F312464

General Info

Members Datasets Scaffolds Average Seq Length
204 158 408 234

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10255265|Ga0114129_102552653
Length 262
Sequence MTMSIGRRASVEFIGTFWLVFGGCGSAVIAAAFPNVGIGLLGVALAFGLTVLTMAYAIGHISGCHLNPAVSVGLWAGRRFPGKDIAPYVAAQVLGAIAGAAVLYVIASGKEGFSLSSGFAANGFGAHSPGGYSLVAGLVSEVVLTAMFLFIILGATDGRAPEGFAPIAIGLGLTLIHLIGIPVTNVSVNPARSTGPALFVGGWALAQLWLFWVAPLLGAVCAGLGYRFLAGSETQPVADVVKGVAIEQVAFGFDRFGQAAER

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 2.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.47
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10255265 3300009147 Bacteria 2352
2 Ga0058859_11790877 3300004798 Bacteria 2209
3 Ga0058860_10089805 3300004801 Bacteria 2128
4 Ga0070677_10005401 3300005333 Bacteria 4210
5 Ga0068868_100585416 3300005338 Bacteria 987
6 Ga0070668_100102767 3300005347 Bacteria 2266
7 Ga0070669_100066812 3300005353 Bacteria 2651
8 Ga0070669_100166861 3300005353 Bacteria 1714
9 Ga0070675_100022111 3300005354 Bacteria 5081
10 Ga0070675_100085326 3300005354 Bacteria 2638
11 Ga0070674_100016650 3300005356 Bacteria 4611
12 Ga0070667_100151692 3300005367 Bacteria 2036
13 Ga0070700_100019602 3300005441 Bacteria 3906
14 Ga0070708_100919132 3300005445 Bacteria 821
15 Ga0070678_100009553 3300005456 Bacteria 5883
16 Ga0070678_100010726 3300005456 Bacteria 5613
17 Ga0070662_100013001 3300005457 Bacteria 5531
18 Ga0070707_100286683 3300005468 Bacteria 1600
19 Ga0070707_100558327 3300005468 Bacteria 1107
20 Ga0068853_100023296 3300005539 Bacteria 5181
21 Ga0070672_100002888 3300005543 Bacteria 11045
22 Ga0070686_100074564 3300005544 Bacteria 2230
23 Ga0070695_100078327 3300005545 Bacteria 2179
24 Ga0070696_100022335 3300005546 Bacteria 4297
25 Ga0070665_100024042 3300005548 Bacteria 6136
26 Ga0068857_100084528 3300005577 Bacteria 2836
27 Ga0068856_100403753 3300005614 Bacteria 1386
28 Ga0068856_100533110 3300005614 Bacteria 1195
29 Ga0068852_100006260 3300005616 Bacteria 8587
30 Ga0068852_100564028 3300005616 Bacteria 1140
31 Ga0068864_100017712 3300005618 Bacteria 5942
32 Ga0068851_10011000 3300005834 Bacteria 4234
33 Ga0068870_10034015 3300005840 Bacteria 2605
34 Ga0068858_100055271 3300005842 Bacteria 3670
35 Ga0068858_100522020 3300005842 Bacteria 1148
36 Ga0068860_100148111 3300005843 Bacteria 2260
37 Ga0068862_100173178 3300005844 Bacteria 1933
38 Ga0081538_10021285 3300005981 Bacteria 4739
39 Ga0081540_1004747 3300005983 Bacteria 10272
40 Ga0081540_1006778 3300005983 Bacteria 8281
41 Ga0081539_10028082 3300005985 Bacteria 3546
42 Ga0070712_100140738 3300006175 Bacteria 1841
43 Ga0068871_100498089 3300006358 Bacteria 1098
44 Ga0075428_100133144 3300006844 Bacteria 2703
45 Ga0075430_100051812 3300006846 Bacteria 3457
46 Ga0075430_100556909 3300006846 Bacteria 946
47 Ga0075431_100039691 3300006847 Bacteria 4850
48 Ga0075431_100218710 3300006847 Bacteria 1944
49 Ga0075429_100151497 3300006880 Bacteria 2031
50 Ga0068865_100126029 3300006881 Bacteria 1911
51 Ga0068865_100182823 3300006881 Bacteria 1616
52 Ga0075436_100122663 3300006914 Unclassified 1819
53 Ga0075435_100156333 3300007076 Bacteria 1919
54 Ga0075435_100818494 3300007076 Bacteria 811
55 Ga0111539_10037776 3300009094 Bacteria 5828
56 Ga0111539_10694382 3300009094 Bacteria 1185
57 Ga0114129_10076250 3300009147 Unclassified 4668
58 Ga0114129_10284512 3300009147 Bacteria 2208
59 Ga0105242_10005247 3300009176 Bacteria 9999
60 Ga0105242_10018088 3300009176 Bacteria 5505
61 Ga0105249_10292257 3300009553 Bacteria 1631
62 Ga0157370_10215773 3300013104 Bacteria 1778
63 Ga0163162_10007172 3300013306 Bacteria 10822
64 Ga0163162_10114122 3300013306 Bacteria 2801
65 Ga0157372_10366309 3300013307 Bacteria 1679
66 Ga0157375_10018762 3300013308 Bacteria 6277
67 Ga0163163_10082497 3300014325 Bacteria 3219
68 Ga0163163_10530326 3300014325 Unclassified 1240
69 Ga0163163_10646820 3300014325 Bacteria 1121
70 Ga0157380_10059745 3300014326 Bacteria 3043
71 Ga0157376_10232793 3300014969 Bacteria 1712
72 Ga0157376_10344534 3300014969 Bacteria 1424
73 Ga0163161_10091393 3300017792 Bacteria 2253
74 Ga0163161_10445342 3300017792 Bacteria 1046
75 Ga0207697_10031799 3300025315 Bacteria 2159
76 Ga0207656_10209469 3300025321 Bacteria 944
77 Ga0207682_10017935 3300025893 Bacteria 2763
78 Ga0207647_10366347 3300025904 Bacteria 815
79 Ga0207699_10451528 3300025906 Bacteria 922
80 Ga0207645_10024198 3300025907 Bacteria 3940
81 Ga0207643_10031767 3300025908 Bacteria 2945
82 Ga0207693_10362839 3300025915 Bacteria 1133
83 Ga0207663_10486953 3300025916 Bacteria 956
84 Ga0207681_10184472 3300025923 Bacteria 1592
85 Ga0207681_10322217 3300025923 Bacteria 1229
86 Ga0207681_10426727 3300025923 Bacteria 1075
87 Ga0207650_10608684 3300025925 Bacteria 919
88 Ga0207659_10088009 3300025926 Bacteria 2313
89 Ga0207659_10135237 3300025926 Bacteria 1907
90 Ga0207644_10398994 3300025931 Bacteria 1124
91 Ga0207690_10254292 3300025932 Bacteria 1358
92 Ga0207706_10015232 3300025933 Bacteria 6955
93 Ga0207706_10768353 3300025933 Bacteria 820
94 Ga0207686_10027007 3300025934 Bacteria 3356
95 Ga0207686_10032306 3300025934 Bacteria 3114
96 Ga0207669_10430688 3300025937 Bacteria 1040
97 Ga0207704_10015451 3300025938 Bacteria 3891
98 Ga0207691_10000414 3300025940 Bacteria 42796
99 Ga0207711_10461681 3300025941 Bacteria 1182
100 Ga0207668_10199102 3300025972 Bacteria 1593
101 Ga0207668_10808157 3300025972 Bacteria 830
102 Ga0207658_10026136 3300025986 Bacteria 4091
103 Ga0207703_10056510 3300026035 Bacteria 3197
104 Ga0207708_10130541 3300026075 Bacteria 1964
105 Ga0207702_10430009 3300026078 Bacteria 1278
106 Ga0207702_10563577 3300026078 Bacteria 1115
107 Ga0207648_10008675 3300026089 Bacteria 9808
108 Ga0207674_10015748 3300026116 Bacteria 8294
109 Ga0207674_10102355 3300026116 Bacteria 2844
110 Ga0207675_100011000 3300026118 Bacteria 8476
111 Ga0207675_100486471 3300026118 Bacteria 1227
112 Ga0207683_10032926 3300026121 Bacteria 4503
113 Ga0207698_10122040 3300026142 Bacteria 2207
114 Ga0207428_10237610 3300027907 Bacteria 1362
115 Ga0268266_10031772 3300028379 Bacteria 4486
116 Ga0268265_10286252 3300028380 Bacteria 1477
117 Ga0265327_10142008 3300031251 Bacteria 1122
118 Ga0307513_10070180 3300031456 Bacteria 3663
119 Ga0307509_10219411 3300031507 Bacteria 1717
120 Ga0307508_10000840 3300031616 Bacteria 35693
121 Ga0307516_10018117 3300031730 Bacteria 7322
122 Ga0307414_10000013 3300032004 Bacteria 310222
123 Ga0307414_10032006 3300032004 Bacteria 3457
124 Ga0316593_10129238 3300032168 Bacteria 911
125 Ga0373954_0035842 3300035118 Bacteria 2302
126 Ga0373957_0158848 3300035120 Bacteria 931
127 Ga0373943_0226191 3300035170 Bacteria 1044
128 Ga0373927_0025378 3300035695 Bacteria 3874
129 Ga0373933_0285670 3300035724 Bacteria 1066
130 Ga0373937_0020548 3300036401 Bacteria 5919
131 Ga0373937_0096878 3300036401 Bacteria 2736
132 Ga0373925_0022598 3300037068 Bacteria 4589
133 Ga0373925_0325832 3300037068 Bacteria 1244
134 Ga0436365_1181792 3300039437 Bacteria 11439
135 Ga0436361_0644644 3300039447 Bacteria 2811
136 Ga0450893_0036747 3300042532 Bacteria 887
137 Ga0453683_0041440 3300044673 Bacteria 2892
138 Ga0451576_0346102 3300045051 Bacteria 1556
139 Ga0466967_0218090 3300045976 Bacteria 1812
140 Ga0495651_0109929 3300046462 Unclassified 2040
141 Ga0495580_0002603 3300046472 Bacteria 15667
142 Ga0495582_0008976 3300046473 Bacteria 5516
143 Ga0495606_0002853 3300046507 Bacteria 19146
144 Ga0495663_0049713 3300046525 Bacteria 1295
145 Ga0495586_0074247 3300046535 Bacteria 1861
146 Ga0495645_0153659 3300046543 Bacteria 1597
147 Ga0495656_0048385 3300046615 Bacteria 1807
148 Ga0495668_0000076 3300046616 Bacteria 161826
149 Ga0495668_0094269 3300046616 Bacteria 1639
150 Ga0495659_0060132 3300046664 Bacteria 1401
151 Ga0495658_0074767 3300046683 Bacteria 1975
152 Ga0495613_0178362 3300046689 Unclassified 1505
153 Ga0495613_0211266 3300046689 Bacteria 1365
154 Ga0495670_0118472 3300046691 Bacteria 1374
155 Ga0495674_0331274 3300047319 Unclassified 1239
156 Ga0495684_0038376 3300047471 Unclassified 3673
157 Ga0495686_0179373 3300047472 Bacteria 1228
158 Ga0496101_0073847 3300048904 Bacteria 2506
159 Ga0496104_0000011 3300048907 Bacteria 459358
160 Ga0496105_0000014 3300048908 Bacteria 220911
161 Ga0501308_018655 3300049128 Bacteria 850
162 Ga0501304_010388 3300049160 Bacteria 813
163 Ga0501032_0024929 3300049569 Bacteria 4127
164 Ga0501033_0347314 3300049570 Bacteria 1040
165 Ga0501034_0273089 3300049571 Bacteria 1631
166 Ga0501034_0913732 3300049571 Bacteria 765
167 Ga0501039_0043206 3300049575 Bacteria 3482
168 Ga0501040_0221010 3300049576 Bacteria 1348
169 Ga0501041_0107965 3300049577 Bacteria 1726
170 Ga0501041_0271364 3300049577 Bacteria 1067
171 Ga0501042_0121455 3300049578 Bacteria 1881
172 Ga0501046_0237940 3300049580 Bacteria 1344
173 Ga0501070_0333672 3300049586 Bacteria 1232
174 Ga0501071_0022459 3300049587 Bacteria 4398
175 Ga0501072_0003304 3300049588 Bacteria 12130
176 Ga0501074_0021887 3300049590 Bacteria 4642
177 Ga0501074_0490298 3300049590 Bacteria 871
178 Ga0501075_0146460 3300049591 Bacteria 1800
179 Ga0501076_0096477 3300049592 Bacteria 2381
180 Ga0501076_0411865 3300049592 Bacteria 1112
181 Ga0501079_0230250 3300049741 Bacteria 1447
182 Ga0501035_0050042 3300049822 Bacteria 3745
183 Ga0501044_0038655 3300049823 Bacteria 4983
184 Ga0501045_0235389 3300049824 Bacteria 1363
185 nmdc:mga05p37_378357_c1 3300050507 Bacteria 1660
186 nmdc:mga09592_112768_c1 3300050508 Bacteria 2333
187 nmdc:mga0qj67_54772_c1 3300050509 Bacteria 3159
188 nmdc:mga06r32_237104_c1 3300050510 Bacteria 1812
189 nmdc:mga06r32_8921_c1 3300050510 Bacteria 9037
190 nmdc:mga08y16_529416_c1 3300050511 Bacteria 1194
191 nmdc:mga0n895_240879_c1 3300050512 Bacteria 1835
192 nmdc:mga0n895_56408_c1 3300050512 Unclassified 3870
193 nmdc:mga08x19_97029_c1 3300050514 Unclassified 1951
194 nmdc:mga0a205_33860_c1 3300050515 Unclassified 4899
195 nmdc:mga0a205_477139_c1 3300050515 Bacteria 1106
196 Ga0500568_0004316 3300053139 Bacteria 7628
197 Ga0501084_0212546 3300054114 Bacteria 1632
198 Ga0587082_024042 3300059504 Bacteria 1015
199 Ga0501082_0136401 3300060353 Bacteria 2129
200 Ga0501082_0489094 3300060353 Bacteria 1075
201 Ga0530510_0032406 3300061734 Bacteria 3760
202 Ga0530510_0068303 3300061734 Bacteria 2578
203 Ga0530510_0172228 3300061734 Bacteria 1603
204 Ga0530510_0552739 3300061734 Bacteria 874
205 Ga0114129_10255265
206 Ga0058859_11790877
207 Ga0058860_10089805
208 Ga0070677_10005401
209 Ga0068868_100585416
210 Ga0070668_100102767
211 Ga0070669_100066812
212 Ga0070669_100166861
213 Ga0070675_100022111
214 Ga0070675_100085326
215 Ga0070674_100016650
216 Ga0070667_100151692
217 Ga0070700_100019602
218 Ga0070708_100919132
219 Ga0070678_100009553
220 Ga0070678_100010726
221 Ga0070662_100013001
222 Ga0070707_100286683
223 Ga0070707_100558327
224 Ga0068853_100023296
225 Ga0070672_100002888
226 Ga0070686_100074564
227 Ga0070695_100078327
228 Ga0070696_100022335
229 Ga0070665_100024042
230 Ga0068857_100084528
231 Ga0068856_100403753
232 Ga0068856_100533110
233 Ga0068852_100006260
234 Ga0068852_100564028
235 Ga0068864_100017712
236 Ga0068851_10011000
237 Ga0068870_10034015
238 Ga0068858_100055271
239 Ga0068858_100522020
240 Ga0068860_100148111
241 Ga0068862_100173178
242 Ga0081538_10021285
243 Ga0081540_1004747
244 Ga0081540_1006778
245 Ga0081539_10028082
246 Ga0070712_100140738
247 Ga0068871_100498089
248 Ga0075428_100133144
249 Ga0075430_100051812
250 Ga0075430_100556909
251 Ga0075431_100039691
252 Ga0075431_100218710
253 Ga0075429_100151497
254 Ga0068865_100126029
255 Ga0068865_100182823
256 Ga0075436_100122663
257 Ga0075435_100156333
258 Ga0075435_100818494
259 Ga0111539_10037776
260 Ga0111539_10694382
261 Ga0114129_10076250
262 Ga0114129_10284512
263 Ga0105242_10005247
264 Ga0105242_10018088
265 Ga0105249_10292257
266 Ga0157370_10215773
267 Ga0163162_10007172
268 Ga0163162_10114122
269 Ga0157372_10366309
270 Ga0157375_10018762
271 Ga0163163_10082497
272 Ga0163163_10530326
273 Ga0163163_10646820
274 Ga0157380_10059745
275 Ga0157376_10232793
276 Ga0157376_10344534
277 Ga0163161_10091393
278 Ga0163161_10445342
279 Ga0207697_10031799
280 Ga0207656_10209469
281 Ga0207682_10017935
282 Ga0207647_10366347
283 Ga0207699_10451528
284 Ga0207645_10024198
285 Ga0207643_10031767
286 Ga0207693_10362839
287 Ga0207663_10486953
288 Ga0207681_10184472
289 Ga0207681_10322217
290 Ga0207681_10426727
291 Ga0207650_10608684
292 Ga0207659_10088009
293 Ga0207659_10135237
294 Ga0207644_10398994
295 Ga0207690_10254292
296 Ga0207706_10015232
297 Ga0207706_10768353
298 Ga0207686_10027007
299 Ga0207686_10032306
300 Ga0207669_10430688
301 Ga0207704_10015451
302 Ga0207691_10000414
303 Ga0207711_10461681
304 Ga0207668_10199102
305 Ga0207668_10808157
306 Ga0207658_10026136
307 Ga0207703_10056510
308 Ga0207708_10130541
309 Ga0207702_10430009
310 Ga0207702_10563577
311 Ga0207648_10008675
312 Ga0207674_10015748
313 Ga0207674_10102355
314 Ga0207675_100011000
315 Ga0207675_100486471
316 Ga0207683_10032926
317 Ga0207698_10122040
318 Ga0207428_10237610
319 Ga0268266_10031772
320 Ga0268265_10286252
321 Ga0265327_10142008
322 Ga0307513_10070180
323 Ga0307509_10219411
324 Ga0307508_10000840
325 Ga0307516_10018117
326 Ga0307414_10000013
327 Ga0307414_10032006
328 Ga0316593_10129238
329 Ga0373954_0035842
330 Ga0373957_0158848
331 Ga0373943_0226191
332 Ga0373927_0025378
333 Ga0373933_0285670
334 Ga0373937_0020548
335 Ga0373937_0096878
336 Ga0373925_0022598
337 Ga0373925_0325832
338 Ga0436365_1181792
339 Ga0436361_0644644
340 Ga0450893_0036747
341 Ga0453683_0041440
342 Ga0451576_0346102
343 Ga0466967_0218090
344 Ga0495651_0109929
345 Ga0495580_0002603
346 Ga0495582_0008976
347 Ga0495606_0002853
348 Ga0495663_0049713
349 Ga0495586_0074247
350 Ga0495645_0153659
351 Ga0495656_0048385
352 Ga0495668_0000076
353 Ga0495668_0094269
354 Ga0495659_0060132
355 Ga0495658_0074767
356 Ga0495613_0178362
357 Ga0495613_0211266
358 Ga0495670_0118472
359 Ga0495674_0331274
360 Ga0495684_0038376
361 Ga0495686_0179373
362 Ga0496101_0073847
363 Ga0496104_0000011
364 Ga0496105_0000014
365 Ga0501308_018655
366 Ga0501304_010388
367 Ga0501032_0024929
368 Ga0501033_0347314
369 Ga0501034_0273089
370 Ga0501034_0913732
371 Ga0501039_0043206
372 Ga0501040_0221010
373 Ga0501041_0107965
374 Ga0501041_0271364
375 Ga0501042_0121455
376 Ga0501046_0237940
377 Ga0501070_0333672
378 Ga0501071_0022459
379 Ga0501072_0003304
380 Ga0501074_0021887
381 Ga0501074_0490298
382 Ga0501075_0146460
383 Ga0501076_0096477
384 Ga0501076_0411865
385 Ga0501079_0230250
386 Ga0501035_0050042
387 Ga0501044_0038655
388 Ga0501045_0235389
389 nmdc:mga05p37_378357_c1
390 nmdc:mga09592_112768_c1
391 nmdc:mga0qj67_54772_c1
392 nmdc:mga06r32_237104_c1
393 nmdc:mga06r32_8921_c1
394 nmdc:mga08y16_529416_c1
395 nmdc:mga0n895_240879_c1
396 nmdc:mga0n895_56408_c1
397 nmdc:mga08x19_97029_c1
398 nmdc:mga0a205_33860_c1
399 nmdc:mga0a205_477139_c1
400 Ga0500568_0004316
401 Ga0501084_0212546
402 Ga0587082_024042
403 Ga0501082_0136401
404 Ga0501082_0489094
405 Ga0530510_0032406
406 Ga0530510_0068303
407 Ga0530510_0172228
408 Ga0530510_0552739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

226

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.991 1 234
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9901 1 234
3nkc-assembly2.cif.gz_B crystal structure of aqpz f43w,h174g,t183f 0.9901 4 234
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9875 1 234
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.9875 4 234
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9801 1 237 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9553 1 237 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9382 1 109 1.20.1080.10
2b5fB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9308 4 233 1.20.1080.10
af_Q9V5Z7_14_242_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9305 3 231 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A0D1LSR2-F1-model_v4 deleted 0.9987 1 234
AF-A0A6S5TVF1-F1-model_v4 Aquaporin Z 0.9985 1 235 GO:0005886
GO:0015250
AF-A0A2K4IAI4-F1-model_v4 Aquaporin Z 0.998 1 234 GO:0005886
GO:0015250
AF-A0A5B0FZ81-F1-model_v4 Aquaporin Z 0.9979 1 235 GO:0005886
GO:0015250
AF-A0A3T0JQZ1-F1-model_v4 Aquaporin Z 0.9979 1 234 GO:0005886
GO:0015250

Map