F310769

General Info

Members Datasets Scaffolds Average Seq Length
203 120 203 318

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100052917|Ga0070683_1000529174
Length 323
Sequence MPLTVVVSFVVVFALSLLAVSVGLKYFDARRKNQVVGMLQTASGETAVNVSNLLKEIENDKPTGLKRLFSSMQFSKHAEEQIQQAGLNWSSTRLLTSMALMMVPGFGLGLLMPVLFNGPTTAVVMALFFGSIPYLVVRAKRTKRLNTLEEQFPEALDFLARSMRAGHAFSISLEMLGEEMADPLGQEFRALFNEQNLGAPIDIALRNFSTRVPLLDVRFFTSSVLLQKQTGGNLSEILSRLAYVIRERFRLKGQVKAASAHGRLTATILTLLPIATMLCLLFVAPGYLQGMAEDSDGKWLIGGAIVAQILGNFFIKKIINIKV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 82.27
Stem 0
Stem Tuber 0
Unclassified 16.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10003822 3300005327 Bacteria 12338
2 Ga0070658_10185269 3300005327 Bacteria 1753
3 Ga0070683_100000004 3300005329 Bacteria 373231
4 Ga0070683_100052917 3300005329 Bacteria 3762
5 Ga0070683_100246833 3300005329 Unclassified 1698
6 Ga0070673_100065065 3300005364 Unclassified 2907
7 Ga0070659_100013001 3300005366 Bacteria 6189
8 Ga0070659_100111028 3300005366 Bacteria 2213
9 Ga0070709_10248999 3300005434 Unclassified 1279
10 Ga0070714_100010044 3300005435 Bacteria 7468
11 Ga0070713_100005234 3300005436 Bacteria 8842
12 Ga0070713_100024164 3300005436 Bacteria 4730
13 Ga0070713_100041475 3300005436 Unclassified 3750
14 Ga0070713_100057427 3300005436 Bacteria 3241
15 Ga0070713_100068015 3300005436 Bacteria 3001
16 Ga0070711_100142232 3300005439 Bacteria 1800
17 Ga0070663_100119109 3300005455 Bacteria 1992
18 Ga0070678_100096096 3300005456 Bacteria 2285
19 Ga0070662_100233146 3300005457 Bacteria 1473
20 Ga0070681_10001139 3300005458 Bacteria 22872
21 Ga0070681_10024662 3300005458 Bacteria 6051
22 Ga0070685_10120758 3300005466 Bacteria 1627
23 Ga0070699_100017155 3300005518 Bacteria 6217
24 Ga0070679_100200990 3300005530 Bacteria 1959
25 Ga0070684_100000142 3300005535 Bacteria 47988
26 Ga0070684_100066897 3300005535 Unclassified 3155
27 Ga0068853_100017469 3300005539 Bacteria 5920
28 Ga0070696_100004115 3300005546 Bacteria 9697
29 Ga0068855_100010679 3300005563 Bacteria 11080
30 Ga0068855_100035853 3300005563 Bacteria 5907
31 Ga0068856_100002669 3300005614 Bacteria 18292
32 Ga0068856_100005243 3300005614 Bacteria 12789
33 Ga0068856_100008613 3300005614 Bacteria 9919
34 Ga0068856_100010149 3300005614 Bacteria 9153
35 Ga0068859_100132267 3300005617 Unclassified 2567
36 Ga0068864_100177650 3300005618 Bacteria 1944
37 Ga0068863_100214424 3300005841 Bacteria 1854
38 Ga0070717_10015953 3300006028 Bacteria 5815
39 Ga0070717_10070920 3300006028 Bacteria 2905
40 Ga0097621_100055428 3300006237 Unclassified 3237
41 Ga0097621_100281470 3300006237 Bacteria 1464
42 Ga0068871_100206444 3300006358 Unclassified 1698
43 Ga0075436_100001482 3300006914 Bacteria 15994
44 Ga0097620_100132272 3300006931 Unclassified 2567
45 Ga0075435_100029693 3300007076 Bacteria 4293
46 Ga0105240_10000425 3300009093 Bacteria 78173
47 Ga0105240_10022688 3300009093 Bacteria 8316
48 Ga0105242_10133738 3300009176 Bacteria 2144
49 Ga0105248_10076987 3300009177 Bacteria 3749
50 Ga0105248_10106822 3300009177 Bacteria 3156
51 Ga0105248_10186154 3300009177 Bacteria 2340
52 Ga0105237_10005452 3300009545 Bacteria 14347
53 Ga0105237_10410282 3300009545 Unclassified 1359
54 Ga0105237_10547075 3300009545 Bacteria 1164
55 Ga0105239_10284886 3300010375 Bacteria 1860
56 Ga0105239_10412470 3300010375 Bacteria 1529
57 Ga0157373_10059440 3300013100 Unclassified 2709
58 Ga0157370_10228149 3300013104 Bacteria 1724
59 Ga0157369_10000445 3300013105 Bacteria 54768
60 Ga0157369_10014320 3300013105 Bacteria 8957
61 Ga0157369_10258789 3300013105 Unclassified 1815
62 Ga0157374_10235859 3300013296 Bacteria 1798
63 Ga0163162_10077854 3300013306 Bacteria 3380
64 Ga0157372_10011380 3300013307 Bacteria 9466
65 Ga0157372_10017081 3300013307 Bacteria 7790
66 Ga0157372_10431842 3300013307 Unclassified 1535
67 Ga0157375_10625873 3300013308 Bacteria 1234
68 Ga0163163_10038285 3300014325 Bacteria 4673
69 Ga0163163_10052842 3300014325 Bacteria 4010
70 Ga0163163_10073021 3300014325 Bacteria 3421
71 Ga0163163_10596486 3300014325 Unclassified 1168
72 Ga0157376_10216630 3300014969 Unclassified 1771
73 Ga0213874_10003683 3300021377 Bacteria 3427
74 Ga0213874_10011814 3300021377 Bacteria 2223
75 Ga0213876_10001990 3300021384 Bacteria 12225
76 Ga0213876_10003129 3300021384 Bacteria 9550
77 Ga0213875_10000019 3300021388 Bacteria 231333
78 Ga0213875_10000416 3300021388 Bacteria 37433
79 Ga0213875_10003116 3300021388 Bacteria 9551
80 Ga0213875_10027553 3300021388 Bacteria 2703
81 Ga0213875_10049137 3300021388 Bacteria 1977
82 Ga0207699_10037614 3300025906 Bacteria 2768
83 Ga0207705_10008918 3300025909 Bacteria 7301
84 Ga0207707_10018911 3300025912 Bacteria 6006
85 Ga0207707_10072459 3300025912 Bacteria 3003
86 Ga0207707_10197091 3300025912 Bacteria 1756
87 Ga0207695_10018384 3300025913 Bacteria 8084
88 Ga0207695_10028438 3300025913 Bacteria 6199
89 Ga0207671_10054790 3300025914 Bacteria 2954
90 Ga0207663_10090795 3300025916 Bacteria 2026
91 Ga0207660_10037588 3300025917 Unclassified 3375
92 Ga0207649_10091047 3300025920 Unclassified 1997
93 Ga0207652_10031628 3300025921 Bacteria 4446
94 Ga0207694_10029436 3300025924 Bacteria 4190
95 Ga0207687_10328664 3300025927 Bacteria 1240
96 Ga0207700_10099803 3300025928 Unclassified 2312
97 Ga0207700_10206021 3300025928 Unclassified 1660
98 Ga0207700_10245362 3300025928 Bacteria 1528
99 Ga0207664_10046044 3300025929 Bacteria 3423
100 Ga0207664_10397063 3300025929 Unclassified 1226
101 Ga0207690_10068756 3300025932 Bacteria 2435
102 Ga0207711_10188437 3300025941 Bacteria 1879
103 Ga0207661_10000017 3300025944 Bacteria 289163
104 Ga0207667_10010914 3300025949 Bacteria 10587
105 Ga0207667_10055419 3300025949 Bacteria 4167
106 Ga0207651_10392403 3300025960 Bacteria 1179
107 Ga0207703_10210346 3300026035 Bacteria 1734
108 Ga0207639_10079536 3300026041 Bacteria 2591
109 Ga0207702_10002191 3300026078 Bacteria 18721
110 Ga0207702_10012608 3300026078 Bacteria 7037
111 Ga0207702_10014297 3300026078 Bacteria 6590
112 Ga0207702_10045433 3300026078 Bacteria 3694
113 Ga0207641_10192734 3300026088 Bacteria 1874
114 Ga0207676_10168470 3300026095 Bacteria 1906
115 Ga0207683_10144968 3300026121 Bacteria 2141
116 Ga0265762_1001397 3300030760 Bacteria 4379
117 Ga0265760_10018449 3300031090 Bacteria 2010
118 Ga0265332_10120108 3300031238 Bacteria 1104
119 Ga0265329_10029500 3300031242 Bacteria 1792
120 Ga0265331_10023095 3300031250 Bacteria 3166
121 Ga0265316_10007721 3300031344 Bacteria 10083
122 Ga0265316_10044965 3300031344 Bacteria 3508
123 Ga0265342_10059475 3300031712 Bacteria 2257
124 Ga0373955_0078842 3300035172 Bacteria 1857
125 Ga0373927_0042806 3300035695 Bacteria 2934
126 Ga0373933_0017766 3300035724 Bacteria 3991
127 Ga0373937_0005396 3300036401 Bacteria 10938
128 Ga0373937_0012144 3300036401 Bacteria 7560
129 Ga0373937_0079161 3300036401 Bacteria 3038
130 Ga0373937_0148971 3300036401 Bacteria 2192
131 Ga0373937_0410013 3300036401 Unclassified 1286
132 Ga0373937_0434553 3300036401 Bacteria 1246
133 Ga0373925_0212859 3300037068 Bacteria 1540
134 Ga0436364_0079190 3300037853 Bacteria 6480
135 Ga0436364_0129883 3300037853 Bacteria 4405
136 Ga0436364_0133805 3300037853 Bacteria 37744
137 Ga0436364_0366372 3300037853 Bacteria 231753
138 Ga0436364_0372658 3300037853 Bacteria 9853
139 Ga0436364_0387774 3300037853 Bacteria 44891
140 Ga0436364_0433226 3300037853 Bacteria 3113
141 Ga0436364_0584666 3300037853 Bacteria 8763
142 Ga0436364_0655704 3300037853 Bacteria 2446
143 Ga0436364_0745246 3300037853 Bacteria 72310
144 Ga0436364_1017775 3300037853 Bacteria 6058
145 Ga0436364_1192730 3300037853 Bacteria 2981
146 Ga0436364_1501253 3300037853 Bacteria 3258
147 Ga0436365_0012738 3300039437 Bacteria 4086
148 Ga0436365_0629880 3300039437 Bacteria 6137
149 Ga0436365_0924186 3300039437 Unclassified 2450
150 Ga0436365_1533501 3300039437 Bacteria 2055
151 Ga0436365_1538719 3300039437 Bacteria 3036
152 Ga0436365_1642251 3300039437 Bacteria 2721
153 Ga0436365_1675064 3300039437 Bacteria 2780
154 Ga0436365_1833042 3300039437 Bacteria 2524
155 Ga0436363_0164962 3300039450 Bacteria 2363
156 Ga0436363_0324156 3300039450 Bacteria 8500
157 Ga0436363_1357069 3300039450 Bacteria 10849
158 Ga0495592_0002038 3300046454 Bacteria 14221
159 Ga0495592_0070484 3300046454 Bacteria 2546
160 Ga0495603_0218560 3300046455 Bacteria 1100
161 Ga0495580_0024604 3300046472 Bacteria 4406
162 Ga0495580_0049392 3300046472 Bacteria 2977
163 Ga0495662_0007635 3300046476 Bacteria 5336
164 Ga0495664_0000568 3300046477 Bacteria 18530
165 Ga0495594_0032571 3300046499 Bacteria 2830
166 Ga0495608_0091627 3300046511 Bacteria 1965
167 Ga0495618_0010745 3300046514 Bacteria 5542
168 Ga0495628_0022475 3300046516 Bacteria 5180
169 Ga0495652_0075700 3300046529 Bacteria 2794
170 Ga0495652_0134267 3300046529 Bacteria 1954
171 Ga0495640_0007774 3300046533 Bacteria 8436
172 Ga0495640_0068592 3300046533 Bacteria 2386
173 Ga0495586_0208943 3300046535 Unclassified 1107
174 Ga0495587_0023914 3300046536 Bacteria 3750
175 Ga0495587_0074114 3300046536 Bacteria 1977
176 Ga0495645_0006742 3300046543 Bacteria 7979
177 Ga0495645_0131189 3300046543 Bacteria 1756
178 Ga0495667_0021608 3300046559 Bacteria 4342
179 Ga0495635_0010656 3300046663 Bacteria 6437
180 Ga0495599_0027123 3300046678 Bacteria 3590
181 Ga0495623_0030028 3300046679 Bacteria 3498
182 Ga0495646_0009409 3300046680 Bacteria 6200
183 Ga0495613_0011970 3300046689 Bacteria 6447
184 Ga0495613_0280886 3300046689 Unclassified 1156
185 Ga0495604_0024253 3300047317 Bacteria 4840
186 Ga0495604_0213811 3300047317 Unclassified 1331
187 Ga0495674_0021222 3300047319 Bacteria 6009
188 Ga0495680_0012024 3300047322 Bacteria 7637
189 Ga0495675_0023485 3300047444 Bacteria 3929
190 Ga0495684_0057451 3300047471 Bacteria 2965
191 Ga0495602_0015321 3300048088 Bacteria 7745
192 Ga0495602_0048967 3300048088 Bacteria 3790
193 Ga0495602_0086043 3300048088 Bacteria 2625
194 Ga0496104_0423239 3300048907 Bacteria 1244
195 Ga0496112_0058022 3300048915 Bacteria 3811
196 Ga0496114_0271679 3300048917 Bacteria 1494
197 Ga0501047_0070762 3300049581 Unclassified 3359
198 Ga0501047_0093799 3300049581 Bacteria 2881
199 Ga0501044_0008328 3300049823 Bacteria 11361
200 nmdc:mga0n895_370713_c1 3300050512 Unclassified 1449
201 nmdc:mga0rr50_18242_c1 3300050513 Bacteria 4708
202 nmdc:mga08x19_4802_c1 3300050514 Bacteria 8009
203 Ga0501082_0322019 3300060353 Bacteria 1347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10001990 Ga0213876_100019905 272
2 3300039437 Ga0436365_1642251 Ga0436365_1642251_691_1653 272
3 3300005327 Ga0070658_10185269 Ga0070658_101852691 279
4 3300046535 Ga0495586_0208943 Ga0495586_0208943_18_878 282
5 3300021388 Ga0213875_10027553 Ga0213875_100275532 289
6 3300037853 Ga0436364_0372658 Ga0436364_0372658_1306_2271 289
7 3300039437 Ga0436365_1538719 Ga0436365_1538719_711_1676 289
8 3300021388 Ga0213875_10003116 Ga0213875_100031162 290
9 3300037853 Ga0436364_0387774 Ga0436364_0387774_34878_35843 290
10 3300006028 Ga0070717_10015953 Ga0070717_100159535 291
11 3300049581 Ga0501047_0070762 Ga0501047_0070762_367_1329 291
12 3300049823 Ga0501044_0008328 Ga0501044_0008328_1934_2896 291
13 3300009545 Ga0105237_10547075 Ga0105237_105470752 294
14 3300025914 Ga0207671_10054790 Ga0207671_100547902 294
15 3300036401 Ga0373937_0012144 Ga0373937_0012144_4055_5032 299
16 3300005458 Ga0070681_10001139 Ga0070681_1000113914 300
17 3300005518 Ga0070699_100017155 Ga0070699_1000171553 300
18 3300005546 Ga0070696_100004115 Ga0070696_1000041159 300
19 3300025912 Ga0207707_10018911 Ga0207707_100189116 300
20 3300025927 Ga0207687_10328664 Ga0207687_103286642 300
21 3300031090 Ga0265760_10018449 Ga0265760_100184492 301
22 3300005435 Ga0070714_100010044 Ga0070714_1000100448 302
23 3300005455 Ga0070663_100119109 Ga0070663_1001191092 304
24 3300005530 Ga0070679_100200990 Ga0070679_1002009902 304
25 3300006914 Ga0075436_100001482 Ga0075436_1000014828 304
26 3300007076 Ga0075435_100029693 Ga0075435_1000296932 304
27 3300035695 Ga0373927_0042806 Ga0373927_0042806_742_1719 304
28 3300037068 Ga0373925_0212859 Ga0373925_0212859_100_1068 304
29 3300047319 Ga0495674_0021222 Ga0495674_0021222_1126_2094 304
30 3300050513 nmdc:mga0rr50_18242_c1 nmdc:mga0rr50_18242_c1_2536_3513 304
31 3300050514 nmdc:mga08x19_4802_c1 nmdc:mga08x19_4802_c1_2372_3349 304
32 3300037853 Ga0436364_0433226 Ga0436364_0433226_834_1796 305
33 3300046472 Ga0495580_0049392 Ga0495580_0049392_469_1446 305
34 3300037853 Ga0436364_0129883 Ga0436364_0129883_1808_2767 306
35 3300039437 Ga0436365_1533501 Ga0436365_1533501_530_1456 306
36 3300021377 Ga0213874_10003683 Ga0213874_100036834 309
37 3300021384 Ga0213876_10003129 Ga0213876_100031294 309
38 3300039437 Ga0436365_0629880 Ga0436365_0629880_2711_3676 309
39 3300039450 Ga0436363_0324156 Ga0436363_0324156_7124_8089 309
40 3300005364 Ga0070673_100065065 Ga0070673_1000650654 311
41 3300005436 Ga0070713_100068015 Ga0070713_1000680152 311
42 3300025928 Ga0207700_10245362 Ga0207700_102453622 311
43 3300025960 Ga0207651_10392403 Ga0207651_103924032 311
44 3300010375 Ga0105239_10412470 Ga0105239_104124702 312
45 3300046679 Ga0495623_0030028 Ga0495623_0030028_1603_2559 314
46 3300047317 Ga0495604_0213811 Ga0495604_0213811_113_1069 314
47 3300047471 Ga0495684_0057451 Ga0495684_0057451_1729_2685 314
48 3300005329 Ga0070683_100000004 Ga0070683_100000004265 315
49 3300005535 Ga0070684_100000142 Ga0070684_1000001422 315
50 3300013105 Ga0157369_10014320 Ga0157369_100143204 315
51 3300014325 Ga0163163_10596486 Ga0163163_105964861 315
52 3300025944 Ga0207661_10000017 Ga0207661_10000017186 315
53 3300005434 Ga0070709_10248999 Ga0070709_102489992 316
54 3300005436 Ga0070713_100005234 Ga0070713_1000052344 316
55 3300005439 Ga0070711_100142232 Ga0070711_1001422322 316
56 3300006028 Ga0070717_10070920 Ga0070717_100709202 316
57 3300014325 Ga0163163_10052842 Ga0163163_100528422 316
58 3300025916 Ga0207663_10090795 Ga0207663_100907952 316
59 3300025929 Ga0207664_10046044 Ga0207664_100460442 316
60 3300035172 Ga0373955_0078842 Ga0373955_0078842_463_1434 316
61 3300035724 Ga0373933_0017766 Ga0373933_0017766_2162_3133 316
62 3300036401 Ga0373937_0005396 Ga0373937_0005396_4037_5008 316
63 3300037853 Ga0436364_0655704 Ga0436364_0655704_871_1830 316
64 3300046454 Ga0495592_0070484 Ga0495592_0070484_320_1291 316
65 3300046476 Ga0495662_0007635 Ga0495662_0007635_36_998 316
66 3300046511 Ga0495608_0091627 Ga0495608_0091627_689_1651 316
67 3300046516 Ga0495628_0022475 Ga0495628_0022475_2824_3786 316
68 3300046529 Ga0495652_0075700 Ga0495652_0075700_625_1587 316
69 3300046543 Ga0495645_0006742 Ga0495645_0006742_6508_7470 316
70 3300046543 Ga0495645_0131189 Ga0495645_0131189_199_1170 316
71 3300046663 Ga0495635_0010656 Ga0495635_0010656_4225_5187 316
72 3300046680 Ga0495646_0009409 Ga0495646_0009409_1355_2317 316
73 3300046689 Ga0495613_0011970 Ga0495613_0011970_1783_2745 316
74 3300048088 Ga0495602_0015321 Ga0495602_0015321_1152_2123 316
75 3300005366 Ga0070659_100013001 Ga0070659_1000130014 317
76 3300005366 Ga0070659_100111028 Ga0070659_1001110282 317
77 3300005457 Ga0070662_100233146 Ga0070662_1002331462 317
78 3300005539 Ga0068853_100017469 Ga0068853_1000174695 317
79 3300005563 Ga0068855_100010679 Ga0068855_1000106798 317
80 3300005614 Ga0068856_100002669 Ga0068856_1000026698 317
81 3300005614 Ga0068856_100005243 Ga0068856_1000052437 317
82 3300005614 Ga0068856_100010149 Ga0068856_1000101499 317
83 3300006237 Ga0097621_100055428 Ga0097621_1000554285 317
84 3300009545 Ga0105237_10410282 Ga0105237_104102822 317
85 3300013100 Ga0157373_10059440 Ga0157373_100594404 317
86 3300013104 Ga0157370_10228149 Ga0157370_102281492 317
87 3300013105 Ga0157369_10000445 Ga0157369_1000044542 317
88 3300013105 Ga0157369_10258789 Ga0157369_102587892 317
89 3300013296 Ga0157374_10235859 Ga0157374_102358592 317
90 3300013307 Ga0157372_10431842 Ga0157372_104318422 317
91 3300014969 Ga0157376_10216630 Ga0157376_102166302 317
92 3300021377 Ga0213874_10011814 Ga0213874_100118142 317
93 3300021388 Ga0213875_10049137 Ga0213875_100491372 317
94 3300025920 Ga0207649_10091047 Ga0207649_100910472 317
95 3300025932 Ga0207690_10068756 Ga0207690_100687562 317
96 3300025949 Ga0207667_10010914 Ga0207667_100109148 317
97 3300026041 Ga0207639_10079536 Ga0207639_100795362 317
98 3300026078 Ga0207702_10002191 Ga0207702_1000219110 317
99 3300026078 Ga0207702_10012608 Ga0207702_100126083 317
100 3300026078 Ga0207702_10045433 Ga0207702_100454332 317
101 3300037853 Ga0436364_0079190 Ga0436364_0079190_3706_4665 317
102 3300037853 Ga0436364_0584666 Ga0436364_0584666_4206_5168 317
103 3300037853 Ga0436364_1017775 Ga0436364_1017775_810_1772 317
104 3300039437 Ga0436365_0924186 Ga0436365_0924186_41_1003 317
105 3300039437 Ga0436365_1675064 Ga0436365_1675064_1036_1998 317
106 3300039437 Ga0436365_1833042 Ga0436365_1833042_865_1824 317
107 3300039450 Ga0436363_1357069 Ga0436363_1357069_2877_3839 317
108 3300048915 Ga0496112_0058022 Ga0496112_0058022_1701_2666 317
109 3300005329 Ga0070683_100246833 Ga0070683_1002468332 318
110 3300005436 Ga0070713_100057427 Ga0070713_1000574272 318
111 3300005466 Ga0070685_10120758 Ga0070685_101207581 318
112 3300009093 Ga0105240_10022688 Ga0105240_100226887 318
113 3300009177 Ga0105248_10106822 Ga0105248_101068222 318
114 3300009545 Ga0105237_10005452 Ga0105237_100054527 318
115 3300014325 Ga0163163_10073021 Ga0163163_100730212 318
116 3300021388 Ga0213875_10000019 Ga0213875_1000001963 318
117 3300021388 Ga0213875_10000416 Ga0213875_1000041615 318
118 3300025913 Ga0207695_10018384 Ga0207695_100183847 318
119 3300025928 Ga0207700_10206021 Ga0207700_102060212 318
120 3300036401 Ga0373937_0410013 Ga0373937_0410013_163_1134 318
121 3300037853 Ga0436364_0133805 Ga0436364_0133805_9255_10220 318
122 3300037853 Ga0436364_0366372 Ga0436364_0366372_163437_164405 318
123 3300037853 Ga0436364_0745246 Ga0436364_0745246_724_1689 318
124 3300037853 Ga0436364_1192730 Ga0436364_1192730_419_1384 318
125 3300039437 Ga0436365_0012738 Ga0436365_0012738_1650_2615 318
126 3300039450 Ga0436363_0164962 Ga0436363_0164962_415_1380 318
127 3300005329 Ga0070683_100052917 Ga0070683_1000529174 319
128 3300005436 Ga0070713_100024164 Ga0070713_1000241643 319
129 3300005436 Ga0070713_100041475 Ga0070713_1000414754 319
130 3300005456 Ga0070678_100096096 Ga0070678_1000960962 319
131 3300005535 Ga0070684_100066897 Ga0070684_1000668973 319
132 3300005617 Ga0068859_100132267 Ga0068859_1001322672 319
133 3300005618 Ga0068864_100177650 Ga0068864_1001776502 319
134 3300005841 Ga0068863_100214424 Ga0068863_1002144242 319
135 3300006237 Ga0097621_100281470 Ga0097621_1002814702 319
136 3300006358 Ga0068871_100206444 Ga0068871_1002064442 319
137 3300006931 Ga0097620_100132272 Ga0097620_1001322722 319
138 3300009176 Ga0105242_10133738 Ga0105242_101337382 319
139 3300009177 Ga0105248_10076987 Ga0105248_100769875 319
140 3300009177 Ga0105248_10186154 Ga0105248_101861542 319
141 3300010375 Ga0105239_10284886 Ga0105239_102848862 319
142 3300013306 Ga0163162_10077854 Ga0163162_100778543 319
143 3300013307 Ga0157372_10017081 Ga0157372_100170815 319
144 3300013308 Ga0157375_10625873 Ga0157375_106258731 319
145 3300014325 Ga0163163_10038285 Ga0163163_100382852 319
146 3300025906 Ga0207699_10037614 Ga0207699_100376142 319
147 3300025912 Ga0207707_10072459 Ga0207707_100724592 319
148 3300025913 Ga0207695_10028438 Ga0207695_100284385 319
149 3300025924 Ga0207694_10029436 Ga0207694_100294365 319
150 3300025928 Ga0207700_10099803 Ga0207700_100998033 319
151 3300025929 Ga0207664_10397063 Ga0207664_103970632 319
152 3300025941 Ga0207711_10188437 Ga0207711_101884372 319
153 3300026035 Ga0207703_10210346 Ga0207703_102103462 319
154 3300026088 Ga0207641_10192734 Ga0207641_101927342 319
155 3300026095 Ga0207676_10168470 Ga0207676_101684702 319
156 3300026121 Ga0207683_10144968 Ga0207683_101449682 319
157 3300030760 Ga0265762_1001397 Ga0265762_10013972 319
158 3300031238 Ga0265332_10120108 Ga0265332_101201081 319
159 3300031250 Ga0265331_10023095 Ga0265331_100230953 319
160 3300031344 Ga0265316_10007721 Ga0265316_100077215 319
161 3300031344 Ga0265316_10044965 Ga0265316_100449653 319
162 3300031712 Ga0265342_10059475 Ga0265342_100594752 319
163 3300036401 Ga0373937_0079161 Ga0373937_0079161_1120_2091 319
164 3300036401 Ga0373937_0148971 Ga0373937_0148971_382_1353 319
165 3300036401 Ga0373937_0434553 Ga0373937_0434553_134_1105 319
166 3300037853 Ga0436364_1501253 Ga0436364_1501253_176_1147 319
167 3300046454 Ga0495592_0002038 Ga0495592_0002038_6208_7179 319
168 3300046455 Ga0495603_0218560 Ga0495603_0218560_82_1053 319
169 3300046472 Ga0495580_0024604 Ga0495580_0024604_2131_3102 319
170 3300046477 Ga0495664_0000568 Ga0495664_0000568_6220_7191 319
171 3300046499 Ga0495594_0032571 Ga0495594_0032571_726_1697 319
172 3300046514 Ga0495618_0010745 Ga0495618_0010745_3469_4440 319
173 3300046529 Ga0495652_0134267 Ga0495652_0134267_126_1097 319
174 3300046533 Ga0495640_0007774 Ga0495640_0007774_5126_6097 319
175 3300046533 Ga0495640_0068592 Ga0495640_0068592_854_1825 319
176 3300046536 Ga0495587_0023914 Ga0495587_0023914_674_1645 319
177 3300046536 Ga0495587_0074114 Ga0495587_0074114_179_1150 319
178 3300046559 Ga0495667_0021608 Ga0495667_0021608_2776_3747 319
179 3300046678 Ga0495599_0027123 Ga0495599_0027123_1420_2391 319
180 3300046689 Ga0495613_0280886 Ga0495613_0280886_85_1056 319
181 3300047317 Ga0495604_0024253 Ga0495604_0024253_1518_2489 319
182 3300047322 Ga0495680_0012024 Ga0495680_0012024_3809_4780 319
183 3300047444 Ga0495675_0023485 Ga0495675_0023485_2657_3628 319
184 3300048088 Ga0495602_0048967 Ga0495602_0048967_1882_2853 319
185 3300048088 Ga0495602_0086043 Ga0495602_0086043_1066_2037 319
186 3300048907 Ga0496104_0423239 Ga0496104_0423239_170_1141 319
187 3300048917 Ga0496114_0271679 Ga0496114_0271679_133_1104 319
188 3300050512 nmdc:mga0n895_370713_c1 nmdc:mga0n895_370713_c1_24_995 319
189 3300005614 Ga0068856_100008613 Ga0068856_1000086138 320
190 3300026078 Ga0207702_10014297 Ga0207702_100142976 320
191 3300031242 Ga0265329_10029500 Ga0265329_100295002 320
192 3300005327 Ga0070658_10003822 Ga0070658_1000382210 321
193 3300005458 Ga0070681_10024662 Ga0070681_100246622 321
194 3300005563 Ga0068855_100035853 Ga0068855_1000358533 321
195 3300009093 Ga0105240_10000425 Ga0105240_1000042528 321
196 3300013307 Ga0157372_10011380 Ga0157372_100113805 321
197 3300025909 Ga0207705_10008918 Ga0207705_100089182 321
198 3300025912 Ga0207707_10197091 Ga0207707_101970912 321
199 3300025917 Ga0207660_10037588 Ga0207660_100375882 321
200 3300025921 Ga0207652_10031628 Ga0207652_100316286 321
201 3300025949 Ga0207667_10055419 Ga0207667_100554196 321
202 3300049581 Ga0501047_0093799 Ga0501047_0093799_556_1521 321
203 3300060353 Ga0501082_0322019 Ga0501082_0322019_193_1161 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

155

282

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8417 147 249
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.828 147 259
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8275 147 254
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.826 147 252
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8258 147 259
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8329 154 279 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8254 147 255 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8154 154 279 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7978 147 255 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7844 140 246 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A537VPR9-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9416 122 321 GO:0005886
AF-A0A537VPR9-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9327 122 321 GO:0005886
AF-A0A7V0XEU4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9315 130 321 GO:0005886
AF-A0A7V0XEU4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9224 130 321 GO:0005886
AF-A0A838ERJ6-F1-model_v4 Type II secretion system F family protein 0.9103 70 321 GO:0005886

Feature Viewer

pLDDT pTM Quality
82.37 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map