F312673

General Info

Members Datasets Scaffolds Average Seq Length
204 134 408 141

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10020398|Ga0307515_100203984
Length 168
Sequence MGHPAPEYRRHLPGGCSGRLGAARRWPEMRVRLVAVVAIAMLGATMTAHAADDAIDTPLTDVPGDAARGRAIVVNRQLGLCLLCHSGPFAEERSQGNMAPDLSGAGARWSEGQLRLRLVDSRRLNPQTLMPSYRRTDGLERVGAAWRGQAVLSAQQVEDVVAFLRTLK

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
102 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
114 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
115 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
116 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
117 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
118 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
119 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
120 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
126 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
131 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
132 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
133 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
134 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.29
Nodule 0
Rhizoplane 2.94
Rhizosphere 41.18
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10020398 3300028794 Bacteria 11827
2 Ga0068869_101139465 3300005334 Bacteria 684
3 Ga0070668_101847166 3300005347 Bacteria 556
4 Ga0070675_100691799 3300005354 Bacteria 928
5 Ga0070673_100305899 3300005364 Bacteria 1401
6 Ga0070667_100001934 3300005367 Bacteria 18379
7 Ga0068855_100906942 3300005563 Bacteria 931
8 Ga0068854_101074350 3300005578 Bacteria 716
9 Ga0068852_100182449 3300005616 Bacteria 1974
10 Ga0068861_100098149 3300005719 Bacteria 2325
11 Ga0068862_100406263 3300005844 Bacteria 1275
12 Ga0081455_10009526 3300005937 Bacteria 9976
13 Ga0075365_10098959 3300006038 Bacteria 1995
14 Ga0075368_10049610 3300006042 Bacteria 1666
15 Ga0075368_10175010 3300006042 Bacteria 903
16 Ga0075363_100163283 3300006048 Bacteria 1262
17 Ga0075364_10182924 3300006051 Bacteria 1419
18 Ga0075362_10018002 3300006177 Bacteria 2918
19 Ga0075362_10046347 3300006177 Bacteria 1933
20 Ga0075362_10172032 3300006177 Bacteria 1047
21 Ga0075367_10017464 3300006178 Bacteria 3939
22 Ga0075367_10029448 3300006178 Bacteria 3140
23 Ga0075369_10011576 3300006186 Bacteria 3473
24 Ga0075369_10159126 3300006186 Bacteria 1035
25 Ga0075366_10016273 3300006195 Bacteria 4273
26 Ga0075366_10076189 3300006195 Bacteria 2002
27 Ga0075370_10034420 3300006353 Bacteria 2839
28 Ga0075370_10113345 3300006353 Bacteria 1575
29 Ga0075370_10156068 3300006353 Bacteria 1338
30 Ga0068865_100122673 3300006881 Bacteria 1935
31 Ga0105240_10058123 3300009093 Bacteria 4829
32 Ga0105245_10135824 3300009098 Bacteria 2311
33 Ga0105241_10716406 3300009174 Bacteria 915
34 Ga0105248_12246797 3300009177 Bacteria 621
35 Ga0105237_10186971 3300009545 Bacteria 2071
36 Ga0105237_10373997 3300009545 Bacteria 1430
37 Ga0105239_10330864 3300010375 Bacteria 1718
38 Ga0157369_11024496 3300013105 Bacteria 845
39 Ga0157375_10528416 3300013308 Bacteria 1342
40 Ga0157379_10120730 3300014968 Bacteria 2357
41 Ga0157379_10332313 3300014968 Bacteria 1389
42 Ga0157379_11152344 3300014968 Bacteria 744
43 Ga0209673_1009561 3300025273 Bacteria 4178
44 Ga0209050_1000282 3300025298 Bacteria 108629
45 Ga0209256_1038372 3300025299 Bacteria 1241
46 Ga0209051_1085399 3300025303 Bacteria 895
47 Ga0207682_10136939 3300025893 Bacteria 1096
48 Ga0207680_10275262 3300025903 Bacteria 1168
49 Ga0207695_10032651 3300025913 Bacteria 5694
50 Ga0207671_10262730 3300025914 Bacteria 1359
51 Ga0207657_10567826 3300025919 Bacteria 886
52 Ga0207659_10338303 3300025926 Bacteria 1246
53 Ga0207687_10144813 3300025927 Bacteria 1806
54 Ga0207690_10834293 3300025932 Bacteria 763
55 Ga0207706_10052888 3300025933 Bacteria 3585
56 Ga0207669_10488657 3300025937 Bacteria 983
57 Ga0207704_10024034 3300025938 Bacteria 3296
58 Ga0207689_10526534 3300025942 Bacteria 992
59 Ga0207667_10823574 3300025949 Bacteria 924
60 Ga0207651_10568372 3300025960 Bacteria 988
61 Ga0207640_10654682 3300025981 Bacteria 895
62 Ga0207658_10006941 3300025986 Bacteria 7710
63 Ga0207658_11042348 3300025986 Bacteria 747
64 Ga0207678_10049003 3300026067 Bacteria 3650
65 Ga0207648_10611359 3300026089 Bacteria 1005
66 Ga0207674_10130688 3300026116 Bacteria 2474
67 Ga0207675_100123470 3300026118 Bacteria 2451
68 Ga0207698_11265478 3300026142 Bacteria 752
69 Ga0209813_10188866 3300027866 Bacteria 757
70 Ga0268265_10447315 3300028380 Bacteria 1206
71 Ga0307517_10003242 3300028786 Bacteria 25464
72 Ga0307517_10094739 3300028786 Bacteria 2408
73 Ga0307515_10031041 3300028794 Bacteria 8934
74 Ga0307515_10065748 3300028794 Bacteria 5039
75 Ga0307515_10121841 3300028794 Bacteria 2947
76 Ga0307515_10249828 3300028794 Bacteria 1528
77 Ga0307512_10041391 3300030522 Bacteria 3830
78 Ga0307512_10148115 3300030522 Bacteria 1413
79 Ga0307513_10018336 3300031456 Bacteria 8367
80 Ga0307513_10343991 3300031456 Bacteria 1241
81 Ga0307509_10009390 3300031507 Bacteria 12239
82 Ga0307509_10061405 3300031507 Bacteria 3967
83 Ga0307509_10197255 3300031507 Bacteria 1855
84 Ga0307509_10219249 3300031507 Bacteria 1718
85 Ga0307509_10351500 3300031507 Bacteria 1197
86 Ga0307509_10560291 3300031507 Unclassified 819
87 Ga0307509_10631436 3300031507 Bacteria 741
88 Ga0307508_10000028 3300031616 Bacteria 168639
89 Ga0307508_10001494 3300031616 Bacteria 26240
90 Ga0307508_10084591 3300031616 Bacteria 2754
91 Ga0307508_10253794 3300031616 Bacteria 1354
92 Ga0307508_10468225 3300031616 Bacteria 853
93 Ga0307508_10887875 3300031616 Bacteria 516
94 Ga0307514_10034183 3300031649 Bacteria 4052
95 Ga0307514_10140769 3300031649 Bacteria 1640
96 Ga0307516_10001972 3300031730 Bacteria 28094
97 Ga0307516_10117227 3300031730 Bacteria 2457
98 Ga0307516_10141690 3300031730 Bacteria 2173
99 Ga0307516_10318328 3300031730 Bacteria 1227
100 Ga0307516_10394411 3300031730 Bacteria 1044
101 Ga0307405_10786163 3300031731 Bacteria 796
102 Ga0307410_11979663 3300031852 Bacteria 520
103 Ga0307507_10370947 3300033179 Bacteria 830
104 Ga0307510_10009944 3300033180 Bacteria 11306
105 Ga0307510_10033557 3300033180 Bacteria 5762
106 Ga0307510_10143253 3300033180 Bacteria 2028
107 Ga0307510_10167684 3300033180 Bacteria 1780
108 Ga0307510_10178141 3300033180 Bacteria 1693
109 Ga0307510_10195426 3300033180 Bacteria 1565
110 Ga0373950_0091702 3300034818 Unclassified 646
111 Ga0373931_0110413 3300035691 Bacteria 1559
112 Ga0373925_0153977 3300037068 Bacteria 1807
113 Ga0395900_0111107 3300037418 Bacteria 2815
114 Ga0436362_0425435 3300039453 Bacteria 815
115 Ga0436362_0834207 3300039453 Bacteria 706
116 Ga0451793_1280473 3300041452 Bacteria 673
117 Ga0451577_0253127 3300042876 Bacteria 1594
118 Ga0495592_0001923 3300046454 Bacteria 14629
119 Ga0495638_0049859 3300046460 Bacteria 2616
120 Ga0495610_0075414 3300046512 Bacteria 1562
121 Ga0495616_0315133 3300046513 Bacteria 658
122 Ga0495620_0150490 3300046515 Bacteria 907
123 Ga0495631_0228525 3300046518 Bacteria 794
124 Ga0495632_0004456 3300046519 Bacteria 9514
125 Ga0495632_0023136 3300046519 Bacteria 3322
126 Ga0495632_0023266 3300046519 Bacteria 3311
127 Ga0495632_0167785 3300046519 Bacteria 1009
128 Ga0495648_0277323 3300046524 Bacteria 796
129 Ga0495609_0097701 3300046538 Bacteria 1274
130 Ga0495622_0168406 3300046557 Bacteria 986
131 Ga0495622_0190812 3300046557 Bacteria 916
132 Ga0495611_0150694 3300046648 Bacteria 1086
133 Ga0495611_0187896 3300046648 Bacteria 965
134 Ga0495625_0069085 3300046660 Bacteria 2482
135 Ga0495625_0224186 3300046660 Bacteria 1230
136 Ga0495624_0172537 3300046690 Bacteria 1319
137 Ga0495671_0142092 3300046692 Bacteria 1170
138 Ga0495671_0445509 3300046692 Bacteria 619
139 Ga0495649_0000541 3300046694 Bacteria 32077
140 Ga0495660_0005435 3300046810 Bacteria 7629
141 Ga0495676_0047900 3300047321 Bacteria 3451
142 Ga0495687_004487 3300047443 Bacteria 9398
143 Ga0495687_009407 3300047443 Bacteria 5464
144 Ga0495593_0132198 3300047673 Bacteria 1266
145 Ga0496106_0014751 3300048909 Bacteria 5777
146 Ga0496106_0132347 3300048909 Bacteria 1957
147 Ga0496112_0490433 3300048915 Bacteria 1165
148 Ga0496113_0221742 3300048916 Bacteria 1507
149 Ga0496113_0741050 3300048916 Bacteria 783
150 Ga0496121_0172578 3300048924 Bacteria 1569
151 Ga0495682_0105637 3300049460 Bacteria 1010
152 nmdc:mga03683_106015_c1 3300050489 Bacteria 1239
153 nmdc:mga03683_62588_c1 3300050489 Bacteria 1576
154 nmdc:mga03n38_173579_c1 3300050490 Bacteria 1100
155 nmdc:mga00v17_53877_c1 3300050491 Bacteria 2453
156 nmdc:mga0yw44_54778_c1 3300050492 Bacteria 2425
157 nmdc:mga0yw44_742542_c1 3300050492 Bacteria 667
158 nmdc:mga0yw44_83781_c1 3300050492 Bacteria 2003
159 nmdc:mga0k408_195101_c1 3300050493 Bacteria 1209
160 nmdc:mga0k408_51352_c1 3300050493 Bacteria 2389
161 nmdc:mga06z11_125716_c1 3300050494 Bacteria 1435
162 nmdc:mga06z11_189889_c1 3300050494 Bacteria 1189
163 nmdc:mga06z11_19185_c1 3300050494 Bacteria 3139
164 nmdc:mga04h51_216731_c1 3300050495 Bacteria 757
165 nmdc:mga04h51_31733_c1 3300050495 Bacteria 1671
166 nmdc:mga07m45_110535_c1 3300050496 Bacteria 1583
167 nmdc:mga07m45_190093_c1 3300050496 Bacteria 1194
168 nmdc:mga07m45_326000_c1 3300050496 Bacteria 893
169 nmdc:mga07m45_326733_c1 3300050496 Bacteria 892
170 Ga0500578_0001060 3300053086 Bacteria 29908
171 Ga0500578_0017684 3300053086 Bacteria 4581
172 Ga0500644_0008293 3300053088 Bacteria 2739
173 Ga0500583_0127602 3300053092 Bacteria 1261
174 Ga0500583_0207998 3300053092 Bacteria 972
175 Ga0500651_0033486 3300053093 Bacteria 3240
176 Ga0500651_0085062 3300053093 Bacteria 1955
177 Ga0500650_0283576 3300053098 Bacteria 736
178 Ga0500594_0019960 3300053118 Bacteria 1666
179 Ga0500607_074129 3300053121 Bacteria 1750
180 Ga0500628_020083 3300053129 Bacteria 1338
181 Ga0500642_0011091 3300053130 Bacteria 3208
182 Ga0500652_000299 3300053131 Bacteria 18083
183 Ga0500655_059449 3300053133 Bacteria 769
184 Ga0500658_0003732 3300053134 Bacteria 5738
185 Ga0500658_0090865 3300053134 Bacteria 1320
186 Ga0500559_0000694 3300053136 Bacteria 22155
187 Ga0500564_181156 3300053138 Bacteria 878
188 Ga0500568_0016275 3300053139 Bacteria 3311
189 Ga0500568_0048787 3300053139 Bacteria 1672
190 Ga0500573_0328616 3300053140 Bacteria 752
191 Ga0500619_000023 3300053154 Bacteria 50489
192 Ga0500619_050138 3300053154 Bacteria 1349
193 Ga0500620_217136 3300053155 Bacteria 647
194 Ga0500622_0000125 3300053156 Bacteria 81109
195 Ga0500622_0008466 3300053156 Bacteria 5753
196 Ga0500636_0044331 3300053177 Bacteria 2623
197 Ga0500645_000226 3300053730 Bacteria 42982
198 Ga0500645_001912 3300053730 Bacteria 9900
199 Ga0500645_005748 3300053730 Bacteria 4514
200 Ga0500552_001171 3300053733 Bacteria 2483
201 Ga0500587_002482 3300053739 Bacteria 2621
202 2644143380 2643221625 Bacteria 6512927
203 2644276183 2643221648 Bacteria 6521465
204 2644301137 2643221654 Bacteria 5273570
205 Ga0307515_10020398
206 Ga0068869_101139465
207 Ga0070668_101847166
208 Ga0070675_100691799
209 Ga0070673_100305899
210 Ga0070667_100001934
211 Ga0068855_100906942
212 Ga0068854_101074350
213 Ga0068852_100182449
214 Ga0068861_100098149
215 Ga0068862_100406263
216 Ga0081455_10009526
217 Ga0075365_10098959
218 Ga0075368_10049610
219 Ga0075368_10175010
220 Ga0075363_100163283
221 Ga0075364_10182924
222 Ga0075362_10018002
223 Ga0075362_10046347
224 Ga0075362_10172032
225 Ga0075367_10017464
226 Ga0075367_10029448
227 Ga0075369_10011576
228 Ga0075369_10159126
229 Ga0075366_10016273
230 Ga0075366_10076189
231 Ga0075370_10034420
232 Ga0075370_10113345
233 Ga0075370_10156068
234 Ga0068865_100122673
235 Ga0105240_10058123
236 Ga0105245_10135824
237 Ga0105241_10716406
238 Ga0105248_12246797
239 Ga0105237_10186971
240 Ga0105237_10373997
241 Ga0105239_10330864
242 Ga0157369_11024496
243 Ga0157375_10528416
244 Ga0157379_10120730
245 Ga0157379_10332313
246 Ga0157379_11152344
247 Ga0209673_1009561
248 Ga0209050_1000282
249 Ga0209256_1038372
250 Ga0209051_1085399
251 Ga0207682_10136939
252 Ga0207680_10275262
253 Ga0207695_10032651
254 Ga0207671_10262730
255 Ga0207657_10567826
256 Ga0207659_10338303
257 Ga0207687_10144813
258 Ga0207690_10834293
259 Ga0207706_10052888
260 Ga0207669_10488657
261 Ga0207704_10024034
262 Ga0207689_10526534
263 Ga0207667_10823574
264 Ga0207651_10568372
265 Ga0207640_10654682
266 Ga0207658_10006941
267 Ga0207658_11042348
268 Ga0207678_10049003
269 Ga0207648_10611359
270 Ga0207674_10130688
271 Ga0207675_100123470
272 Ga0207698_11265478
273 Ga0209813_10188866
274 Ga0268265_10447315
275 Ga0307517_10003242
276 Ga0307517_10094739
277 Ga0307515_10031041
278 Ga0307515_10065748
279 Ga0307515_10121841
280 Ga0307515_10249828
281 Ga0307512_10041391
282 Ga0307512_10148115
283 Ga0307513_10018336
284 Ga0307513_10343991
285 Ga0307509_10009390
286 Ga0307509_10061405
287 Ga0307509_10197255
288 Ga0307509_10219249
289 Ga0307509_10351500
290 Ga0307509_10560291
291 Ga0307509_10631436
292 Ga0307508_10000028
293 Ga0307508_10001494
294 Ga0307508_10084591
295 Ga0307508_10253794
296 Ga0307508_10468225
297 Ga0307508_10887875
298 Ga0307514_10034183
299 Ga0307514_10140769
300 Ga0307516_10001972
301 Ga0307516_10117227
302 Ga0307516_10141690
303 Ga0307516_10318328
304 Ga0307516_10394411
305 Ga0307405_10786163
306 Ga0307410_11979663
307 Ga0307507_10370947
308 Ga0307510_10009944
309 Ga0307510_10033557
310 Ga0307510_10143253
311 Ga0307510_10167684
312 Ga0307510_10178141
313 Ga0307510_10195426
314 Ga0373950_0091702
315 Ga0373931_0110413
316 Ga0373925_0153977
317 Ga0395900_0111107
318 Ga0436362_0425435
319 Ga0436362_0834207
320 Ga0451793_1280473
321 Ga0451577_0253127
322 Ga0495592_0001923
323 Ga0495638_0049859
324 Ga0495610_0075414
325 Ga0495616_0315133
326 Ga0495620_0150490
327 Ga0495631_0228525
328 Ga0495632_0004456
329 Ga0495632_0023136
330 Ga0495632_0023266
331 Ga0495632_0167785
332 Ga0495648_0277323
333 Ga0495609_0097701
334 Ga0495622_0168406
335 Ga0495622_0190812
336 Ga0495611_0150694
337 Ga0495611_0187896
338 Ga0495625_0069085
339 Ga0495625_0224186
340 Ga0495624_0172537
341 Ga0495671_0142092
342 Ga0495671_0445509
343 Ga0495649_0000541
344 Ga0495660_0005435
345 Ga0495676_0047900
346 Ga0495687_004487
347 Ga0495687_009407
348 Ga0495593_0132198
349 Ga0496106_0014751
350 Ga0496106_0132347
351 Ga0496112_0490433
352 Ga0496113_0221742
353 Ga0496113_0741050
354 Ga0496121_0172578
355 Ga0495682_0105637
356 nmdc:mga03683_106015_c1
357 nmdc:mga03683_62588_c1
358 nmdc:mga03n38_173579_c1
359 nmdc:mga00v17_53877_c1
360 nmdc:mga0yw44_54778_c1
361 nmdc:mga0yw44_742542_c1
362 nmdc:mga0yw44_83781_c1
363 nmdc:mga0k408_195101_c1
364 nmdc:mga0k408_51352_c1
365 nmdc:mga06z11_125716_c1
366 nmdc:mga06z11_189889_c1
367 nmdc:mga06z11_19185_c1
368 nmdc:mga04h51_216731_c1
369 nmdc:mga04h51_31733_c1
370 nmdc:mga07m45_110535_c1
371 nmdc:mga07m45_190093_c1
372 nmdc:mga07m45_326000_c1
373 nmdc:mga07m45_326733_c1
374 Ga0500578_0001060
375 Ga0500578_0017684
376 Ga0500644_0008293
377 Ga0500583_0127602
378 Ga0500583_0207998
379 Ga0500651_0033486
380 Ga0500651_0085062
381 Ga0500650_0283576
382 Ga0500594_0019960
383 Ga0500607_074129
384 Ga0500628_020083
385 Ga0500642_0011091
386 Ga0500652_000299
387 Ga0500655_059449
388 Ga0500658_0003732
389 Ga0500658_0090865
390 Ga0500559_0000694
391 Ga0500564_181156
392 Ga0500568_0016275
393 Ga0500568_0048787
394 Ga0500573_0328616
395 Ga0500619_000023
396 Ga0500619_050138
397 Ga0500620_217136
398 Ga0500622_0000125
399 Ga0500622_0008466
400 Ga0500636_0044331
401 Ga0500645_000226
402 Ga0500645_001912
403 Ga0500645_005748
404 Ga0500552_001171
405 Ga0500587_002482
406 2644143380
407 2644276183
408 2644301137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

66

168

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h31-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8993 24 143
2c1d-assembly4.cif.gz_H crystal structure of soxxa from p. pantotrophus 0.8928 24 143
2oz1-assembly1.cif.gz_B the soxax complex of rhodovulum sulfidophilum 0.8784 24 144
1h33-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8765 24 144
1h33-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.79 24 144
ID Description Score Start End Superfamily
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9082 24 143 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8997 24 144 1.10.760.10
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7956 24 143 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7942 24 144 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7597 72 144 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A0S9QCE0-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.964 22 144 GO:0009055
GO:0020037
GO:0046872
AF-A0A3N1KR94-F1-model_v4 Sulfur-oxidizing protein SoxX 0.9568 23 144 GO:0009055
GO:0020037
GO:0046872
AF-A0A2N3PPW5-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9556 23 144 GO:0009055
GO:0020037
GO:0046872
AF-W3REU5-F1-model_v4 Cytochrome C 0.955 23 143 GO:0009055
GO:0020037
GO:0046872
AF-A0A0F2R7D9-F1-model_v4 Cytochrome c domain-containing protein 0.9546 24 144 GO:0009055
GO:0020037
GO:0046872

Map