F312985

General Info

Members Datasets Scaffolds Average Seq Length
204 154 408 118

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0876220|Ga0495602_0876220_150_542
Length 130
Sequence MAPGVGIDLLEIDRLERALERHPRLAERVFTESERRYAAARARPGRHLAARFAAKEAVVKALGLSGGFGLREVEVLAGEPPTVRLSGSVAEAANGEQINISLTHSRDYAAAVALRSSSAGAYRGQRRTDP

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 9.31
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0876220 3300048088 Bacteria 599
2 Ga0070670_101362522 3300005331 Bacteria 650
3 Ga0070680_100006526 3300005336 Bacteria 8871
4 Ga0070689_100453336 3300005340 Bacteria 1092
5 Ga0070691_10000004 3300005341 Bacteria 80156
6 Ga0070692_11349908 3300005345 Bacteria 513
7 Ga0070659_100462707 3300005366 Bacteria 1077
8 Ga0070705_101815961 3300005440 Bacteria 517
9 Ga0070694_100519666 3300005444 Bacteria 950
10 Ga0070708_100986249 3300005445 Bacteria 790
11 Ga0070662_100000001 3300005457 Bacteria 317995
12 Ga0070681_10200978 3300005458 Bacteria 1911
13 Ga0068867_101425433 3300005459 Bacteria 643
14 Ga0070685_10144219 3300005466 Bacteria 1503
15 Ga0070679_100000088 3300005530 Bacteria 69314
16 Ga0068853_100003781 3300005539 Bacteria 11596
17 Ga0070686_101552375 3300005544 Bacteria 559
18 Ga0070695_100081258 3300005545 Bacteria 2144
19 Ga0070696_100849474 3300005546 Bacteria 754
20 Ga0070665_100000022 3300005548 Bacteria 379286
21 Ga0070704_100314685 3300005549 Bacteria 1309
22 Ga0070664_100020189 3300005564 Bacteria 5486
23 Ga0070702_100958921 3300005615 Bacteria 674
24 Ga0068863_100000261 3300005841 Bacteria 55053
25 Ga0068858_100001140 3300005842 Bacteria 27503
26 Ga0081539_10174304 3300005985 Bacteria 1014
27 Ga0075364_10241976 3300006051 Bacteria 1226
28 Ga0105245_10000857 3300009098 Bacteria 27591
29 Ga0105245_10938578 3300009098 Unclassified 908
30 Ga0114129_10574922 3300009147 Bacteria 1463
31 Ga0105243_11886313 3300009148 Bacteria 630
32 Ga0105239_10759003 3300010375 Bacteria 1110
33 Ga0105246_10590256 3300011119 Bacteria 958
34 Ga0105246_11895569 3300011119 Bacteria 572
35 Ga0157374_10037391 3300013296 Bacteria 4455
36 Ga0157374_10037702 3300013296 Bacteria 4439
37 Ga0157372_10832860 3300013307 Bacteria 1071
38 Ga0157372_11211029 3300013307 Bacteria 872
39 Ga0157375_10003564 3300013308 Bacteria 13514
40 Ga0157375_10129808 3300013308 Bacteria 2638
41 Ga0157375_10922617 3300013308 Bacteria 1016
42 Ga0163163_10243541 3300014325 Bacteria 1848
43 Ga0163163_10265080 3300014325 Bacteria 1769
44 Ga0163163_10385357 3300014325 Bacteria 1459
45 Ga0157380_10003730 3300014326 Bacteria 10481
46 Ga0157377_11204980 3300014745 Bacteria 586
47 Ga0163161_10174498 3300017792 Bacteria 1645
48 Ga0163161_10322670 3300017792 Bacteria 1221
49 Ga0207707_10200473 3300025912 Bacteria 1740
50 Ga0207695_11243719 3300025913 Bacteria 625
51 Ga0207660_10480448 3300025917 Bacteria 1007
52 Ga0207657_10447685 3300025919 Bacteria 1013
53 Ga0207652_10000232 3300025921 Bacteria 58473
54 Ga0207687_10000095 3300025927 Bacteria 64664
55 Ga0207690_10235811 3300025932 Bacteria 1407
56 Ga0207706_10000003 3300025933 Bacteria 345011
57 Ga0207709_11640571 3300025935 Bacteria 534
58 Ga0207670_10163002 3300025936 Bacteria 1666
59 Ga0207669_10064402 3300025937 Bacteria 2268
60 Ga0207661_10357970 3300025944 Bacteria 1318
61 Ga0207679_10008689 3300025945 Bacteria 6476
62 Ga0207703_10000020 3300026035 Bacteria 251603
63 Ga0207639_10002475 3300026041 Bacteria 12386
64 Ga0207702_11231338 3300026078 Bacteria 743
65 Ga0207428_10961957 3300027907 Unclassified 601
66 Ga0268266_10000029 3300028379 Bacteria 424015
67 Ga0265337_1000167 3300028556 Bacteria 34055
68 Ga0265326_10000179 3300028558 Bacteria 32210
69 Ga0265319_1222627 3300028563 Bacteria 577
70 Ga0265322_10000005 3300028654 Bacteria 246112
71 Ga0265336_10004170 3300028666 Bacteria 5504
72 Ga0265338_10165734 3300028800 Bacteria 1701
73 Ga0265324_10000183 3300029957 Bacteria 48185
74 Ga0265328_10000354 3300031239 Bacteria 21630
75 Ga0265320_10000010 3300031240 Bacteria 250501
76 Ga0265329_10003630 3300031242 Bacteria 6662
77 Ga0265331_10000217 3300031250 Bacteria 69142
78 Ga0265327_10000040 3300031251 Bacteria 291052
79 Ga0265316_10147506 3300031344 Bacteria 1764
80 Ga0265313_10048215 3300031595 Bacteria 2057
81 Ga0265314_10000578 3300031711 Bacteria 46350
82 Ga0265342_10192017 3300031712 Bacteria 1114
83 Ga0307410_10188281 3300031852 Bacteria 1568
84 Ga0373937_0020483 3300036401 Bacteria 5929
85 Ga0395899_0437572 3300037312 Unclassified 859
86 Ga0395900_0340383 3300037418 Bacteria 1476
87 Ga0395900_0515064 3300037418 Bacteria 1145
88 Ga0395898_0525038 3300037466 Bacteria 1125
89 Ga0395901_1052353 3300038443 Unclassified 787
90 Ga0395901_1602409 3300038443 Bacteria 604
91 Ga0451853_0363641 3300041512 Bacteria 1084
92 Ga0451853_2762518 3300041512 Bacteria 2780
93 Ga0466967_0103415 3300045976 Bacteria 2606
94 Ga0466967_0345648 3300045976 Bacteria 1439
95 Ga0466967_1412099 3300045976 Bacteria 693
96 Ga0495603_0000546 3300046455 Bacteria 20981
97 Ga0495603_0001929 3300046455 Bacteria 12230
98 Ga0495603_0201572 3300046455 Bacteria 1150
99 Ga0495629_0191849 3300046459 Bacteria 1414
100 Ga0495629_0267165 3300046459 Bacteria 1175
101 Ga0495629_0485797 3300046459 Bacteria 834
102 Ga0495641_0341642 3300046461 Bacteria 676
103 Ga0495651_0021828 3300046462 Bacteria 4978
104 Ga0495651_0180127 3300046462 Unclassified 1496
105 Ga0495651_0649807 3300046462 Bacteria 661
106 Ga0495653_0082043 3300046463 Bacteria 2381
107 Ga0495639_0343783 3300046475 Bacteria 748
108 Ga0495662_0059873 3300046476 Bacteria 1839
109 Ga0495662_0227614 3300046476 Bacteria 919
110 Ga0495664_0162902 3300046477 Bacteria 1353
111 Ga0495620_0107712 3300046515 Bacteria 1106
112 Ga0495630_0008188 3300046517 Bacteria 7506
113 Ga0495630_0173087 3300046517 Bacteria 1645
114 Ga0495644_0008215 3300046523 Bacteria 4018
115 Ga0495652_0000018 3300046529 Bacteria 201634
116 Ga0495640_0014624 3300046533 Bacteria 5930
117 Ga0495586_0000588 3300046535 Bacteria 21115
118 Ga0495587_0001456 3300046536 Bacteria 15786
119 Ga0495645_0183676 3300046543 Bacteria 1431
120 Ga0495633_0010194 3300046558 Bacteria 5141
121 Ga0495634_0002310 3300046642 Bacteria 15954
122 Ga0495634_0014734 3300046642 Bacteria 5625
123 Ga0495634_0114465 3300046642 Bacteria 1732
124 Ga0495635_0000005 3300046663 Bacteria 302178
125 Ga0495599_0001943 3300046678 Bacteria 11977
126 Ga0495599_0169665 3300046678 Bacteria 1347
127 Ga0495623_0477288 3300046679 Bacteria 661
128 Ga0495646_0053539 3300046680 Bacteria 2433
129 Ga0495658_0055392 3300046683 Bacteria 2259
130 Ga0495669_0020122 3300046684 Bacteria 2886
131 Ga0495624_0000347 3300046690 Bacteria 36770
132 Ga0495649_0002095 3300046694 Bacteria 14310
133 Ga0495604_0002435 3300047317 Bacteria 14888
134 Ga0495604_0050244 3300047317 Bacteria 3238
135 Ga0495676_0000499 3300047321 Bacteria 32193
136 Ga0495676_0164477 3300047321 Bacteria 1567
137 Ga0495676_0842454 3300047321 Bacteria 589
138 Ga0495680_0001950 3300047322 Bacteria 21725
139 Ga0495675_0398298 3300047444 Bacteria 803
140 Ga0495684_0186575 3300047471 Bacteria 1535
141 Ga0495593_0363188 3300047673 Bacteria 724
142 Ga0495602_0089185 3300048088 Bacteria 2565
143 Ga0496101_0647867 3300048904 Bacteria 835
144 Ga0496101_0671028 3300048904 Bacteria 819
145 Ga0496104_0000230 3300048907 Bacteria 49225
146 Ga0496104_0851191 3300048907 Bacteria 817
147 Ga0496105_0000051 3300048908 Bacteria 90365
148 Ga0496105_0031461 3300048908 Bacteria 4350
149 Ga0496106_0000042 3300048909 Bacteria 106662
150 Ga0496107_0044471 3300048910 Bacteria 3192
151 Ga0496108_0476384 3300048911 Bacteria 1091
152 Ga0496110_0016499 3300048913 Bacteria 6168
153 Ga0496110_0802143 3300048913 Bacteria 846
154 Ga0496111_0070061 3300048914 Bacteria 2550
155 Ga0496111_0676424 3300048914 Bacteria 752
156 Ga0496113_0030159 3300048916 Bacteria 3923
157 Ga0496113_0105726 3300048916 Bacteria 2185
158 Ga0496113_0925477 3300048916 Bacteria 689
159 Ga0496114_0000003 3300048917 Bacteria 630981
160 Ga0496114_0049431 3300048917 Bacteria 3499
161 Ga0496115_0000022 3300048918 Bacteria 164224
162 Ga0501034_0762207 3300049571 Bacteria 863
163 Ga0501036_0019168 3300049572 Bacteria 5740
164 Ga0501036_0471004 3300049572 Bacteria 1046
165 Ga0501039_0279105 3300049575 Bacteria 1313
166 Ga0501040_0956654 3300049576 Bacteria 621
167 Ga0501040_1178977 3300049576 Unclassified 556
168 Ga0501041_0460434 3300049577 Unclassified 808
169 Ga0501042_0001883 3300049578 Bacteria 12596
170 Ga0501042_0047126 3300049578 Bacteria 3073
171 Ga0501046_0442598 3300049580 Bacteria 935
172 Ga0501047_1378261 3300049581 Unclassified 520
173 Ga0501068_0072947 3300049584 Bacteria 2097
174 Ga0501069_0043928 3300049585 Bacteria 2474
175 Ga0501069_0209179 3300049585 Bacteria 1132
176 Ga0501070_0079877 3300049586 Bacteria 2706
177 Ga0501071_0013145 3300049587 Bacteria 5636
178 Ga0501072_0082699 3300049588 Bacteria 2545
179 Ga0501073_0012623 3300049589 Bacteria 6164
180 Ga0501074_0129045 3300049590 Bacteria 1809
181 Ga0501074_1338197 3300049590 Bacteria 502
182 Ga0501075_0003322 3300049591 Bacteria 10753
183 Ga0501075_0004965 3300049591 Bacteria 9069
184 Ga0501076_0268713 3300049592 Bacteria 1396
185 Ga0501076_1194743 3300049592 Bacteria 626
186 Ga0501077_0132659 3300049593 Bacteria 1579
187 Ga0501079_0015392 3300049741 Bacteria 5835
188 Ga0501079_1387728 3300049741 Bacteria 553
189 Ga0501080_0045444 3300049742 Bacteria 4088
190 Ga0501081_0136035 3300049743 Bacteria 1759
191 Ga0501083_0721096 3300049744 Bacteria 648
192 Ga0501045_0959443 3300049824 Bacteria 627
193 nmdc:mga00v17_139346_c1 3300050491 Bacteria 1554
194 nmdc:mga00v17_229551_c1 3300050491 Bacteria 1202
195 nmdc:mga0rr50_409042_c1 3300050513 Bacteria 1147
196 Ga0495601_0005883 3300053077 Bacteria 7151
197 Ga0495601_0006430 3300053077 Bacteria 6871
198 Ga0495601_0180794 3300053077 Bacteria 1379
199 Ga0495612_0018261 3300053078 Bacteria 2809
200 Ga0495612_0035910 3300053078 Bacteria 2010
201 Ga0501084_0002440 3300054114 Bacteria 14959
202 Ga0501082_0082416 3300060353 Bacteria 2776
203 Ga0501082_0284724 3300060353 Bacteria 1439
204 Ga0530510_0003780 3300061734 Bacteria 10425
205 Ga0495602_0876220
206 Ga0070670_101362522
207 Ga0070680_100006526
208 Ga0070689_100453336
209 Ga0070691_10000004
210 Ga0070692_11349908
211 Ga0070659_100462707
212 Ga0070705_101815961
213 Ga0070694_100519666
214 Ga0070708_100986249
215 Ga0070662_100000001
216 Ga0070681_10200978
217 Ga0068867_101425433
218 Ga0070685_10144219
219 Ga0070679_100000088
220 Ga0068853_100003781
221 Ga0070686_101552375
222 Ga0070695_100081258
223 Ga0070696_100849474
224 Ga0070665_100000022
225 Ga0070704_100314685
226 Ga0070664_100020189
227 Ga0070702_100958921
228 Ga0068863_100000261
229 Ga0068858_100001140
230 Ga0081539_10174304
231 Ga0075364_10241976
232 Ga0105245_10000857
233 Ga0105245_10938578
234 Ga0114129_10574922
235 Ga0105243_11886313
236 Ga0105239_10759003
237 Ga0105246_10590256
238 Ga0105246_11895569
239 Ga0157374_10037391
240 Ga0157374_10037702
241 Ga0157372_10832860
242 Ga0157372_11211029
243 Ga0157375_10003564
244 Ga0157375_10129808
245 Ga0157375_10922617
246 Ga0163163_10243541
247 Ga0163163_10265080
248 Ga0163163_10385357
249 Ga0157380_10003730
250 Ga0157377_11204980
251 Ga0163161_10174498
252 Ga0163161_10322670
253 Ga0207707_10200473
254 Ga0207695_11243719
255 Ga0207660_10480448
256 Ga0207657_10447685
257 Ga0207652_10000232
258 Ga0207687_10000095
259 Ga0207690_10235811
260 Ga0207706_10000003
261 Ga0207709_11640571
262 Ga0207670_10163002
263 Ga0207669_10064402
264 Ga0207661_10357970
265 Ga0207679_10008689
266 Ga0207703_10000020
267 Ga0207639_10002475
268 Ga0207702_11231338
269 Ga0207428_10961957
270 Ga0268266_10000029
271 Ga0265337_1000167
272 Ga0265326_10000179
273 Ga0265319_1222627
274 Ga0265322_10000005
275 Ga0265336_10004170
276 Ga0265338_10165734
277 Ga0265324_10000183
278 Ga0265328_10000354
279 Ga0265320_10000010
280 Ga0265329_10003630
281 Ga0265331_10000217
282 Ga0265327_10000040
283 Ga0265316_10147506
284 Ga0265313_10048215
285 Ga0265314_10000578
286 Ga0265342_10192017
287 Ga0307410_10188281
288 Ga0373937_0020483
289 Ga0395899_0437572
290 Ga0395900_0340383
291 Ga0395900_0515064
292 Ga0395898_0525038
293 Ga0395901_1052353
294 Ga0395901_1602409
295 Ga0451853_0363641
296 Ga0451853_2762518
297 Ga0466967_0103415
298 Ga0466967_0345648
299 Ga0466967_1412099
300 Ga0495603_0000546
301 Ga0495603_0001929
302 Ga0495603_0201572
303 Ga0495629_0191849
304 Ga0495629_0267165
305 Ga0495629_0485797
306 Ga0495641_0341642
307 Ga0495651_0021828
308 Ga0495651_0180127
309 Ga0495651_0649807
310 Ga0495653_0082043
311 Ga0495639_0343783
312 Ga0495662_0059873
313 Ga0495662_0227614
314 Ga0495664_0162902
315 Ga0495620_0107712
316 Ga0495630_0008188
317 Ga0495630_0173087
318 Ga0495644_0008215
319 Ga0495652_0000018
320 Ga0495640_0014624
321 Ga0495586_0000588
322 Ga0495587_0001456
323 Ga0495645_0183676
324 Ga0495633_0010194
325 Ga0495634_0002310
326 Ga0495634_0014734
327 Ga0495634_0114465
328 Ga0495635_0000005
329 Ga0495599_0001943
330 Ga0495599_0169665
331 Ga0495623_0477288
332 Ga0495646_0053539
333 Ga0495658_0055392
334 Ga0495669_0020122
335 Ga0495624_0000347
336 Ga0495649_0002095
337 Ga0495604_0002435
338 Ga0495604_0050244
339 Ga0495676_0000499
340 Ga0495676_0164477
341 Ga0495676_0842454
342 Ga0495680_0001950
343 Ga0495675_0398298
344 Ga0495684_0186575
345 Ga0495593_0363188
346 Ga0495602_0089185
347 Ga0496101_0647867
348 Ga0496101_0671028
349 Ga0496104_0000230
350 Ga0496104_0851191
351 Ga0496105_0000051
352 Ga0496105_0031461
353 Ga0496106_0000042
354 Ga0496107_0044471
355 Ga0496108_0476384
356 Ga0496110_0016499
357 Ga0496110_0802143
358 Ga0496111_0070061
359 Ga0496111_0676424
360 Ga0496113_0030159
361 Ga0496113_0105726
362 Ga0496113_0925477
363 Ga0496114_0000003
364 Ga0496114_0049431
365 Ga0496115_0000022
366 Ga0501034_0762207
367 Ga0501036_0019168
368 Ga0501036_0471004
369 Ga0501039_0279105
370 Ga0501040_0956654
371 Ga0501040_1178977
372 Ga0501041_0460434
373 Ga0501042_0001883
374 Ga0501042_0047126
375 Ga0501046_0442598
376 Ga0501047_1378261
377 Ga0501068_0072947
378 Ga0501069_0043928
379 Ga0501069_0209179
380 Ga0501070_0079877
381 Ga0501071_0013145
382 Ga0501072_0082699
383 Ga0501073_0012623
384 Ga0501074_0129045
385 Ga0501074_1338197
386 Ga0501075_0003322
387 Ga0501075_0004965
388 Ga0501076_0268713
389 Ga0501076_1194743
390 Ga0501077_0132659
391 Ga0501079_0015392
392 Ga0501079_1387728
393 Ga0501080_0045444
394 Ga0501081_0136035
395 Ga0501083_0721096
396 Ga0501045_0959443
397 nmdc:mga00v17_139346_c1
398 nmdc:mga00v17_229551_c1
399 nmdc:mga0rr50_409042_c1
400 Ga0495601_0005883
401 Ga0495601_0006430
402 Ga0495601_0180794
403 Ga0495612_0018261
404 Ga0495612_0035910
405 Ga0501084_0002440
406 Ga0501082_0082416
407 Ga0501082_0284724
408 Ga0530510_0003780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

113

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9087 4 116
2jca-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor holo- [acyl-carrier-protein] synthase (acps) at 2 a. 0.9034 1 115
2was-assembly2.cif.gz_D structure of the fungal type i fas ppt domain 0.8974 4 116
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.8931 1 115
6ql7-assembly1.cif.gz_B structure of fatty acid synthase complex with bound gamma subunit from saccharomyces cerevisiae at 4.6 angstrom 0.8901 3 116
ID Description Score Start End Superfamily
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8788 4 116 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8786 1 116 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8735 4 115 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8715 1 116 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8668 1 116 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A1H6FVE5-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9659 2 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7V9KAA3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9619 3 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7W0LXZ8-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9582 3 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7V8ZK11-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9571 4 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A1J5NDL0-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9547 4 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map