga0068871_100021398
260 Ga0068871_100033436
261 Ga0075428_100009075
262 Ga0075431_100003792
263 Ga0068865_100082168
264 Ga0097620_100001063
265 Ga0097620_100247260
266 Ga0105240_10003315
267 Ga0111539_10066409
268 Ga0105247_10062670
269 Ga0105247_10131223
270 Ga0114129_10057523
271 Ga0105243_10186114
272 Ga0105241_10000663
273 Ga0105241_10000951
274 Ga0105242_10037231
275 Ga0105242_10071001
276 Ga0105248_10074628
277 Ga0105237_10006836
278 Ga0105237_10030065
279 Ga0105249_10004505
280 Ga0105249_10006431
281 Ga0105249_10053583
282 Ga0105249_10152361
283 Ga0105246_10041168
284 Ga0157370_10001459
285 Ga0157370_10155838
286 Ga0157369_10033474
287 Ga0157369_10061615
288 Ga0157374_10000007
289 Ga0157374_10000266
290 Ga0157374_10069691
291 Ga0157374_10115668
292 Ga0157378_10003094
293 Ga0157378_10007685
294 Ga0157378_10008492
295 Ga0157378_10087556
296 Ga0163162_10000397
297 Ga0163162_10012600
298 Ga0163162_10014943
299 Ga0163162_10029363
300 Ga0163162_10094287
301 Ga0163162_10173836
302 Ga0157372_10473400
303 Ga0157375_10000346
304 Ga0157375_10016894
305 Ga0157375_10018941
306 Ga0157375_10035590
307 Ga0157375_10168986
308 Ga0157375_10403350
309 Ga0163163_10008986
310 Ga0157380_10013892
311 Ga0157379_10000229
312 Ga0157379_10108913
313 Ga0157376_10000117
314 Ga0157376_10003332
315 Ga0157376_10115951
316 Ga0157376_10162694
317 Ga0163161_10054998
318 Ga0213876_10015759
319 Ga0207656_10000261
320 Ga0207656_10029873
321 Ga0207710_10037680
322 Ga0207680_10000211
323 Ga0207680_10000533
324 Ga0207645_10000836
325 Ga0207643_10005694
326 Ga0207705_10006262
327 Ga0207654_10000832
328 Ga0207654_10000989
329 Ga0207707_10001200
330 Ga0207695_10010277
331 Ga0207671_10018337
332 Ga0207671_10029548
333 Ga0207660_10000111
334 Ga0207662_10018718
335 Ga0207652_10000460
336 Ga0207659_10086142
337 Ga0207659_10107615
338 Ga0207687_10027495
339 Ga0207709_10113613
340 Ga0207670_10013046
341 Ga0207704_10007803
342 Ga0207704_10023916
343 Ga0207691_10000001
344 Ga0207711_10105269
345 Ga0207689_10004326
346 Ga0207689_10009728
347 Ga0207679_10040519
348 Ga0207651_10008145
349 Ga0207712_10003292
350 Ga0207712_10008099
351 Ga0207712_10013206
352 Ga0207668_10000263
353 Ga0207640_10116930
354 Ga0207658_10001591
355 Ga0207658_10022215
356 Ga0207677_10001832
357 Ga0207677_10011410
358 Ga0207677_10032635
359 Ga0207703_10006720
360 Ga0207703_10032625
361 Ga0207703_10145849
362 Ga0207708_10026533
363 Ga0207641_10000299
364 Ga0207641_10000371
365 Ga0207641_10000756
366 Ga0207641_10020641
367 Ga0207648_10008820
368 Ga0207648_10038072
369 Ga0207676_10006593
370 Ga0207675_100020031
371 Ga0207683_10026930
372 Ga0268266_10001506
373 Ga0268265_10029020
374 Ga0268264_10010767
375 Ga0268264_10050546
376 Ga0268264_10073379
377 Ga0307517_10002909
378 Ga0307515_10000024
379 Ga0307513_10109763
380 Ga0307509_10137055
381 Ga0307508_10028329
382 Ga0307516_10030906
383 Ga0307510_10000406
384 Ga0373937_0063258
385 Ga0436365_0577581
386 Ga0466972_0000003
387 Ga0453684_0151271
388 Ga0495629_0061874
389 Ga0495606_0029373
390 Ga0495611_0000121
391 Ga0495657_0072717
392 Ga0501300_006233
393 Ga0501034_0027801
394 Ga0501067_0012317
395 Ga0501070_0036497
396 Ga0501044_0058069
397 nmdc:mga0k408_5012_c1
398 nmdc:mga06r32_4027_c2
399 nmdc:mga08y16_234223_c1
400 Ga0500646_0006426
401 Ga0500646_0021745
402 Ga0500588_0001759
403 Ga0500616_0017385
404 Ga0501082_0010927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

62

167

0.86

PF16657

Malt_amylase_C

Maltogenic Amylase, C-terminal domain

382

435

0.83

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

151

266

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gkl-assembly1.cif.gz_A crystal structure of a noncanonic maltogenic alpha-amylase amyb from thermotoga neapolitana 0.902 13 411
4gkl-assembly2.cif.gz_B crystal structure of a noncanonic maltogenic alpha-amylase amyb from thermotoga neapolitana 0.9005 13 410
3dhu-assembly3.cif.gz_C crystal structure of an alpha-amylase from lactobacillus plantarum 0.8907 10 410
3dhu-assembly4.cif.gz_D crystal structure of an alpha-amylase from lactobacillus plantarum 0.8772 11 410
4gkl-assembly1.cif.gz_A crystal structure of a noncanonic maltogenic alpha-amylase amyb from thermotoga neapolitana 0.8727 13 411
ID Description Score Start End Superfamily
3dhuA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9254 10 323 3.20.20.80
4gklB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9065 13 330 3.20.20.80
4gklB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8698 13 330 3.20.20.80
4lxfB03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8508 334 411 2.60.40.1180
af_P9WQ19_501_601_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8433 334 412 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A7X7Z9N4-F1-model_v4 Alpha-amylase 0.9896 5 108 GO:0005975
GO:0016740
AF-A0A7C4Q7D9-F1-model_v4 Glycosyl hydrolase family 13 catalytic domain-containing protein 0.9892 14 127 GO:0005975
GO:0016740
AF-A0A3C1R4C8-F1-model_v4 deleted 0.9889 14 186
AF-A0A519YRM9-F1-model_v4 Alpha-amlyase 0.9879 5 134 GO:0005975
GO:0016740
GO:0016829
AF-A0A2J6HZX5-F1-model_v4 Alpha-amylase 0.9874 5 170 GO:0005975
GO:0016740

Map