F312426

General Info

Members Datasets Scaffolds Average Seq Length
204 161 408 161

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10025759|Ga0105240_100257596
Length 186
Sequence MRQNIDFGPVPPQTRIGHVHLKVSDLERAIAFYRDVLGFQETQRYGRQAAFLSAGGYHHHIGLNTWESAGGSPPPAGSTGLFHLAILYPSRADLADALRRLLEAGIPLEGASDHGVSEALYLRDPDGNGVELYWDRPQDQWPRGKDGQIQMSTDPLNLDDLLRELSDRADGPGRPSTRKQSVDSAP

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
161 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 4.41
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 5.39
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10025759 3300009093 Bacteria 7724
2 rootH1_10075123 3300003316 Bacteria 3753
3 rootH2_10272918 3300003320 Bacteria 1623
4 rootH1_10302527 3300003323 Bacteria 2021
5 Ga0070690_100017161 3300005330 Bacteria 4348
6 Ga0068869_100092366 3300005334 Unclassified 2278
7 Ga0070689_100010806 3300005340 Bacteria 6524
8 Ga0070692_10054608 3300005345 Bacteria 2086
9 Ga0070668_100343657 3300005347 Bacteria 1261
10 Ga0070669_100046185 3300005353 Bacteria 3175
11 Ga0070673_100041794 3300005364 Bacteria 3530
12 Ga0070673_100372705 3300005364 Bacteria 1271
13 Ga0070688_100034476 3300005365 Bacteria 3066
14 Ga0070688_100157691 3300005365 Bacteria 1557
15 Ga0070667_100481702 3300005367 Bacteria 1136
16 Ga0070713_100513940 3300005436 Bacteria 1131
17 Ga0070701_10765381 3300005438 Bacteria 655
18 Ga0070711_100090341 3300005439 Bacteria 2206
19 Ga0070711_100839370 3300005439 Unclassified 781
20 Ga0070678_100242279 3300005456 Bacteria 1508
21 Ga0068867_100301861 3300005459 Unclassified 1320
22 Ga0070685_11184397 3300005466 Archaea 580
23 Ga0070686_100644445 3300005544 Archaea 839
24 Ga0070695_100809845 3300005545 Bacteria 751
25 Ga0070695_100875046 3300005545 Unclassified 724
26 Ga0070665_100331696 3300005548 Bacteria 1526
27 Ga0070665_100851298 3300005548 Bacteria 925
28 Ga0070665_102201917 3300005548 Archaea 555
29 Ga0068855_100009609 3300005563 Bacteria 11670
30 Ga0068852_100235578 3300005616 Bacteria 1747
31 Ga0068852_100676522 3300005616 Bacteria 1041
32 Ga0068859_101403689 3300005617 Bacteria 770
33 Ga0068866_10288043 3300005718 Unclassified 1020
34 Ga0068861_100164998 3300005719 Archaea 1831
35 Ga0068861_101587350 3300005719 Bacteria 644
36 Ga0068860_100992821 3300005843 Archaea 857
37 Ga0068862_101460957 3300005844 Bacteria 688
38 Ga0081455_10003431 3300005937 Bacteria 18219
39 Ga0070717_10789047 3300006028 Bacteria 864
40 Ga0070712_100542838 3300006175 Bacteria 979
41 Ga0070712_101062121 3300006175 Unclassified 702
42 Ga0097621_100479438 3300006237 Bacteria 1124
43 Ga0075428_100400288 3300006844 Bacteria 1472
44 Ga0075434_100016807 3300006871 Bacteria 7041
45 Ga0075434_100108332 3300006871 Bacteria 2788
46 Ga0097620_101403867 3300006931 Bacteria 770
47 Ga0075435_100008945 3300007076 Bacteria 7218
48 Ga0075435_100393904 3300007076 Bacteria 1191
49 Ga0111539_10127287 3300009094 Bacteria 2983
50 Ga0105245_10437287 3300009098 Bacteria 1314
51 Ga0105241_11043338 3300009174 Bacteria 767
52 Ga0105248_10020936 3300009177 Bacteria 7249
53 Ga0157373_10001639 3300013100 Bacteria 17082
54 Ga0157374_10079789 3300013296 Bacteria 3102
55 Ga0157374_10322505 3300013296 Bacteria 1531
56 Ga0157378_11026370 3300013297 Bacteria 860
57 Ga0163162_11292771 3300013306 Unclassified 829
58 Ga0157375_10088648 3300013308 Bacteria 3149
59 Ga0163163_10044168 3300014325 Bacteria 4371
60 Ga0163163_10831842 3300014325 Bacteria 987
61 Ga0157376_10012329 3300014969 Bacteria 6341
62 Ga0157376_10424022 3300014969 Bacteria 1292
63 Ga0163161_10678753 3300017792 Bacteria 856
64 Ga0207673_1000766 3300025290 Bacteria 3467
65 Ga0209050_1000093 3300025298 Bacteria 250654
66 Ga0207695_10040777 3300025913 Bacteria 4973
67 Ga0207693_10473071 3300025915 Bacteria 979
68 Ga0207663_10094588 3300025916 Bacteria 1991
69 Ga0207649_10997210 3300025920 Bacteria 659
70 Ga0207646_10315078 3300025922 Bacteria 1413
71 Ga0207681_10278356 3300025923 Bacteria 1316
72 Ga0207650_10043589 3300025925 Bacteria 3294
73 Ga0207700_10219527 3300025928 Unclassified 1611
74 Ga0207700_10321345 3300025928 Bacteria 1341
75 Ga0207665_10547749 3300025939 Unclassified 898
76 Ga0207711_11458090 3300025941 Bacteria 627
77 Ga0207689_10031234 3300025942 Bacteria 4436
78 Ga0207679_12024387 3300025945 Bacteria 524
79 Ga0207667_10112994 3300025949 Bacteria 2800
80 Ga0207651_10118893 3300025960 Archaea 2000
81 Ga0207658_10244474 3300025986 Bacteria 1522
82 Ga0207702_10453862 3300026078 Bacteria 1244
83 Ga0207648_10478789 3300026089 Unclassified 1137
84 Ga0207674_10175671 3300026116 Bacteria 2094
85 Ga0207675_100031600 3300026118 Bacteria 4932
86 Ga0207683_10283165 3300026121 Bacteria 1515
87 Ga0207698_10603109 3300026142 Bacteria 1083
88 Ga0209999_1068732 3300027543 Bacteria 678
89 Ga0268266_10211712 3300028379 Bacteria 1778
90 Ga0265337_1005878 3300028556 Bacteria 4804
91 Ga0265337_1031215 3300028556 Bacteria 1583
92 Ga0265319_1034234 3300028563 Bacteria 1749
93 Ga0265319_1087779 3300028563 Bacteria 983
94 Ga0265318_10029064 3300028577 Bacteria 2157
95 Ga0265338_10002888 3300028800 Bacteria 25044
96 Ga0265338_10033443 3300028800 Bacteria 4989
97 Ga0265338_10087684 3300028800 Bacteria 2584
98 Ga0265338_10125112 3300028800 Bacteria 2041
99 Ga0265338_10318540 3300028800 Bacteria 1126
100 Ga0265324_10027991 3300029957 Bacteria 1989
101 Ga0265332_10084097 3300031238 Bacteria 1349
102 Ga0265332_10200942 3300031238 Bacteria 828
103 Ga0265320_10000204 3300031240 Bacteria 48100
104 Ga0265320_10005998 3300031240 Bacteria 7720
105 Ga0265320_10017462 3300031240 Bacteria 3983
106 Ga0265325_10136229 3300031241 Bacteria 1171
107 Ga0265340_10012667 3300031247 Bacteria 4451
108 Ga0265331_10008481 3300031250 Bacteria 5843
109 Ga0265316_10685061 3300031344 Bacteria 723
110 Ga0265313_10000197 3300031595 Bacteria 64794
111 Ga0265342_10043389 3300031712 Bacteria 2714
112 Ga0316576_10085250 3300031727 Bacteria 2348
113 Ga0316577_10014212 3300031733 Bacteria 4369
114 Ga0316574_0115190 3300035398 Bacteria 1724
115 Ga0373933_0798928 3300035724 Unclassified 621
116 Ga0373937_0198448 3300036401 Bacteria 1886
117 Ga0316584_0028285 3300036712 Bacteria 4132
118 Ga0395899_0472365 3300037312 Bacteria 818
119 Ga0395899_0762605 3300037312 Bacteria 601
120 Ga0395900_0055565 3300037418 Bacteria 4077
121 Ga0395900_0588013 3300037418 Bacteria 1055
122 Ga0395900_1005410 3300037418 Bacteria 754
123 Ga0395898_0001520 3300037466 Bacteria 31974
124 Ga0395898_0117690 3300037466 Bacteria 2546
125 Ga0395898_0410076 3300037466 Bacteria 1292
126 Ga0395905_0231164 3300037471 Bacteria 1729
127 Ga0395901_0012420 3300038443 Bacteria 8641
128 Ga0395901_0249415 3300038443 Bacteria 1850
129 Ga0400483_035209 3300039062 Bacteria 2036
130 Ga0451791_1906348 3300041451 Bacteria 613
131 Ga0451845_0460971 3300041501 Bacteria 793
132 Ga0451577_0016142 3300042876 Bacteria 6923
133 Ga0451577_0498219 3300042876 Unclassified 1106
134 Ga0451577_0660117 3300042876 Unclassified 948
135 Ga0451577_0714189 3300042876 Bacteria 907
136 Ga0451577_0746974 3300042876 Bacteria 885
137 Ga0453683_0531901 3300044673 Bacteria 764
138 Ga0453684_0005683 3300044712 Bacteria 24458
139 Ga0451576_0370678 3300045051 Bacteria 1500
140 Ga0451576_1014216 3300045051 Bacteria 870
141 Ga0495592_0353556 3300046454 Bacteria 941
142 Ga0495653_0665582 3300046463 Unclassified 635
143 Ga0495582_0148079 3300046473 Bacteria 1332
144 Ga0495664_0081293 3300046477 Bacteria 1943
145 Ga0495630_0009363 3300046517 Bacteria 7041
146 Ga0495630_0212627 3300046517 Unclassified 1476
147 Ga0495652_0036726 3300046529 Bacteria 4257
148 Ga0495652_0500181 3300046529 Bacteria 843
149 Ga0495587_0372797 3300046536 Bacteria 794
150 Ga0495645_0001977 3300046543 Bacteria 13937
151 Ga0495668_0449485 3300046616 Bacteria 709
152 Ga0495625_0500664 3300046660 Bacteria 743
153 Ga0495588_0346191 3300046674 Bacteria 781
154 Ga0495599_0041377 3300046678 Bacteria 2894
155 Ga0495623_0056539 3300046679 Bacteria 2470
156 Ga0495613_0221766 3300046689 Bacteria 1327
157 Ga0495649_0147845 3300046694 Bacteria 1235
158 Ga0495600_0154053 3300046809 Bacteria 1487
159 Ga0495604_0029465 3300047317 Bacteria 4367
160 Ga0495636_0321674 3300047318 Bacteria 726
161 Ga0495672_0001214 3300047320 Bacteria 26001
162 Ga0495675_0575083 3300047444 Bacteria 641
163 Ga0495684_0062343 3300047471 Bacteria 2836
164 Ga0495602_0265083 3300048088 Bacteria 1272
165 Ga0496102_0004512 3300048905 Bacteria 11761
166 Ga0496105_0663487 3300048908 Bacteria 804
167 Ga0496107_0642636 3300048910 Bacteria 782
168 Ga0496108_0800218 3300048911 Bacteria 813
169 Ga0496109_0214936 3300048912 Bacteria 1808
170 Ga0496110_0102405 3300048913 Bacteria 2568
171 Ga0496111_0098084 3300048914 Bacteria 2152
172 Ga0496111_0099014 3300048914 Bacteria 2141
173 Ga0496112_0078959 3300048915 Bacteria 3255
174 Ga0496112_0268540 3300048915 Bacteria 1654
175 Ga0501306_001790 3300049127 Bacteria 2091
176 Ga0501309_025827 3300049129 Bacteria 846
177 Ga0501310_016335 3300049130 Bacteria 889
178 Ga0501305_012206 3300049161 Bacteria 1172
179 Ga0501311_023506 3300049527 Bacteria 853
180 Ga0501316_001457 3300049532 Bacteria 2013
181 Ga0501317_001365 3300049533 Bacteria 2094
182 Ga0501318_036385 3300049534 Bacteria 689
183 Ga0501321_017212 3300049537 Bacteria 867
184 Ga0501033_0314445 3300049570 Bacteria 1101
185 Ga0501046_0049787 3300049580 Bacteria 3313
186 Ga0501047_0000448 3300049581 Bacteria 45549
187 Ga0501075_0010133 3300049591 Bacteria 6615
188 Ga0501076_0655110 3300049592 Bacteria 867
189 Ga0501257_013830 3300049686 Unclassified 1852
190 Ga0501080_0144115 3300049742 Bacteria 2202
191 Ga0501080_0400170 3300049742 Bacteria 1235
192 Ga0501083_0354975 3300049744 Bacteria 953
193 nmdc:mga05p37_146717_c1 3300050507 Bacteria 2888
194 nmdc:mga08y16_498880_c1 3300050511 Bacteria 1237
195 nmdc:mga0n895_128679_c1 3300050512 Bacteria 2557
196 nmdc:mga0n895_1836500_c1 3300050512 Bacteria 566
197 nmdc:mga0rr50_115544_c1 3300050513 Bacteria 2130
198 nmdc:mga0rr50_846234_c1 3300050513 Bacteria 780
199 nmdc:mga0a205_130756_c1 3300050515 Bacteria 2411
200 nmdc:mga0a205_603421_c1 3300050515 Unclassified 951
201 Ga0495595_0208644 3300053084 Bacteria 973
202 Ga0500595_101646 3300053119 Bacteria 823
203 2854683956 2854681122 Bacteria 4548679
204 2894776591 2894772417 Bacteria 5305674
205 Ga0105240_10025759
206 rootH1_10075123
207 rootH2_10272918
208 rootH1_10302527
209 Ga0070690_100017161
210 Ga0068869_100092366
211 Ga0070689_100010806
212 Ga0070692_10054608
213 Ga0070668_100343657
214 Ga0070669_100046185
215 Ga0070673_100041794
216 Ga0070673_100372705
217 Ga0070688_100034476
218 Ga0070688_100157691
219 Ga0070667_100481702
220 Ga0070713_100513940
221 Ga0070701_10765381
222 Ga0070711_100090341
223 Ga0070711_100839370
224 Ga0070678_100242279
225 Ga0068867_100301861
226 Ga0070685_11184397
227 Ga0070686_100644445
228 Ga0070695_100809845
229 Ga0070695_100875046
230 Ga0070665_100331696
231 Ga0070665_100851298
232 Ga0070665_102201917
233 Ga0068855_100009609
234 Ga0068852_100235578
235 Ga0068852_100676522
236 Ga0068859_101403689
237 Ga0068866_10288043
238 Ga0068861_100164998
239 Ga0068861_101587350
240 Ga0068860_100992821
241 Ga0068862_101460957
242 Ga0081455_10003431
243 Ga0070717_10789047
244 Ga0070712_100542838
245 Ga0070712_101062121
246 Ga0097621_100479438
247 Ga0075428_100400288
248 Ga0075434_100016807
249 Ga0075434_100108332
250 Ga0097620_101403867
251 Ga0075435_100008945
252 Ga0075435_100393904
253 Ga0111539_10127287
254 Ga0105245_10437287
255 Ga0105241_11043338
256 Ga0105248_10020936
257 Ga0157373_10001639
258 Ga0157374_10079789
259 Ga0157374_10322505
260 Ga0157378_11026370
261 Ga0163162_11292771
262 Ga0157375_10088648
263 Ga0163163_10044168
264 Ga0163163_10831842
265 Ga0157376_10012329
266 Ga0157376_10424022
267 Ga0163161_10678753
268 Ga0207673_1000766
269 Ga0209050_1000093
270 Ga0207695_10040777
271 Ga0207693_10473071
272 Ga0207663_10094588
273 Ga0207649_10997210
274 Ga0207646_10315078
275 Ga0207681_10278356
276 Ga0207650_10043589
277 Ga0207700_10219527
278 Ga0207700_10321345
279 Ga0207665_10547749
280 Ga0207711_11458090
281 Ga0207689_10031234
282 Ga0207679_12024387
283 Ga0207667_10112994
284 Ga0207651_10118893
285 Ga0207658_10244474
286 Ga0207702_10453862
287 Ga0207648_10478789
288 Ga0207674_10175671
289 Ga0207675_100031600
290 Ga0207683_10283165
291 Ga0207698_10603109
292 Ga0209999_1068732
293 Ga0268266_10211712
294 Ga0265337_1005878
295 Ga0265337_1031215
296 Ga0265319_1034234
297 Ga0265319_1087779
298 Ga0265318_10029064
299 Ga0265338_10002888
300 Ga0265338_10033443
301 Ga0265338_10087684
302 Ga0265338_10125112
303 Ga0265338_10318540
304 Ga0265324_10027991
305 Ga0265332_10084097
306 Ga0265332_10200942
307 Ga0265320_10000204
308 Ga0265320_10005998
309 Ga0265320_10017462
310 Ga0265325_10136229
311 Ga0265340_10012667
312 Ga0265331_10008481
313 Ga0265316_10685061
314 Ga0265313_10000197
315 Ga0265342_10043389
316 Ga0316576_10085250
317 Ga0316577_10014212
318 Ga0316574_0115190
319 Ga0373933_0798928
320 Ga0373937_0198448
321 Ga0316584_0028285
322 Ga0395899_0472365
323 Ga0395899_0762605
324 Ga0395900_0055565
325 Ga0395900_0588013
326 Ga0395900_1005410
327 Ga0395898_0001520
328 Ga0395898_0117690
329 Ga0395898_0410076
330 Ga0395905_0231164
331 Ga0395901_0012420
332 Ga0395901_0249415
333 Ga0400483_035209
334 Ga0451791_1906348
335 Ga0451845_0460971
336 Ga0451577_0016142
337 Ga0451577_0498219
338 Ga0451577_0660117
339 Ga0451577_0714189
340 Ga0451577_0746974
341 Ga0453683_0531901
342 Ga0453684_0005683
343 Ga0451576_0370678
344 Ga0451576_1014216
345 Ga0495592_0353556
346 Ga0495653_0665582
347 Ga0495582_0148079
348 Ga0495664_0081293
349 Ga0495630_0009363
350 Ga0495630_0212627
351 Ga0495652_0036726
352 Ga0495652_0500181
353 Ga0495587_0372797
354 Ga0495645_0001977
355 Ga0495668_0449485
356 Ga0495625_0500664
357 Ga0495588_0346191
358 Ga0495599_0041377
359 Ga0495623_0056539
360 Ga0495613_0221766
361 Ga0495649_0147845
362 Ga0495600_0154053
363 Ga0495604_0029465
364 Ga0495636_0321674
365 Ga0495672_0001214
366 Ga0495675_0575083
367 Ga0495684_0062343
368 Ga0495602_0265083
369 Ga0496102_0004512
370 Ga0496105_0663487
371 Ga0496107_0642636
372 Ga0496108_0800218
373 Ga0496109_0214936
374 Ga0496110_0102405
375 Ga0496111_0098084
376 Ga0496111_0099014
377 Ga0496112_0078959
378 Ga0496112_0268540
379 Ga0501306_001790
380 Ga0501309_025827
381 Ga0501310_016335
382 Ga0501305_012206
383 Ga0501311_023506
384 Ga0501316_001457
385 Ga0501317_001365
386 Ga0501318_036385
387 Ga0501321_017212
388 Ga0501033_0314445
389 Ga0501046_0049787
390 Ga0501047_0000448
391 Ga0501075_0010133
392 Ga0501076_0655110
393 Ga0501257_013830
394 Ga0501080_0144115
395 Ga0501080_0400170
396 Ga0501083_0354975
397 nmdc:mga05p37_146717_c1
398 nmdc:mga08y16_498880_c1
399 nmdc:mga0n895_128679_c1
400 nmdc:mga0n895_1836500_c1
401 nmdc:mga0rr50_115544_c1
402 nmdc:mga0rr50_846234_c1
403 nmdc:mga0a205_130756_c1
404 nmdc:mga0a205_603421_c1
405 Ga0495595_0208644
406 Ga0500595_101646
407 2854683956
408 2894776591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

15

44

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

132

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

133

0.86

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

120

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8he6-assembly1.cif.gz_B crystal structure of a fosfomycin and bleomycin resistant protein (all3014) from anabaena/nostoc cyanobacterium at 1.70 a resolution 0.8064 10 132
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8017 6 128
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.7959 10 136
2i7r-assembly1.cif.gz_B conserved domain protein 0.795 10 132
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.7946 13 133
ID Description Score Start End Superfamily
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8462 104 131 2.30.29.30
af_D3ZDI6_185_278_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8451 104 129 2.30.29.30
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8288 10 138 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8185 12 148 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8174 10 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A431P746-F1-model_v4 deleted 1.001 84 159
AF-A0A4Q3WBU0-F1-model_v4 Glyoxalase 0.9813 76 160
AF-A0A838GBZ9-F1-model_v4 VOC family protein 0.9788 76 160
AF-A0A7V3CZX6-F1-model_v4 Glyoxalase 0.9726 88 159
AF-A0A2T4XH78-F1-model_v4 Glyoxalase 0.9702 79 159

Map