F312231

General Info

Members Datasets Scaffolds Average Seq Length
204 126 204 246

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100037055|Ga0070698_1000370552
Length 282
Sequence MPWWRDRRRASENDAATQSSAASTVFLRSGPYNCCPVHRFFAPALDPGDETVMLPRDEAEHLTRVLRLGVGDTVAIFDGRGHEFLARVASAARRDVRVQLLTRVEPAAEPPVPLTLAQAVLKADKMDDVVRDAVMLGVAAIQPLVTKRSETTVAALARGARRDRWTRVALASVKQSRRATLPDIRTPLTLEGYLSEPGPLLRLMFIEPGAGASVQTLAVLRNRPAPSDAAILVGPEGGWDEEEWTAAQAQGVELVTLGHRTLRADAVPIAAISILQFLWDSG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
82 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
83 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
84 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10004151 3300005293 Bacteria 5545
2 Ga0070670_100486448 3300005331 Bacteria 1096
3 Ga0068869_100122412 3300005334 Unclassified 1991
4 Ga0068869_100404736 3300005334 Bacteria 1123
5 Ga0070666_10179454 3300005335 Bacteria 1485
6 Ga0068868_100156644 3300005338 Bacteria 1879
7 Ga0070689_100030081 3300005340 Bacteria 4118
8 Ga0070689_100056137 3300005340 Unclassified 3053
9 Ga0070671_100105360 3300005355 Bacteria 2367
10 Ga0070673_100005141 3300005364 Bacteria 8347
11 Ga0070688_100006828 3300005365 Bacteria 6122
12 Ga0070688_100421815 3300005365 Bacteria 992
13 Ga0070667_100050066 3300005367 Bacteria 3519
14 Ga0070714_100004063 3300005435 Bacteria 10996
15 Ga0070711_100459847 3300005439 Bacteria 1043
16 Ga0070694_100005411 3300005444 Bacteria 7727
17 Ga0070708_100078482 3300005445 Unclassified 2985
18 Ga0070708_100157378 3300005445 Bacteria 2116
19 Ga0070708_100256872 3300005445 Unclassified 1642
20 Ga0070678_100047136 3300005456 Unclassified 3095
21 Ga0070707_100054553 3300005468 Bacteria 3832
22 Ga0070707_100089899 3300005468 Bacteria 2972
23 Ga0070698_100037055 3300005471 Bacteria 5030
24 Ga0070698_100100638 3300005471 Bacteria 2863
25 Ga0070698_100176627 3300005471 Bacteria 2075
26 Ga0070699_100002361 3300005518 Bacteria 16930
27 Ga0070699_100105514 3300005518 Unclassified 2472
28 Ga0070699_100200024 3300005518 Bacteria 1776
29 Ga0070699_100230635 3300005518 Bacteria 1651
30 Ga0070699_100580708 3300005518 Bacteria 1021
31 Ga0070697_100138710 3300005536 Bacteria 2044
32 Ga0070697_100338052 3300005536 Unclassified 1299
33 Ga0070672_100101719 3300005543 Bacteria 2331
34 Ga0070672_100257104 3300005543 Bacteria 1472
35 Ga0070686_100358917 3300005544 Bacteria 1097
36 Ga0070695_100003611 3300005545 Bacteria 9029
37 Ga0070695_100107002 3300005545 Bacteria 1892
38 Ga0070696_100452842 3300005546 Unclassified 1013
39 Ga0070665_100017847 3300005548 Bacteria 7124
40 Ga0070704_100087004 3300005549 Bacteria 2318
41 Ga0070704_100412371 3300005549 Bacteria 1155
42 Ga0068855_100151990 3300005563 Bacteria 2632
43 Ga0068854_100417207 3300005578 Unclassified 1114
44 Ga0070702_100276369 3300005615 Unclassified 1151
45 Ga0068859_100618383 3300005617 Bacteria 1176
46 Ga0068864_100247144 3300005618 Unclassified 1655
47 Ga0068866_10268158 3300005718 Unclassified 1052
48 Ga0068851_10136733 3300005834 Bacteria 1329
49 Ga0068858_100154520 3300005842 Bacteria 2159
50 Ga0068858_100337414 3300005842 Unclassified 1442
51 Ga0068860_100270654 3300005843 Bacteria 1658
52 Ga0068860_100778890 3300005843 Unclassified 969
53 Ga0068862_100117923 3300005844 Bacteria 2336
54 Ga0068871_100003518 3300006358 Bacteria 10778
55 Ga0068871_100089569 3300006358 Bacteria 2561
56 Ga0068871_100270302 3300006358 Unclassified 1485
57 Ga0075428_100566910 3300006844 Bacteria 1213
58 Ga0075433_10046504 3300006852 Bacteria 3775
59 Ga0075433_10050345 3300006852 Bacteria 3626
60 Ga0075434_100013104 3300006871 Bacteria 7873
61 Ga0075434_100026504 3300006871 Bacteria 5679
62 Ga0075434_100027370 3300006871 Bacteria 5597
63 Ga0075434_100698346 3300006871 Unclassified 1032
64 Ga0068865_100012501 3300006881 Bacteria 5344
65 Ga0075436_100025075 3300006914 Bacteria 4100
66 Ga0075436_100089796 3300006914 Unclassified 2135
67 Ga0075436_100104194 3300006914 Bacteria 1977
68 Ga0097620_100618397 3300006931 Bacteria 1176
69 Ga0075435_100006626 3300007076 Bacteria 8204
70 Ga0075435_100011641 3300007076 Bacteria 6484
71 Ga0075435_100042669 3300007076 Bacteria 3629
72 Ga0075435_100128300 3300007076 Bacteria 2121
73 Ga0075435_100191078 3300007076 Bacteria 1733
74 Ga0105240_10056272 3300009093 Bacteria 4922
75 Ga0111539_10031302 3300009094 Bacteria 6463
76 Ga0111539_10043073 3300009094 Bacteria 5414
77 Ga0105245_10085457 3300009098 Bacteria 2892
78 Ga0114129_10005815 3300009147 Bacteria 17467
79 Ga0114129_10009041 3300009147 Bacteria 14197
80 Ga0114129_10009110 3300009147 Bacteria 14147
81 Ga0114129_10087289 3300009147 Bacteria 4326
82 Ga0114129_10236603 3300009147 Bacteria 2457
83 Ga0114129_10290786 3300009147 Bacteria 2181
84 Ga0114129_10316756 3300009147 Bacteria 2074
85 Ga0114129_11133949 3300009147 Unclassified 977
86 Ga0105242_10019826 3300009176 Bacteria 5268
87 Ga0105248_10111817 3300009177 Unclassified 3081
88 Ga0105248_10116519 3300009177 Bacteria 3013
89 Ga0105248_10162122 3300009177 Bacteria 2522
90 Ga0105248_10174470 3300009177 Bacteria 2423
91 Ga0105238_10080136 3300009551 Bacteria 3255
92 Ga0157369_10412019 3300013105 Bacteria 1401
93 Ga0157378_10032946 3300013297 Bacteria 4580
94 Ga0157378_10935386 3300013297 Unclassified 899
95 Ga0163162_10030323 3300013306 Bacteria 5359
96 Ga0157375_11225469 3300013308 Unclassified 881
97 Ga0163163_10122062 3300014325 Unclassified 2640
98 Ga0163163_10343312 3300014325 Bacteria 1549
99 Ga0163163_10935358 3300014325 Unclassified 930
100 Ga0157380_10042447 3300014326 Bacteria 3556
101 Ga0157380_10185991 3300014326 Bacteria 1830
102 Ga0157379_10004296 3300014968 Bacteria 12177
103 Ga0157379_10028725 3300014968 Bacteria 4946
104 Ga0157376_10030993 3300014969 Unclassified 4277
105 Ga0157376_10094706 3300014969 Bacteria 2595
106 Ga0207680_10058159 3300025903 Unclassified 2342
107 Ga0207663_10560478 3300025916 Unclassified 894
108 Ga0207662_10267851 3300025918 Unclassified 1126
109 Ga0207646_10008835 3300025922 Bacteria 10043
110 Ga0207646_10182678 3300025922 Bacteria 1894
111 Ga0207681_10016026 3300025923 Bacteria 4681
112 Ga0207650_10736606 3300025925 Bacteria 834
113 Ga0207664_10089905 3300025929 Bacteria 2515
114 Ga0207644_10012829 3300025931 Bacteria 5573
115 Ga0207644_10296410 3300025931 Bacteria 1302
116 Ga0207686_10186814 3300025934 Bacteria 1474
117 Ga0207686_10446955 3300025934 Unclassified 994
118 Ga0207670_10072933 3300025936 Bacteria 2379
119 Ga0207704_10014894 3300025938 Unclassified 3944
120 Ga0207691_10023566 3300025940 Bacteria 5796
121 Ga0207691_10344482 3300025940 Bacteria 1275
122 Ga0207711_10225196 3300025941 Bacteria 1716
123 Ga0207711_10360971 3300025941 Bacteria 1346
124 Ga0207689_10188611 3300025942 Unclassified 1701
125 Ga0207651_10180260 3300025960 Bacteria 1675
126 Ga0207703_10513273 3300026035 Bacteria 1126
127 Ga0207676_10462424 3300026095 Unclassified 1198
128 Ga0207683_10301395 3300026121 Bacteria 1466
129 Ga0268266_10012450 3300028379 Bacteria 7352
130 Ga0268266_10739965 3300028379 Unclassified 949
131 Ga0268265_10289537 3300028380 Bacteria 1470
132 Ga0268264_10045228 3300028381 Bacteria 3655
133 Ga0373930_0001079 3300034816 Unclassified 3943
134 Ga0373948_0000872 3300034817 Bacteria 4008
135 Ga0373950_0001380 3300034818 Bacteria 3158
136 Ga0373928_0058873 3300035084 Bacteria 924
137 Ga0373951_0000587 3300035091 Bacteria 10052
138 Ga0373932_0001750 3300035112 Bacteria 5876
139 Ga0373939_0000629 3300035114 Bacteria 8771
140 Ga0373941_0000065 3300035115 Bacteria 16423
141 Ga0373941_0019187 3300035115 Bacteria 1900
142 Ga0373956_0166804 3300035119 Bacteria 1039
143 Ga0373960_0000092 3300035121 Bacteria 13839
144 Ga0373942_0000398 3300035207 Bacteria 12063
145 Ga0373961_0001869 3300035241 Bacteria 5737
146 Ga0373962_0007388 3300035242 Bacteria 2690
147 Ga0373931_0009570 3300035691 Bacteria 4635
148 Ga0373947_0317634 3300035725 Bacteria 1041
149 Ga0373937_0197128 3300036401 Bacteria 1893
150 Ga0373925_0081788 3300037068 Bacteria 2457
151 Ga0450916_014620 3300042530 Bacteria 1024
152 Ga0451576_0106633 3300045051 Bacteria 2915
153 Ga0451576_0413605 3300045051 Archaea 1415
154 Ga0451576_0758981 3300045051 Bacteria 1019
155 Ga0451576_0765627 3300045051 Bacteria 1014
156 Ga0466967_0637431 3300045976 Unclassified 1053
157 Ga0495652_0303005 3300046529 Unclassified 1161
158 Ga0495640_0117064 3300046533 Unclassified 1735
159 Ga0495621_0015061 3300046539 Bacteria 2460
160 Ga0495645_0007571 3300046543 Bacteria 7555
161 Ga0495667_0345687 3300046559 Bacteria 940
162 Ga0495656_0190928 3300046615 Unclassified 1012
163 Ga0495658_0121732 3300046683 Bacteria 1579
164 Ga0495669_0030611 3300046684 Bacteria 2363
165 Ga0496107_0058518 3300048910 Bacteria 2787
166 Ga0496109_0255286 3300048912 Bacteria 1651
167 Ga0496112_0519278 3300048915 Bacteria 1126
168 Ga0501034_0028992 3300049571 Bacteria 5629
169 Ga0501043_0337772 3300049579 Bacteria 1146
170 Ga0501047_0020209 3300049581 Bacteria 6394
171 Ga0501070_0268760 3300049586 Bacteria 1393
172 Ga0501071_0347962 3300049587 Bacteria 1128
173 Ga0501073_0138713 3300049589 Bacteria 1685
174 Ga0501073_0186865 3300049589 Bacteria 1434
175 Ga0501080_0482480 3300049742 Unclassified 1109
176 Ga0501083_0258684 3300049744 Bacteria 1133
177 Ga0501044_0005869 3300049823 Bacteria 13604
178 nmdc:mga05p37_184918_c1 3300050507 Bacteria 2534
179 nmdc:mga05p37_224947_c1 3300050507 Bacteria 2263
180 nmdc:mga05p37_257816_c1 3300050507 Bacteria 2089
181 nmdc:mga05p37_386278_c1 3300050507 Bacteria 1639
182 nmdc:mga05p37_4912_c1 3300050507 Bacteria 15656
183 nmdc:mga05p37_574688_c1 3300050507 Unclassified 1278
184 nmdc:mga05p37_70346_c1 3300050507 Bacteria 4304
185 nmdc:mga05p37_980264_c1 3300050507 Bacteria 901
186 nmdc:mga08y16_180040_c1 3300050511 Bacteria 2195
187 nmdc:mga08y16_22172_c1 3300050511 Bacteria 6704
188 nmdc:mga08y16_45739_c1 3300050511 Bacteria 4585
189 nmdc:mga0n895_27247_c1 3300050512 Bacteria 5426
190 nmdc:mga0n895_460449_c1 3300050512 Bacteria 1284
191 nmdc:mga0n895_557959_c1 3300050512 Bacteria 1151
192 nmdc:mga0rr50_103916_c1 3300050513 Bacteria 2237
193 nmdc:mga0rr50_169541_c1 3300050513 Unclassified 1778
194 nmdc:mga0rr50_18453_c1 3300050513 Bacteria 4688
195 nmdc:mga08x19_281345_c1 3300050514 Bacteria 1153
196 nmdc:mga08x19_48610_c1 3300050514 Bacteria 2718
197 nmdc:mga08x19_59939_c1 3300050514 Unclassified 2465
198 nmdc:mga08x19_81533_c1 3300050514 Bacteria 2125
199 nmdc:mga0a205_20402_c1 3300050515 Bacteria 4273
200 nmdc:mga0a205_35932_c1 3300050515 Bacteria 4759
201 nmdc:mga0a205_5457_c2 3300050515 Bacteria 9974
202 nmdc:mga0a205_60420_c1 3300050515 Bacteria 3661
203 nmdc:mga0a205_65063_c1 3300050515 Bacteria 3522
204 Ga0495619_0071301 3300053085 Bacteria 2325

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10935386 Ga0157378_109353861 221
2 3300009177 Ga0105248_10111817 Ga0105248_101118171 222
3 3300013308 Ga0157375_11225469 Ga0157375_112254691 222
4 3300025934 Ga0207686_10446955 Ga0207686_104469551 222
5 3300005445 Ga0070708_100078482 Ga0070708_1000784822 223
6 3300046533 Ga0495640_0117064 Ga0495640_0117064_521_1264 223
7 3300005578 Ga0068854_100417207 Ga0068854_1004172072 224
8 3300025918 Ga0207662_10267851 Ga0207662_102678511 224
9 3300026035 Ga0207703_10513273 Ga0207703_105132731 224
10 3300005842 Ga0068858_100337414 Ga0068858_1003374141 226
11 3300048915 Ga0496112_0519278 Ga0496112_0519278_302_1051 227
12 3300049587 Ga0501071_0347962 Ga0501071_0347962_390_1109 227
13 3300005445 Ga0070708_100256872 Ga0070708_1002568721 228
14 3300035119 Ga0373956_0166804 Ga0373956_0166804_108_848 229
15 3300046529 Ga0495652_0303005 Ga0495652_0303005_354_1094 229
16 3300046543 Ga0495645_0007571 Ga0495645_0007571_2421_3161 229
17 3300046559 Ga0495667_0345687 Ga0495667_0345687_132_872 229
18 3300053085 Ga0495619_0071301 Ga0495619_0071301_520_1260 229
19 3300005518 Ga0070699_100230635 Ga0070699_1002306352 232
20 3300009093 Ga0105240_10056272 Ga0105240_100562721 234
21 3300046684 Ga0495669_0030611 Ga0495669_0030611_158_922 238
22 3300005518 Ga0070699_100002361 Ga0070699_1000023613 240
23 3300006871 Ga0075434_100698346 Ga0075434_1006983461 240
24 3300007076 Ga0075435_100191078 Ga0075435_1001910782 240
25 3300045051 Ga0451576_0413605 Ga0451576_0413605_243_986 240
26 3300005334 Ga0068869_100404736 Ga0068869_1004047362 241
27 3300005355 Ga0070671_100105360 Ga0070671_1001053601 241
28 3300005365 Ga0070688_100421815 Ga0070688_1004218151 241
29 3300005367 Ga0070667_100050066 Ga0070667_1000500663 241
30 3300005439 Ga0070711_100459847 Ga0070711_1004598471 241
31 3300005518 Ga0070699_100580708 Ga0070699_1005807081 241
32 3300005543 Ga0070672_100101719 Ga0070672_1001017193 241
33 3300005544 Ga0070686_100358917 Ga0070686_1003589172 241
34 3300005549 Ga0070704_100412371 Ga0070704_1004123712 241
35 3300005615 Ga0070702_100276369 Ga0070702_1002763691 241
36 3300005842 Ga0068858_100154520 Ga0068858_1001545201 241
37 3300005843 Ga0068860_100270654 Ga0068860_1002706542 241
38 3300005844 Ga0068862_100117923 Ga0068862_1001179232 241
39 3300006844 Ga0075428_100566910 Ga0075428_1005669101 241
40 3300006852 Ga0075433_10046504 Ga0075433_100465041 241
41 3300006852 Ga0075433_10050345 Ga0075433_100503452 241
42 3300006871 Ga0075434_100013104 Ga0075434_1000131045 241
43 3300006871 Ga0075434_100027370 Ga0075434_1000273702 241
44 3300007076 Ga0075435_100006626 Ga0075435_1000066267 241
45 3300009147 Ga0114129_10009041 Ga0114129_100090417 241
46 3300009147 Ga0114129_10087289 Ga0114129_100872894 241
47 3300009147 Ga0114129_10290786 Ga0114129_102907862 241
48 3300009147 Ga0114129_10316756 Ga0114129_103167562 241
49 3300009177 Ga0105248_10116519 Ga0105248_101165193 241
50 3300013306 Ga0163162_10030323 Ga0163162_100303232 241
51 3300014326 Ga0157380_10042447 Ga0157380_100424472 241
52 3300014968 Ga0157379_10028725 Ga0157379_100287251 241
53 3300014969 Ga0157376_10094706 Ga0157376_100947062 241
54 3300025916 Ga0207663_10560478 Ga0207663_105604781 241
55 3300025923 Ga0207681_10016026 Ga0207681_100160261 241
56 3300025931 Ga0207644_10012829 Ga0207644_100128293 241
57 3300025931 Ga0207644_10296410 Ga0207644_102964102 241
58 3300025936 Ga0207670_10072933 Ga0207670_100729332 241
59 3300025940 Ga0207691_10023566 Ga0207691_100235666 241
60 3300025940 Ga0207691_10344482 Ga0207691_103444822 241
61 3300025941 Ga0207711_10225196 Ga0207711_102251962 241
62 3300025960 Ga0207651_10180260 Ga0207651_101802601 241
63 3300026121 Ga0207683_10301395 Ga0207683_103013953 241
64 3300028381 Ga0268264_10045228 Ga0268264_100452282 241
65 3300035725 Ga0373947_0317634 Ga0373947_0317634_256_999 241
66 3300045051 Ga0451576_0758981 Ga0451576_0758981_211_957 241
67 3300046615 Ga0495656_0190928 Ga0495656_0190928_155_901 241
68 3300048910 Ga0496107_0058518 Ga0496107_0058518_238_984 241
69 3300048912 Ga0496109_0255286 Ga0496109_0255286_863_1609 241
70 3300050507 nmdc:mga05p37_184918_c1 nmdc:mga05p37_184918_c1_1342_2088 241
71 3300050507 nmdc:mga05p37_257816_c1 nmdc:mga05p37_257816_c1_284_1021 241
72 3300050507 nmdc:mga05p37_70346_c1 nmdc:mga05p37_70346_c1_884_1630 241
73 3300050507 nmdc:mga05p37_980264_c1 nmdc:mga05p37_980264_c1_108_854 241
74 3300050512 nmdc:mga0n895_27247_c1 nmdc:mga0n895_27247_c1_2353_3099 241
75 3300050512 nmdc:mga0n895_460449_c1 nmdc:mga0n895_460449_c1_464_1201 241
76 3300050513 nmdc:mga0rr50_169541_c1 nmdc:mga0rr50_169541_c1_121_858 241
77 3300050515 nmdc:mga0a205_20402_c1 nmdc:mga0a205_20402_c1_1953_2699 241
78 3300050515 nmdc:mga0a205_5457_c2 nmdc:mga0a205_5457_c2_3623_4360 241
79 3300005331 Ga0070670_100486448 Ga0070670_1004864481 242
80 3300005334 Ga0068869_100122412 Ga0068869_1001224122 242
81 3300005340 Ga0070689_100056137 Ga0070689_1000561372 242
82 3300005365 Ga0070688_100006828 Ga0070688_1000068286 242
83 3300005444 Ga0070694_100005411 Ga0070694_1000054112 242
84 3300005445 Ga0070708_100157378 Ga0070708_1001573782 242
85 3300005456 Ga0070678_100047136 Ga0070678_1000471363 242
86 3300005468 Ga0070707_100054553 Ga0070707_1000545533 242
87 3300005468 Ga0070707_100089899 Ga0070707_1000898992 242
88 3300005471 Ga0070698_100100638 Ga0070698_1001006382 242
89 3300005471 Ga0070698_100176627 Ga0070698_1001766271 242
90 3300005536 Ga0070697_100138710 Ga0070697_1001387101 242
91 3300005536 Ga0070697_100338052 Ga0070697_1003380522 242
92 3300005543 Ga0070672_100257104 Ga0070672_1002571042 242
93 3300005545 Ga0070695_100003611 Ga0070695_1000036115 242
94 3300005546 Ga0070696_100452842 Ga0070696_1004528421 242
95 3300005548 Ga0070665_100017847 Ga0070665_1000178475 242
96 3300005549 Ga0070704_100087004 Ga0070704_1000870042 242
97 3300005563 Ga0068855_100151990 Ga0068855_1001519901 242
98 3300005617 Ga0068859_100618383 Ga0068859_1006183831 242
99 3300005618 Ga0068864_100247144 Ga0068864_1002471442 242
100 3300005718 Ga0068866_10268158 Ga0068866_102681581 242
101 3300005834 Ga0068851_10136733 Ga0068851_101367332 242
102 3300005843 Ga0068860_100778890 Ga0068860_1007788901 242
103 3300006358 Ga0068871_100003518 Ga0068871_1000035187 242
104 3300006358 Ga0068871_100270302 Ga0068871_1002703021 242
105 3300006871 Ga0075434_100026504 Ga0075434_1000265043 242
106 3300006881 Ga0068865_100012501 Ga0068865_1000125013 242
107 3300006914 Ga0075436_100025075 Ga0075436_1000250752 242
108 3300006914 Ga0075436_100089796 Ga0075436_1000897961 242
109 3300006914 Ga0075436_100104194 Ga0075436_1001041943 242
110 3300006931 Ga0097620_100618397 Ga0097620_1006183972 242
111 3300007076 Ga0075435_100011641 Ga0075435_1000116414 242
112 3300007076 Ga0075435_100042669 Ga0075435_1000426693 242
113 3300007076 Ga0075435_100128300 Ga0075435_1001283003 242
114 3300009094 Ga0111539_10031302 Ga0111539_100313024 242
115 3300009094 Ga0111539_10043073 Ga0111539_100430732 242
116 3300009098 Ga0105245_10085457 Ga0105245_100854572 242
117 3300009147 Ga0114129_10005815 Ga0114129_100058157 242
118 3300009147 Ga0114129_10009110 Ga0114129_1000911012 242
119 3300009147 Ga0114129_10236603 Ga0114129_102366032 242
120 3300009147 Ga0114129_11133949 Ga0114129_111339491 242
121 3300009176 Ga0105242_10019826 Ga0105242_100198262 242
122 3300009177 Ga0105248_10162122 Ga0105248_101621222 242
123 3300009551 Ga0105238_10080136 Ga0105238_100801362 242
124 3300013105 Ga0157369_10412019 Ga0157369_104120192 242
125 3300014325 Ga0163163_10122062 Ga0163163_101220622 242
126 3300014325 Ga0163163_10343312 Ga0163163_103433122 242
127 3300014325 Ga0163163_10935358 Ga0163163_109353581 242
128 3300014326 Ga0157380_10185991 Ga0157380_101859912 242
129 3300014968 Ga0157379_10004296 Ga0157379_100042969 242
130 3300014969 Ga0157376_10030993 Ga0157376_100309933 242
131 3300025903 Ga0207680_10058159 Ga0207680_100581592 242
132 3300025922 Ga0207646_10008835 Ga0207646_100088358 242
133 3300025922 Ga0207646_10182678 Ga0207646_101826782 242
134 3300025925 Ga0207650_10736606 Ga0207650_107366061 242
135 3300025934 Ga0207686_10186814 Ga0207686_101868142 242
136 3300025938 Ga0207704_10014894 Ga0207704_100148942 242
137 3300025941 Ga0207711_10360971 Ga0207711_103609711 242
138 3300025942 Ga0207689_10188611 Ga0207689_101886112 242
139 3300026095 Ga0207676_10462424 Ga0207676_104624242 242
140 3300028379 Ga0268266_10012450 Ga0268266_100124505 242
141 3300028379 Ga0268266_10739965 Ga0268266_107399651 242
142 3300028380 Ga0268265_10289537 Ga0268265_102895371 242
143 3300034816 Ga0373930_0001079 Ga0373930_0001079_3043_3783 242
144 3300034817 Ga0373948_0000872 Ga0373948_0000872_938_1678 242
145 3300034818 Ga0373950_0001380 Ga0373950_0001380_792_1532 242
146 3300035084 Ga0373928_0058873 Ga0373928_0058873_88_828 242
147 3300035091 Ga0373951_0000587 Ga0373951_0000587_6766_7506 242
148 3300035112 Ga0373932_0001750 Ga0373932_0001750_2220_2960 242
149 3300035114 Ga0373939_0000629 Ga0373939_0000629_524_1264 242
150 3300035115 Ga0373941_0000065 Ga0373941_0000065_3415_4155 242
151 3300035115 Ga0373941_0019187 Ga0373941_0019187_981_1721 242
152 3300035121 Ga0373960_0000092 Ga0373960_0000092_3248_3988 242
153 3300035207 Ga0373942_0000398 Ga0373942_0000398_17_757 242
154 3300035241 Ga0373961_0001869 Ga0373961_0001869_3041_3781 242
155 3300035242 Ga0373962_0007388 Ga0373962_0007388_1251_1991 242
156 3300035691 Ga0373931_0009570 Ga0373931_0009570_3040_3780 242
157 3300036401 Ga0373937_0197128 Ga0373937_0197128_382_1122 242
158 3300037068 Ga0373925_0081788 Ga0373925_0081788_1288_2028 242
159 3300042530 Ga0450916_014620 Ga0450916_014620_40_783 242
160 3300045051 Ga0451576_0106633 Ga0451576_0106633_1230_1970 242
161 3300045051 Ga0451576_0765627 Ga0451576_0765627_157_912 242
162 3300046539 Ga0495621_0015061 Ga0495621_0015061_1282_2022 242
163 3300046683 Ga0495658_0121732 Ga0495658_0121732_56_796 242
164 3300049571 Ga0501034_0028992 Ga0501034_0028992_78_824 242
165 3300049579 Ga0501043_0337772 Ga0501043_0337772_350_1096 242
166 3300049581 Ga0501047_0020209 Ga0501047_0020209_3440_4186 242
167 3300049586 Ga0501070_0268760 Ga0501070_0268760_234_980 242
168 3300049589 Ga0501073_0138713 Ga0501073_0138713_346_1101 242
169 3300049589 Ga0501073_0186865 Ga0501073_0186865_420_1166 242
170 3300049742 Ga0501080_0482480 Ga0501080_0482480_136_891 242
171 3300049744 Ga0501083_0258684 Ga0501083_0258684_182_928 242
172 3300049823 Ga0501044_0005869 Ga0501044_0005869_10226_10972 242
173 3300050507 nmdc:mga05p37_224947_c1 nmdc:mga05p37_224947_c1_436_1185 242
174 3300050507 nmdc:mga05p37_386278_c1 nmdc:mga05p37_386278_c1_285_1034 242
175 3300050507 nmdc:mga05p37_4912_c1 nmdc:mga05p37_4912_c1_7862_8602 242
176 3300050507 nmdc:mga05p37_574688_c1 nmdc:mga05p37_574688_c1_506_1246 242
177 3300050511 nmdc:mga08y16_180040_c1 nmdc:mga08y16_180040_c1_603_1343 242
178 3300050511 nmdc:mga08y16_22172_c1 nmdc:mga08y16_22172_c1_5190_5930 242
179 3300050511 nmdc:mga08y16_45739_c1 nmdc:mga08y16_45739_c1_2993_3808 242
180 3300050512 nmdc:mga0n895_557959_c1 nmdc:mga0n895_557959_c1_364_1104 242
181 3300050513 nmdc:mga0rr50_103916_c1 nmdc:mga0rr50_103916_c1_1425_2165 242
182 3300050513 nmdc:mga0rr50_18453_c1 nmdc:mga0rr50_18453_c1_1412_2152 242
183 3300050514 nmdc:mga08x19_281345_c1 nmdc:mga08x19_281345_c1_40_858 242
184 3300050514 nmdc:mga08x19_48610_c1 nmdc:mga08x19_48610_c1_1494_2234 242
185 3300050514 nmdc:mga08x19_59939_c1 nmdc:mga08x19_59939_c1_181_921 242
186 3300050514 nmdc:mga08x19_81533_c1 nmdc:mga08x19_81533_c1_241_981 242
187 3300050515 nmdc:mga0a205_35932_c1 nmdc:mga0a205_35932_c1_2295_3044 242
188 3300050515 nmdc:mga0a205_60420_c1 nmdc:mga0a205_60420_c1_259_999 242
189 3300050515 nmdc:mga0a205_65063_c1 nmdc:mga0a205_65063_c1_1435_2175 242
190 3300005293 Ga0065715_10004151 Ga0065715_100041516 243
191 3300005335 Ga0070666_10179454 Ga0070666_101794542 243
192 3300005338 Ga0068868_100156644 Ga0068868_1001566441 243
193 3300005340 Ga0070689_100030081 Ga0070689_1000300812 243
194 3300005364 Ga0070673_100005141 Ga0070673_1000051413 243
195 3300005435 Ga0070714_100004063 Ga0070714_1000040637 243
196 3300005471 Ga0070698_100037055 Ga0070698_1000370552 243
197 3300005518 Ga0070699_100105514 Ga0070699_1001055142 243
198 3300005518 Ga0070699_100200024 Ga0070699_1002000242 243
199 3300005545 Ga0070695_100107002 Ga0070695_1001070022 243
200 3300006358 Ga0068871_100089569 Ga0068871_1000895692 243
201 3300009177 Ga0105248_10174470 Ga0105248_101744702 243
202 3300013297 Ga0157378_10032946 Ga0157378_100329464 243
203 3300025929 Ga0207664_10089905 Ga0207664_100899054 243
204 3300045976 Ga0466967_0637431 Ga0466967_0637431_84_854 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20260

PUA_4

RNA methyltransferase PUA domain

54

101

0.95

PF04452

Methyltrans_RNA

RNA methyltransferase domain

108

276

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vm8-assembly3.cif.gz_B crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine 0.9002 1 240
1nxz-assembly1.cif.gz_B x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. 0.8891 1 240
5o96-assembly4.cif.gz_G structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam 0.8827 1 238
1vhy-assembly3.cif.gz_A crystal structure of haemophilus influenzae protein hi0303, pfam duf558 0.8824 2 240
5vm8-assembly3.cif.gz_B crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine 0.8824 1 240
ID Description Score Start End Superfamily
1z85B01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.9328 4 69 2.40.240.20
5vm8B02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9327 73 240 3.40.1280.10
5o96E02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9177 73 238 3.40.1280.10
1vhkA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9153 73 238 3.40.1280.10
2egwA02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9146 73 236 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2V8A9D5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9493 4 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A6L8GK35-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.9466 2 201 GO:0005737
GO:0070042
GO:0070475
AF-A0A3N5NJ30-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9353 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A520W710-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.935 1 243 GO:0005737
GO:0070042
GO:0070475
AF-A0A2V8A9D5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9343 4 243 GO:0005737
GO:0070042
GO:0070475

Feature Viewer

pLDDT pTM Quality
90.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map