F312231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 204 | 126 | 204 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100037055|Ga0070698_1000370552 |
| Length | 282 |
| Sequence | MPWWRDRRRASENDAATQSSAASTVFLRSGPYNCCPVHRFFAPALDPGDETVMLPRDEAEHLTRVLRLGVGDTVAIFDGRGHEFLARVASAARRDVRVQLLTRVEPAAEPPVPLTLAQAVLKADKMDDVVRDAVMLGVAAIQPLVTKRSETTVAALARGARRDRWTRVALASVKQSRRATLPDIRTPLTLEGYLSEPGPLLRLMFIEPGAGASVQTLAVLRNRPAPSDAAILVGPEGGWDEEEWTAAQAQGVELVTLGHRTLRADAVPIAAISILQFLWDSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 81 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 82 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 84 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 85 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 87 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 90 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 95 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 98 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 99 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 100 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 109 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.47 |
| Rhizosphere | 98.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10004151 | 3300005293 | Bacteria | 5545 |
| 2 | Ga0070670_100486448 | 3300005331 | Bacteria | 1096 |
| 3 | Ga0068869_100122412 | 3300005334 | Unclassified | 1991 |
| 4 | Ga0068869_100404736 | 3300005334 | Bacteria | 1123 |
| 5 | Ga0070666_10179454 | 3300005335 | Bacteria | 1485 |
| 6 | Ga0068868_100156644 | 3300005338 | Bacteria | 1879 |
| 7 | Ga0070689_100030081 | 3300005340 | Bacteria | 4118 |
| 8 | Ga0070689_100056137 | 3300005340 | Unclassified | 3053 |
| 9 | Ga0070671_100105360 | 3300005355 | Bacteria | 2367 |
| 10 | Ga0070673_100005141 | 3300005364 | Bacteria | 8347 |
| 11 | Ga0070688_100006828 | 3300005365 | Bacteria | 6122 |
| 12 | Ga0070688_100421815 | 3300005365 | Bacteria | 992 |
| 13 | Ga0070667_100050066 | 3300005367 | Bacteria | 3519 |
| 14 | Ga0070714_100004063 | 3300005435 | Bacteria | 10996 |
| 15 | Ga0070711_100459847 | 3300005439 | Bacteria | 1043 |
| 16 | Ga0070694_100005411 | 3300005444 | Bacteria | 7727 |
| 17 | Ga0070708_100078482 | 3300005445 | Unclassified | 2985 |
| 18 | Ga0070708_100157378 | 3300005445 | Bacteria | 2116 |
| 19 | Ga0070708_100256872 | 3300005445 | Unclassified | 1642 |
| 20 | Ga0070678_100047136 | 3300005456 | Unclassified | 3095 |
| 21 | Ga0070707_100054553 | 3300005468 | Bacteria | 3832 |
| 22 | Ga0070707_100089899 | 3300005468 | Bacteria | 2972 |
| 23 | Ga0070698_100037055 | 3300005471 | Bacteria | 5030 |
| 24 | Ga0070698_100100638 | 3300005471 | Bacteria | 2863 |
| 25 | Ga0070698_100176627 | 3300005471 | Bacteria | 2075 |
| 26 | Ga0070699_100002361 | 3300005518 | Bacteria | 16930 |
| 27 | Ga0070699_100105514 | 3300005518 | Unclassified | 2472 |
| 28 | Ga0070699_100200024 | 3300005518 | Bacteria | 1776 |
| 29 | Ga0070699_100230635 | 3300005518 | Bacteria | 1651 |
| 30 | Ga0070699_100580708 | 3300005518 | Bacteria | 1021 |
| 31 | Ga0070697_100138710 | 3300005536 | Bacteria | 2044 |
| 32 | Ga0070697_100338052 | 3300005536 | Unclassified | 1299 |
| 33 | Ga0070672_100101719 | 3300005543 | Bacteria | 2331 |
| 34 | Ga0070672_100257104 | 3300005543 | Bacteria | 1472 |
| 35 | Ga0070686_100358917 | 3300005544 | Bacteria | 1097 |
| 36 | Ga0070695_100003611 | 3300005545 | Bacteria | 9029 |
| 37 | Ga0070695_100107002 | 3300005545 | Bacteria | 1892 |
| 38 | Ga0070696_100452842 | 3300005546 | Unclassified | 1013 |
| 39 | Ga0070665_100017847 | 3300005548 | Bacteria | 7124 |
| 40 | Ga0070704_100087004 | 3300005549 | Bacteria | 2318 |
| 41 | Ga0070704_100412371 | 3300005549 | Bacteria | 1155 |
| 42 | Ga0068855_100151990 | 3300005563 | Bacteria | 2632 |
| 43 | Ga0068854_100417207 | 3300005578 | Unclassified | 1114 |
| 44 | Ga0070702_100276369 | 3300005615 | Unclassified | 1151 |
| 45 | Ga0068859_100618383 | 3300005617 | Bacteria | 1176 |
| 46 | Ga0068864_100247144 | 3300005618 | Unclassified | 1655 |
| 47 | Ga0068866_10268158 | 3300005718 | Unclassified | 1052 |
| 48 | Ga0068851_10136733 | 3300005834 | Bacteria | 1329 |
| 49 | Ga0068858_100154520 | 3300005842 | Bacteria | 2159 |
| 50 | Ga0068858_100337414 | 3300005842 | Unclassified | 1442 |
| 51 | Ga0068860_100270654 | 3300005843 | Bacteria | 1658 |
| 52 | Ga0068860_100778890 | 3300005843 | Unclassified | 969 |
| 53 | Ga0068862_100117923 | 3300005844 | Bacteria | 2336 |
| 54 | Ga0068871_100003518 | 3300006358 | Bacteria | 10778 |
| 55 | Ga0068871_100089569 | 3300006358 | Bacteria | 2561 |
| 56 | Ga0068871_100270302 | 3300006358 | Unclassified | 1485 |
| 57 | Ga0075428_100566910 | 3300006844 | Bacteria | 1213 |
| 58 | Ga0075433_10046504 | 3300006852 | Bacteria | 3775 |
| 59 | Ga0075433_10050345 | 3300006852 | Bacteria | 3626 |
| 60 | Ga0075434_100013104 | 3300006871 | Bacteria | 7873 |
| 61 | Ga0075434_100026504 | 3300006871 | Bacteria | 5679 |
| 62 | Ga0075434_100027370 | 3300006871 | Bacteria | 5597 |
| 63 | Ga0075434_100698346 | 3300006871 | Unclassified | 1032 |
| 64 | Ga0068865_100012501 | 3300006881 | Bacteria | 5344 |
| 65 | Ga0075436_100025075 | 3300006914 | Bacteria | 4100 |
| 66 | Ga0075436_100089796 | 3300006914 | Unclassified | 2135 |
| 67 | Ga0075436_100104194 | 3300006914 | Bacteria | 1977 |
| 68 | Ga0097620_100618397 | 3300006931 | Bacteria | 1176 |
| 69 | Ga0075435_100006626 | 3300007076 | Bacteria | 8204 |
| 70 | Ga0075435_100011641 | 3300007076 | Bacteria | 6484 |
| 71 | Ga0075435_100042669 | 3300007076 | Bacteria | 3629 |
| 72 | Ga0075435_100128300 | 3300007076 | Bacteria | 2121 |
| 73 | Ga0075435_100191078 | 3300007076 | Bacteria | 1733 |
| 74 | Ga0105240_10056272 | 3300009093 | Bacteria | 4922 |
| 75 | Ga0111539_10031302 | 3300009094 | Bacteria | 6463 |
| 76 | Ga0111539_10043073 | 3300009094 | Bacteria | 5414 |
| 77 | Ga0105245_10085457 | 3300009098 | Bacteria | 2892 |
| 78 | Ga0114129_10005815 | 3300009147 | Bacteria | 17467 |
| 79 | Ga0114129_10009041 | 3300009147 | Bacteria | 14197 |
| 80 | Ga0114129_10009110 | 3300009147 | Bacteria | 14147 |
| 81 | Ga0114129_10087289 | 3300009147 | Bacteria | 4326 |
| 82 | Ga0114129_10236603 | 3300009147 | Bacteria | 2457 |
| 83 | Ga0114129_10290786 | 3300009147 | Bacteria | 2181 |
| 84 | Ga0114129_10316756 | 3300009147 | Bacteria | 2074 |
| 85 | Ga0114129_11133949 | 3300009147 | Unclassified | 977 |
| 86 | Ga0105242_10019826 | 3300009176 | Bacteria | 5268 |
| 87 | Ga0105248_10111817 | 3300009177 | Unclassified | 3081 |
| 88 | Ga0105248_10116519 | 3300009177 | Bacteria | 3013 |
| 89 | Ga0105248_10162122 | 3300009177 | Bacteria | 2522 |
| 90 | Ga0105248_10174470 | 3300009177 | Bacteria | 2423 |
| 91 | Ga0105238_10080136 | 3300009551 | Bacteria | 3255 |
| 92 | Ga0157369_10412019 | 3300013105 | Bacteria | 1401 |
| 93 | Ga0157378_10032946 | 3300013297 | Bacteria | 4580 |
| 94 | Ga0157378_10935386 | 3300013297 | Unclassified | 899 |
| 95 | Ga0163162_10030323 | 3300013306 | Bacteria | 5359 |
| 96 | Ga0157375_11225469 | 3300013308 | Unclassified | 881 |
| 97 | Ga0163163_10122062 | 3300014325 | Unclassified | 2640 |
| 98 | Ga0163163_10343312 | 3300014325 | Bacteria | 1549 |
| 99 | Ga0163163_10935358 | 3300014325 | Unclassified | 930 |
| 100 | Ga0157380_10042447 | 3300014326 | Bacteria | 3556 |
| 101 | Ga0157380_10185991 | 3300014326 | Bacteria | 1830 |
| 102 | Ga0157379_10004296 | 3300014968 | Bacteria | 12177 |
| 103 | Ga0157379_10028725 | 3300014968 | Bacteria | 4946 |
| 104 | Ga0157376_10030993 | 3300014969 | Unclassified | 4277 |
| 105 | Ga0157376_10094706 | 3300014969 | Bacteria | 2595 |
| 106 | Ga0207680_10058159 | 3300025903 | Unclassified | 2342 |
| 107 | Ga0207663_10560478 | 3300025916 | Unclassified | 894 |
| 108 | Ga0207662_10267851 | 3300025918 | Unclassified | 1126 |
| 109 | Ga0207646_10008835 | 3300025922 | Bacteria | 10043 |
| 110 | Ga0207646_10182678 | 3300025922 | Bacteria | 1894 |
| 111 | Ga0207681_10016026 | 3300025923 | Bacteria | 4681 |
| 112 | Ga0207650_10736606 | 3300025925 | Bacteria | 834 |
| 113 | Ga0207664_10089905 | 3300025929 | Bacteria | 2515 |
| 114 | Ga0207644_10012829 | 3300025931 | Bacteria | 5573 |
| 115 | Ga0207644_10296410 | 3300025931 | Bacteria | 1302 |
| 116 | Ga0207686_10186814 | 3300025934 | Bacteria | 1474 |
| 117 | Ga0207686_10446955 | 3300025934 | Unclassified | 994 |
| 118 | Ga0207670_10072933 | 3300025936 | Bacteria | 2379 |
| 119 | Ga0207704_10014894 | 3300025938 | Unclassified | 3944 |
| 120 | Ga0207691_10023566 | 3300025940 | Bacteria | 5796 |
| 121 | Ga0207691_10344482 | 3300025940 | Bacteria | 1275 |
| 122 | Ga0207711_10225196 | 3300025941 | Bacteria | 1716 |
| 123 | Ga0207711_10360971 | 3300025941 | Bacteria | 1346 |
| 124 | Ga0207689_10188611 | 3300025942 | Unclassified | 1701 |
| 125 | Ga0207651_10180260 | 3300025960 | Bacteria | 1675 |
| 126 | Ga0207703_10513273 | 3300026035 | Bacteria | 1126 |
| 127 | Ga0207676_10462424 | 3300026095 | Unclassified | 1198 |
| 128 | Ga0207683_10301395 | 3300026121 | Bacteria | 1466 |
| 129 | Ga0268266_10012450 | 3300028379 | Bacteria | 7352 |
| 130 | Ga0268266_10739965 | 3300028379 | Unclassified | 949 |
| 131 | Ga0268265_10289537 | 3300028380 | Bacteria | 1470 |
| 132 | Ga0268264_10045228 | 3300028381 | Bacteria | 3655 |
| 133 | Ga0373930_0001079 | 3300034816 | Unclassified | 3943 |
| 134 | Ga0373948_0000872 | 3300034817 | Bacteria | 4008 |
| 135 | Ga0373950_0001380 | 3300034818 | Bacteria | 3158 |
| 136 | Ga0373928_0058873 | 3300035084 | Bacteria | 924 |
| 137 | Ga0373951_0000587 | 3300035091 | Bacteria | 10052 |
| 138 | Ga0373932_0001750 | 3300035112 | Bacteria | 5876 |
| 139 | Ga0373939_0000629 | 3300035114 | Bacteria | 8771 |
| 140 | Ga0373941_0000065 | 3300035115 | Bacteria | 16423 |
| 141 | Ga0373941_0019187 | 3300035115 | Bacteria | 1900 |
| 142 | Ga0373956_0166804 | 3300035119 | Bacteria | 1039 |
| 143 | Ga0373960_0000092 | 3300035121 | Bacteria | 13839 |
| 144 | Ga0373942_0000398 | 3300035207 | Bacteria | 12063 |
| 145 | Ga0373961_0001869 | 3300035241 | Bacteria | 5737 |
| 146 | Ga0373962_0007388 | 3300035242 | Bacteria | 2690 |
| 147 | Ga0373931_0009570 | 3300035691 | Bacteria | 4635 |
| 148 | Ga0373947_0317634 | 3300035725 | Bacteria | 1041 |
| 149 | Ga0373937_0197128 | 3300036401 | Bacteria | 1893 |
| 150 | Ga0373925_0081788 | 3300037068 | Bacteria | 2457 |
| 151 | Ga0450916_014620 | 3300042530 | Bacteria | 1024 |
| 152 | Ga0451576_0106633 | 3300045051 | Bacteria | 2915 |
| 153 | Ga0451576_0413605 | 3300045051 | Archaea | 1415 |
| 154 | Ga0451576_0758981 | 3300045051 | Bacteria | 1019 |
| 155 | Ga0451576_0765627 | 3300045051 | Bacteria | 1014 |
| 156 | Ga0466967_0637431 | 3300045976 | Unclassified | 1053 |
| 157 | Ga0495652_0303005 | 3300046529 | Unclassified | 1161 |
| 158 | Ga0495640_0117064 | 3300046533 | Unclassified | 1735 |
| 159 | Ga0495621_0015061 | 3300046539 | Bacteria | 2460 |
| 160 | Ga0495645_0007571 | 3300046543 | Bacteria | 7555 |
| 161 | Ga0495667_0345687 | 3300046559 | Bacteria | 940 |
| 162 | Ga0495656_0190928 | 3300046615 | Unclassified | 1012 |
| 163 | Ga0495658_0121732 | 3300046683 | Bacteria | 1579 |
| 164 | Ga0495669_0030611 | 3300046684 | Bacteria | 2363 |
| 165 | Ga0496107_0058518 | 3300048910 | Bacteria | 2787 |
| 166 | Ga0496109_0255286 | 3300048912 | Bacteria | 1651 |
| 167 | Ga0496112_0519278 | 3300048915 | Bacteria | 1126 |
| 168 | Ga0501034_0028992 | 3300049571 | Bacteria | 5629 |
| 169 | Ga0501043_0337772 | 3300049579 | Bacteria | 1146 |
| 170 | Ga0501047_0020209 | 3300049581 | Bacteria | 6394 |
| 171 | Ga0501070_0268760 | 3300049586 | Bacteria | 1393 |
| 172 | Ga0501071_0347962 | 3300049587 | Bacteria | 1128 |
| 173 | Ga0501073_0138713 | 3300049589 | Bacteria | 1685 |
| 174 | Ga0501073_0186865 | 3300049589 | Bacteria | 1434 |
| 175 | Ga0501080_0482480 | 3300049742 | Unclassified | 1109 |
| 176 | Ga0501083_0258684 | 3300049744 | Bacteria | 1133 |
| 177 | Ga0501044_0005869 | 3300049823 | Bacteria | 13604 |
| 178 | nmdc:mga05p37_184918_c1 | 3300050507 | Bacteria | 2534 |
| 179 | nmdc:mga05p37_224947_c1 | 3300050507 | Bacteria | 2263 |
| 180 | nmdc:mga05p37_257816_c1 | 3300050507 | Bacteria | 2089 |
| 181 | nmdc:mga05p37_386278_c1 | 3300050507 | Bacteria | 1639 |
| 182 | nmdc:mga05p37_4912_c1 | 3300050507 | Bacteria | 15656 |
| 183 | nmdc:mga05p37_574688_c1 | 3300050507 | Unclassified | 1278 |
| 184 | nmdc:mga05p37_70346_c1 | 3300050507 | Bacteria | 4304 |
| 185 | nmdc:mga05p37_980264_c1 | 3300050507 | Bacteria | 901 |
| 186 | nmdc:mga08y16_180040_c1 | 3300050511 | Bacteria | 2195 |
| 187 | nmdc:mga08y16_22172_c1 | 3300050511 | Bacteria | 6704 |
| 188 | nmdc:mga08y16_45739_c1 | 3300050511 | Bacteria | 4585 |
| 189 | nmdc:mga0n895_27247_c1 | 3300050512 | Bacteria | 5426 |
| 190 | nmdc:mga0n895_460449_c1 | 3300050512 | Bacteria | 1284 |
| 191 | nmdc:mga0n895_557959_c1 | 3300050512 | Bacteria | 1151 |
| 192 | nmdc:mga0rr50_103916_c1 | 3300050513 | Bacteria | 2237 |
| 193 | nmdc:mga0rr50_169541_c1 | 3300050513 | Unclassified | 1778 |
| 194 | nmdc:mga0rr50_18453_c1 | 3300050513 | Bacteria | 4688 |
| 195 | nmdc:mga08x19_281345_c1 | 3300050514 | Bacteria | 1153 |
| 196 | nmdc:mga08x19_48610_c1 | 3300050514 | Bacteria | 2718 |
| 197 | nmdc:mga08x19_59939_c1 | 3300050514 | Unclassified | 2465 |
| 198 | nmdc:mga08x19_81533_c1 | 3300050514 | Bacteria | 2125 |
| 199 | nmdc:mga0a205_20402_c1 | 3300050515 | Bacteria | 4273 |
| 200 | nmdc:mga0a205_35932_c1 | 3300050515 | Bacteria | 4759 |
| 201 | nmdc:mga0a205_5457_c2 | 3300050515 | Bacteria | 9974 |
| 202 | nmdc:mga0a205_60420_c1 | 3300050515 | Bacteria | 3661 |
| 203 | nmdc:mga0a205_65063_c1 | 3300050515 | Bacteria | 3522 |
| 204 | Ga0495619_0071301 | 3300053085 | Bacteria | 2325 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10935386 | Ga0157378_109353861 | 221 |
| 2 | 3300009177 | Ga0105248_10111817 | Ga0105248_101118171 | 222 |
| 3 | 3300013308 | Ga0157375_11225469 | Ga0157375_112254691 | 222 |
| 4 | 3300025934 | Ga0207686_10446955 | Ga0207686_104469551 | 222 |
| 5 | 3300005445 | Ga0070708_100078482 | Ga0070708_1000784822 | 223 |
| 6 | 3300046533 | Ga0495640_0117064 | Ga0495640_0117064_521_1264 | 223 |
| 7 | 3300005578 | Ga0068854_100417207 | Ga0068854_1004172072 | 224 |
| 8 | 3300025918 | Ga0207662_10267851 | Ga0207662_102678511 | 224 |
| 9 | 3300026035 | Ga0207703_10513273 | Ga0207703_105132731 | 224 |
| 10 | 3300005842 | Ga0068858_100337414 | Ga0068858_1003374141 | 226 |
| 11 | 3300048915 | Ga0496112_0519278 | Ga0496112_0519278_302_1051 | 227 |
| 12 | 3300049587 | Ga0501071_0347962 | Ga0501071_0347962_390_1109 | 227 |
| 13 | 3300005445 | Ga0070708_100256872 | Ga0070708_1002568721 | 228 |
| 14 | 3300035119 | Ga0373956_0166804 | Ga0373956_0166804_108_848 | 229 |
| 15 | 3300046529 | Ga0495652_0303005 | Ga0495652_0303005_354_1094 | 229 |
| 16 | 3300046543 | Ga0495645_0007571 | Ga0495645_0007571_2421_3161 | 229 |
| 17 | 3300046559 | Ga0495667_0345687 | Ga0495667_0345687_132_872 | 229 |
| 18 | 3300053085 | Ga0495619_0071301 | Ga0495619_0071301_520_1260 | 229 |
| 19 | 3300005518 | Ga0070699_100230635 | Ga0070699_1002306352 | 232 |
| 20 | 3300009093 | Ga0105240_10056272 | Ga0105240_100562721 | 234 |
| 21 | 3300046684 | Ga0495669_0030611 | Ga0495669_0030611_158_922 | 238 |
| 22 | 3300005518 | Ga0070699_100002361 | Ga0070699_1000023613 | 240 |
| 23 | 3300006871 | Ga0075434_100698346 | Ga0075434_1006983461 | 240 |
| 24 | 3300007076 | Ga0075435_100191078 | Ga0075435_1001910782 | 240 |
| 25 | 3300045051 | Ga0451576_0413605 | Ga0451576_0413605_243_986 | 240 |
| 26 | 3300005334 | Ga0068869_100404736 | Ga0068869_1004047362 | 241 |
| 27 | 3300005355 | Ga0070671_100105360 | Ga0070671_1001053601 | 241 |
| 28 | 3300005365 | Ga0070688_100421815 | Ga0070688_1004218151 | 241 |
| 29 | 3300005367 | Ga0070667_100050066 | Ga0070667_1000500663 | 241 |
| 30 | 3300005439 | Ga0070711_100459847 | Ga0070711_1004598471 | 241 |
| 31 | 3300005518 | Ga0070699_100580708 | Ga0070699_1005807081 | 241 |
| 32 | 3300005543 | Ga0070672_100101719 | Ga0070672_1001017193 | 241 |
| 33 | 3300005544 | Ga0070686_100358917 | Ga0070686_1003589172 | 241 |
| 34 | 3300005549 | Ga0070704_100412371 | Ga0070704_1004123712 | 241 |
| 35 | 3300005615 | Ga0070702_100276369 | Ga0070702_1002763691 | 241 |
| 36 | 3300005842 | Ga0068858_100154520 | Ga0068858_1001545201 | 241 |
| 37 | 3300005843 | Ga0068860_100270654 | Ga0068860_1002706542 | 241 |
| 38 | 3300005844 | Ga0068862_100117923 | Ga0068862_1001179232 | 241 |
| 39 | 3300006844 | Ga0075428_100566910 | Ga0075428_1005669101 | 241 |
| 40 | 3300006852 | Ga0075433_10046504 | Ga0075433_100465041 | 241 |
| 41 | 3300006852 | Ga0075433_10050345 | Ga0075433_100503452 | 241 |
| 42 | 3300006871 | Ga0075434_100013104 | Ga0075434_1000131045 | 241 |
| 43 | 3300006871 | Ga0075434_100027370 | Ga0075434_1000273702 | 241 |
| 44 | 3300007076 | Ga0075435_100006626 | Ga0075435_1000066267 | 241 |
| 45 | 3300009147 | Ga0114129_10009041 | Ga0114129_100090417 | 241 |
| 46 | 3300009147 | Ga0114129_10087289 | Ga0114129_100872894 | 241 |
| 47 | 3300009147 | Ga0114129_10290786 | Ga0114129_102907862 | 241 |
| 48 | 3300009147 | Ga0114129_10316756 | Ga0114129_103167562 | 241 |
| 49 | 3300009177 | Ga0105248_10116519 | Ga0105248_101165193 | 241 |
| 50 | 3300013306 | Ga0163162_10030323 | Ga0163162_100303232 | 241 |
| 51 | 3300014326 | Ga0157380_10042447 | Ga0157380_100424472 | 241 |
| 52 | 3300014968 | Ga0157379_10028725 | Ga0157379_100287251 | 241 |
| 53 | 3300014969 | Ga0157376_10094706 | Ga0157376_100947062 | 241 |
| 54 | 3300025916 | Ga0207663_10560478 | Ga0207663_105604781 | 241 |
| 55 | 3300025923 | Ga0207681_10016026 | Ga0207681_100160261 | 241 |
| 56 | 3300025931 | Ga0207644_10012829 | Ga0207644_100128293 | 241 |
| 57 | 3300025931 | Ga0207644_10296410 | Ga0207644_102964102 | 241 |
| 58 | 3300025936 | Ga0207670_10072933 | Ga0207670_100729332 | 241 |
| 59 | 3300025940 | Ga0207691_10023566 | Ga0207691_100235666 | 241 |
| 60 | 3300025940 | Ga0207691_10344482 | Ga0207691_103444822 | 241 |
| 61 | 3300025941 | Ga0207711_10225196 | Ga0207711_102251962 | 241 |
| 62 | 3300025960 | Ga0207651_10180260 | Ga0207651_101802601 | 241 |
| 63 | 3300026121 | Ga0207683_10301395 | Ga0207683_103013953 | 241 |
| 64 | 3300028381 | Ga0268264_10045228 | Ga0268264_100452282 | 241 |
| 65 | 3300035725 | Ga0373947_0317634 | Ga0373947_0317634_256_999 | 241 |
| 66 | 3300045051 | Ga0451576_0758981 | Ga0451576_0758981_211_957 | 241 |
| 67 | 3300046615 | Ga0495656_0190928 | Ga0495656_0190928_155_901 | 241 |
| 68 | 3300048910 | Ga0496107_0058518 | Ga0496107_0058518_238_984 | 241 |
| 69 | 3300048912 | Ga0496109_0255286 | Ga0496109_0255286_863_1609 | 241 |
| 70 | 3300050507 | nmdc:mga05p37_184918_c1 | nmdc:mga05p37_184918_c1_1342_2088 | 241 |
| 71 | 3300050507 | nmdc:mga05p37_257816_c1 | nmdc:mga05p37_257816_c1_284_1021 | 241 |
| 72 | 3300050507 | nmdc:mga05p37_70346_c1 | nmdc:mga05p37_70346_c1_884_1630 | 241 |
| 73 | 3300050507 | nmdc:mga05p37_980264_c1 | nmdc:mga05p37_980264_c1_108_854 | 241 |
| 74 | 3300050512 | nmdc:mga0n895_27247_c1 | nmdc:mga0n895_27247_c1_2353_3099 | 241 |
| 75 | 3300050512 | nmdc:mga0n895_460449_c1 | nmdc:mga0n895_460449_c1_464_1201 | 241 |
| 76 | 3300050513 | nmdc:mga0rr50_169541_c1 | nmdc:mga0rr50_169541_c1_121_858 | 241 |
| 77 | 3300050515 | nmdc:mga0a205_20402_c1 | nmdc:mga0a205_20402_c1_1953_2699 | 241 |
| 78 | 3300050515 | nmdc:mga0a205_5457_c2 | nmdc:mga0a205_5457_c2_3623_4360 | 241 |
| 79 | 3300005331 | Ga0070670_100486448 | Ga0070670_1004864481 | 242 |
| 80 | 3300005334 | Ga0068869_100122412 | Ga0068869_1001224122 | 242 |
| 81 | 3300005340 | Ga0070689_100056137 | Ga0070689_1000561372 | 242 |
| 82 | 3300005365 | Ga0070688_100006828 | Ga0070688_1000068286 | 242 |
| 83 | 3300005444 | Ga0070694_100005411 | Ga0070694_1000054112 | 242 |
| 84 | 3300005445 | Ga0070708_100157378 | Ga0070708_1001573782 | 242 |
| 85 | 3300005456 | Ga0070678_100047136 | Ga0070678_1000471363 | 242 |
| 86 | 3300005468 | Ga0070707_100054553 | Ga0070707_1000545533 | 242 |
| 87 | 3300005468 | Ga0070707_100089899 | Ga0070707_1000898992 | 242 |
| 88 | 3300005471 | Ga0070698_100100638 | Ga0070698_1001006382 | 242 |
| 89 | 3300005471 | Ga0070698_100176627 | Ga0070698_1001766271 | 242 |
| 90 | 3300005536 | Ga0070697_100138710 | Ga0070697_1001387101 | 242 |
| 91 | 3300005536 | Ga0070697_100338052 | Ga0070697_1003380522 | 242 |
| 92 | 3300005543 | Ga0070672_100257104 | Ga0070672_1002571042 | 242 |
| 93 | 3300005545 | Ga0070695_100003611 | Ga0070695_1000036115 | 242 |
| 94 | 3300005546 | Ga0070696_100452842 | Ga0070696_1004528421 | 242 |
| 95 | 3300005548 | Ga0070665_100017847 | Ga0070665_1000178475 | 242 |
| 96 | 3300005549 | Ga0070704_100087004 | Ga0070704_1000870042 | 242 |
| 97 | 3300005563 | Ga0068855_100151990 | Ga0068855_1001519901 | 242 |
| 98 | 3300005617 | Ga0068859_100618383 | Ga0068859_1006183831 | 242 |
| 99 | 3300005618 | Ga0068864_100247144 | Ga0068864_1002471442 | 242 |
| 100 | 3300005718 | Ga0068866_10268158 | Ga0068866_102681581 | 242 |
| 101 | 3300005834 | Ga0068851_10136733 | Ga0068851_101367332 | 242 |
| 102 | 3300005843 | Ga0068860_100778890 | Ga0068860_1007788901 | 242 |
| 103 | 3300006358 | Ga0068871_100003518 | Ga0068871_1000035187 | 242 |
| 104 | 3300006358 | Ga0068871_100270302 | Ga0068871_1002703021 | 242 |
| 105 | 3300006871 | Ga0075434_100026504 | Ga0075434_1000265043 | 242 |
| 106 | 3300006881 | Ga0068865_100012501 | Ga0068865_1000125013 | 242 |
| 107 | 3300006914 | Ga0075436_100025075 | Ga0075436_1000250752 | 242 |
| 108 | 3300006914 | Ga0075436_100089796 | Ga0075436_1000897961 | 242 |
| 109 | 3300006914 | Ga0075436_100104194 | Ga0075436_1001041943 | 242 |
| 110 | 3300006931 | Ga0097620_100618397 | Ga0097620_1006183972 | 242 |
| 111 | 3300007076 | Ga0075435_100011641 | Ga0075435_1000116414 | 242 |
| 112 | 3300007076 | Ga0075435_100042669 | Ga0075435_1000426693 | 242 |
| 113 | 3300007076 | Ga0075435_100128300 | Ga0075435_1001283003 | 242 |
| 114 | 3300009094 | Ga0111539_10031302 | Ga0111539_100313024 | 242 |
| 115 | 3300009094 | Ga0111539_10043073 | Ga0111539_100430732 | 242 |
| 116 | 3300009098 | Ga0105245_10085457 | Ga0105245_100854572 | 242 |
| 117 | 3300009147 | Ga0114129_10005815 | Ga0114129_100058157 | 242 |
| 118 | 3300009147 | Ga0114129_10009110 | Ga0114129_1000911012 | 242 |
| 119 | 3300009147 | Ga0114129_10236603 | Ga0114129_102366032 | 242 |
| 120 | 3300009147 | Ga0114129_11133949 | Ga0114129_111339491 | 242 |
| 121 | 3300009176 | Ga0105242_10019826 | Ga0105242_100198262 | 242 |
| 122 | 3300009177 | Ga0105248_10162122 | Ga0105248_101621222 | 242 |
| 123 | 3300009551 | Ga0105238_10080136 | Ga0105238_100801362 | 242 |
| 124 | 3300013105 | Ga0157369_10412019 | Ga0157369_104120192 | 242 |
| 125 | 3300014325 | Ga0163163_10122062 | Ga0163163_101220622 | 242 |
| 126 | 3300014325 | Ga0163163_10343312 | Ga0163163_103433122 | 242 |
| 127 | 3300014325 | Ga0163163_10935358 | Ga0163163_109353581 | 242 |
| 128 | 3300014326 | Ga0157380_10185991 | Ga0157380_101859912 | 242 |
| 129 | 3300014968 | Ga0157379_10004296 | Ga0157379_100042969 | 242 |
| 130 | 3300014969 | Ga0157376_10030993 | Ga0157376_100309933 | 242 |
| 131 | 3300025903 | Ga0207680_10058159 | Ga0207680_100581592 | 242 |
| 132 | 3300025922 | Ga0207646_10008835 | Ga0207646_100088358 | 242 |
| 133 | 3300025922 | Ga0207646_10182678 | Ga0207646_101826782 | 242 |
| 134 | 3300025925 | Ga0207650_10736606 | Ga0207650_107366061 | 242 |
| 135 | 3300025934 | Ga0207686_10186814 | Ga0207686_101868142 | 242 |
| 136 | 3300025938 | Ga0207704_10014894 | Ga0207704_100148942 | 242 |
| 137 | 3300025941 | Ga0207711_10360971 | Ga0207711_103609711 | 242 |
| 138 | 3300025942 | Ga0207689_10188611 | Ga0207689_101886112 | 242 |
| 139 | 3300026095 | Ga0207676_10462424 | Ga0207676_104624242 | 242 |
| 140 | 3300028379 | Ga0268266_10012450 | Ga0268266_100124505 | 242 |
| 141 | 3300028379 | Ga0268266_10739965 | Ga0268266_107399651 | 242 |
| 142 | 3300028380 | Ga0268265_10289537 | Ga0268265_102895371 | 242 |
| 143 | 3300034816 | Ga0373930_0001079 | Ga0373930_0001079_3043_3783 | 242 |
| 144 | 3300034817 | Ga0373948_0000872 | Ga0373948_0000872_938_1678 | 242 |
| 145 | 3300034818 | Ga0373950_0001380 | Ga0373950_0001380_792_1532 | 242 |
| 146 | 3300035084 | Ga0373928_0058873 | Ga0373928_0058873_88_828 | 242 |
| 147 | 3300035091 | Ga0373951_0000587 | Ga0373951_0000587_6766_7506 | 242 |
| 148 | 3300035112 | Ga0373932_0001750 | Ga0373932_0001750_2220_2960 | 242 |
| 149 | 3300035114 | Ga0373939_0000629 | Ga0373939_0000629_524_1264 | 242 |
| 150 | 3300035115 | Ga0373941_0000065 | Ga0373941_0000065_3415_4155 | 242 |
| 151 | 3300035115 | Ga0373941_0019187 | Ga0373941_0019187_981_1721 | 242 |
| 152 | 3300035121 | Ga0373960_0000092 | Ga0373960_0000092_3248_3988 | 242 |
| 153 | 3300035207 | Ga0373942_0000398 | Ga0373942_0000398_17_757 | 242 |
| 154 | 3300035241 | Ga0373961_0001869 | Ga0373961_0001869_3041_3781 | 242 |
| 155 | 3300035242 | Ga0373962_0007388 | Ga0373962_0007388_1251_1991 | 242 |
| 156 | 3300035691 | Ga0373931_0009570 | Ga0373931_0009570_3040_3780 | 242 |
| 157 | 3300036401 | Ga0373937_0197128 | Ga0373937_0197128_382_1122 | 242 |
| 158 | 3300037068 | Ga0373925_0081788 | Ga0373925_0081788_1288_2028 | 242 |
| 159 | 3300042530 | Ga0450916_014620 | Ga0450916_014620_40_783 | 242 |
| 160 | 3300045051 | Ga0451576_0106633 | Ga0451576_0106633_1230_1970 | 242 |
| 161 | 3300045051 | Ga0451576_0765627 | Ga0451576_0765627_157_912 | 242 |
| 162 | 3300046539 | Ga0495621_0015061 | Ga0495621_0015061_1282_2022 | 242 |
| 163 | 3300046683 | Ga0495658_0121732 | Ga0495658_0121732_56_796 | 242 |
| 164 | 3300049571 | Ga0501034_0028992 | Ga0501034_0028992_78_824 | 242 |
| 165 | 3300049579 | Ga0501043_0337772 | Ga0501043_0337772_350_1096 | 242 |
| 166 | 3300049581 | Ga0501047_0020209 | Ga0501047_0020209_3440_4186 | 242 |
| 167 | 3300049586 | Ga0501070_0268760 | Ga0501070_0268760_234_980 | 242 |
| 168 | 3300049589 | Ga0501073_0138713 | Ga0501073_0138713_346_1101 | 242 |
| 169 | 3300049589 | Ga0501073_0186865 | Ga0501073_0186865_420_1166 | 242 |
| 170 | 3300049742 | Ga0501080_0482480 | Ga0501080_0482480_136_891 | 242 |
| 171 | 3300049744 | Ga0501083_0258684 | Ga0501083_0258684_182_928 | 242 |
| 172 | 3300049823 | Ga0501044_0005869 | Ga0501044_0005869_10226_10972 | 242 |
| 173 | 3300050507 | nmdc:mga05p37_224947_c1 | nmdc:mga05p37_224947_c1_436_1185 | 242 |
| 174 | 3300050507 | nmdc:mga05p37_386278_c1 | nmdc:mga05p37_386278_c1_285_1034 | 242 |
| 175 | 3300050507 | nmdc:mga05p37_4912_c1 | nmdc:mga05p37_4912_c1_7862_8602 | 242 |
| 176 | 3300050507 | nmdc:mga05p37_574688_c1 | nmdc:mga05p37_574688_c1_506_1246 | 242 |
| 177 | 3300050511 | nmdc:mga08y16_180040_c1 | nmdc:mga08y16_180040_c1_603_1343 | 242 |
| 178 | 3300050511 | nmdc:mga08y16_22172_c1 | nmdc:mga08y16_22172_c1_5190_5930 | 242 |
| 179 | 3300050511 | nmdc:mga08y16_45739_c1 | nmdc:mga08y16_45739_c1_2993_3808 | 242 |
| 180 | 3300050512 | nmdc:mga0n895_557959_c1 | nmdc:mga0n895_557959_c1_364_1104 | 242 |
| 181 | 3300050513 | nmdc:mga0rr50_103916_c1 | nmdc:mga0rr50_103916_c1_1425_2165 | 242 |
| 182 | 3300050513 | nmdc:mga0rr50_18453_c1 | nmdc:mga0rr50_18453_c1_1412_2152 | 242 |
| 183 | 3300050514 | nmdc:mga08x19_281345_c1 | nmdc:mga08x19_281345_c1_40_858 | 242 |
| 184 | 3300050514 | nmdc:mga08x19_48610_c1 | nmdc:mga08x19_48610_c1_1494_2234 | 242 |
| 185 | 3300050514 | nmdc:mga08x19_59939_c1 | nmdc:mga08x19_59939_c1_181_921 | 242 |
| 186 | 3300050514 | nmdc:mga08x19_81533_c1 | nmdc:mga08x19_81533_c1_241_981 | 242 |
| 187 | 3300050515 | nmdc:mga0a205_35932_c1 | nmdc:mga0a205_35932_c1_2295_3044 | 242 |
| 188 | 3300050515 | nmdc:mga0a205_60420_c1 | nmdc:mga0a205_60420_c1_259_999 | 242 |
| 189 | 3300050515 | nmdc:mga0a205_65063_c1 | nmdc:mga0a205_65063_c1_1435_2175 | 242 |
| 190 | 3300005293 | Ga0065715_10004151 | Ga0065715_100041516 | 243 |
| 191 | 3300005335 | Ga0070666_10179454 | Ga0070666_101794542 | 243 |
| 192 | 3300005338 | Ga0068868_100156644 | Ga0068868_1001566441 | 243 |
| 193 | 3300005340 | Ga0070689_100030081 | Ga0070689_1000300812 | 243 |
| 194 | 3300005364 | Ga0070673_100005141 | Ga0070673_1000051413 | 243 |
| 195 | 3300005435 | Ga0070714_100004063 | Ga0070714_1000040637 | 243 |
| 196 | 3300005471 | Ga0070698_100037055 | Ga0070698_1000370552 | 243 |
| 197 | 3300005518 | Ga0070699_100105514 | Ga0070699_1001055142 | 243 |
| 198 | 3300005518 | Ga0070699_100200024 | Ga0070699_1002000242 | 243 |
| 199 | 3300005545 | Ga0070695_100107002 | Ga0070695_1001070022 | 243 |
| 200 | 3300006358 | Ga0068871_100089569 | Ga0068871_1000895692 | 243 |
| 201 | 3300009177 | Ga0105248_10174470 | Ga0105248_101744702 | 243 |
| 202 | 3300013297 | Ga0157378_10032946 | Ga0157378_100329464 | 243 |
| 203 | 3300025929 | Ga0207664_10089905 | Ga0207664_100899054 | 243 |
| 204 | 3300045976 | Ga0466967_0637431 | Ga0466967_0637431_84_854 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vm8-assembly3.cif.gz_B | crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine | 0.9002 | 1 | 240 |
| 1nxz-assembly1.cif.gz_B | x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. | 0.8891 | 1 | 240 |
| 5o96-assembly4.cif.gz_G | structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam | 0.8827 | 1 | 238 |
| 1vhy-assembly3.cif.gz_A | crystal structure of haemophilus influenzae protein hi0303, pfam duf558 | 0.8824 | 2 | 240 |
| 5vm8-assembly3.cif.gz_B | crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine | 0.8824 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z85B01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.9328 | 4 | 69 | 2.40.240.20 |
| 5vm8B02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9327 | 73 | 240 | 3.40.1280.10 |
| 5o96E02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9177 | 73 | 238 | 3.40.1280.10 |
| 1vhkA02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9153 | 73 | 238 | 3.40.1280.10 |
| 2egwA02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9146 | 73 | 236 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8A9D5-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9493 | 4 | 243 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A6L8GK35-F1-model_v4 | 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) | 0.9466 | 2 | 201 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A3N5NJ30-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9353 | 1 | 243 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A520W710-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.935 | 1 | 243 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A2V8A9D5-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9343 | 4 | 243 |
GO:0005737
GO:0070042 GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar