F313802

General Info

Members Datasets Scaffolds Average Seq Length
205 140 410 155

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10005064|Ga0105237_100050649
Length 169
Sequence LSVFIINVSLTLTNPIFVKENPPLKLTTMKTNIGITEKNTKAVSVELSKLLADEYILYTKTRNAHWNVEGPDFHSMHIFFEGQYGQLEDMLDGVAERIRTLGHYAPATLKSFLELTHLTEYSERKNDSLGFIKELLEDHESIVEFLRGNINTFANEYHDLGTSDYHFKN

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
136 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
137 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
138 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
139 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
140 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0
Rhizoplane 1.95
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10005064 3300009545 Bacteria 14970
2 JGI25162J39368_1000005 3300002737 Bacteria 435925
3 JGI25152J39213_1000044 3300002773 Bacteria 87213
4 JGI25150J39212_1000006 3300002774 Bacteria 257228
5 JGI25151J46595_10000024 3300003187 Bacteria 217596
6 JGI25153J46596_10000026 3300003215 Bacteria 217245
7 rootH2_10026787 3300003320 Unclassified 4247
8 rootH2_10071794 3300003320 Bacteria 1297
9 rootH2_10071795 3300003320 Bacteria 1297
10 rootL2_10010023 3300003322 Bacteria 7643
11 rootL2_10062250 3300003322 Bacteria 2630
12 rootL2_10062251 3300003322 Bacteria 3700
13 rootH1_10107410 3300003323 Bacteria 6818
14 rootH1_10116303 3300003323 Bacteria 3157
15 Ga0055536_1000002 3300003781 Bacteria 605605
16 Ga0055530_10001950 3300003791 Bacteria 14086
17 Ga0065704_10079609 3300005289 Bacteria 4118
18 Ga0070670_100165317 3300005331 Bacteria 1918
19 Ga0070666_10164319 3300005335 Bacteria 1552
20 Ga0070682_100003510 3300005337 Bacteria 8674
21 Ga0070660_100244907 3300005339 Unclassified 1461
22 Ga0070660_100434104 3300005339 Unclassified 1088
23 Ga0070689_100335628 3300005340 Bacteria 1265
24 Ga0070691_10006944 3300005341 Bacteria 5183
25 Ga0070659_101105293 3300005366 Bacteria 699
26 Ga0070662_100153866 3300005457 Unclassified 1793
27 Ga0070698_100070190 3300005471 Bacteria 3516
28 Ga0070698_100295396 3300005471 Bacteria 1551
29 Ga0068853_100024307 3300005539 Bacteria 5078
30 Ga0068853_100307660 3300005539 Bacteria 1466
31 Ga0070693_100037295 3300005547 Bacteria 2709
32 Ga0070665_100000001 3300005548 Bacteria 1083363
33 Ga0068855_100000206 3300005563 Bacteria 75521
34 Ga0068855_100171234 3300005563 Bacteria 2459
35 Ga0068855_100841142 3300005563 Bacteria 973
36 Ga0068855_102241224 3300005563 Unclassified 548
37 Ga0068857_100000416 3300005577 Bacteria 30150
38 Ga0068857_100059209 3300005577 Bacteria 3402
39 Ga0068856_100001369 3300005614 Bacteria 25648
40 Ga0068856_100033066 3300005614 Bacteria 5064
41 Ga0068856_100142820 3300005614 Bacteria 2401
42 Ga0068852_100037777 3300005616 Bacteria 4052
43 Ga0068859_100169349 3300005617 Bacteria 2265
44 Ga0068864_100272036 3300005618 Unclassified 1579
45 Ga0068858_100951778 3300005842 Unclassified 841
46 Ga0068860_100000111 3300005843 Bacteria 131004
47 Ga0068860_100135230 3300005843 Bacteria 2367
48 Ga0097621_100543297 3300006237 Bacteria 1057
49 Ga0075428_100944755 3300006844 Bacteria 914
50 Ga0097620_100169354 3300006931 Bacteria 2265
51 Ga0105251_10218084 3300009011 Bacteria 859
52 Ga0105240_10013673 3300009093 Bacteria 11131
53 Ga0105240_10033871 3300009093 Bacteria 6595
54 Ga0105240_10358278 3300009093 Unclassified 1653
55 Ga0105240_11343170 3300009093 Bacteria 753
56 Ga0105240_11703702 3300009093 Bacteria 658
57 Ga0105241_10000319 3300009174 Bacteria 36268
58 Ga0105241_10815503 3300009174 Bacteria 861
59 Ga0105237_10069915 3300009545 Bacteria 3506
60 Ga0105237_10170753 3300009545 Bacteria 2174
61 Ga0105237_10383540 3300009545 Bacteria 1410
62 Ga0105249_10022037 3300009553 Bacteria 5706
63 Ga0105249_10192528 3300009553 Bacteria 1991
64 Ga0105239_10001973 3300010375 Bacteria 26693
65 Ga0105239_10022723 3300010375 Bacteria 6914
66 Ga0105239_10138602 3300010375 Unclassified 2710
67 Ga0105239_11086850 3300010375 Bacteria 920
68 Ga0157373_11244393 3300013100 Bacteria 562
69 Ga0157371_10305774 3300013102 Bacteria 1152
70 Ga0157370_10000479 3300013104 Bacteria 49878
71 Ga0157370_10010061 3300013104 Bacteria 10000
72 Ga0157370_10174756 3300013104 Bacteria 1996
73 Ga0157378_10044390 3300013297 Bacteria 3947
74 Ga0157378_10106367 3300013297 Bacteria 2566
75 Ga0157378_11294102 3300013297 Unclassified 770
76 Ga0163162_10000101 3300013306 Bacteria 77114
77 Ga0163162_10138772 3300013306 Bacteria 2543
78 Ga0163162_10949091 3300013306 Bacteria 971
79 Ga0157372_10049421 3300013307 Bacteria 4676
80 Ga0157372_10364300 3300013307 Unclassified 1684
81 Ga0157375_10252187 3300013308 Bacteria 1926
82 Ga0157380_10880561 3300014326 Bacteria 920
83 Ga0182008_10000023 3300014497 Bacteria 201526
84 Ga0182006_1091958 3300015261 Bacteria 1090
85 Ga0183373_1002 3300015682 Bacteria 990153
86 Ga0209437_100043 3300025233 Bacteria 440454
87 Ga0207425_1000003 3300025245 Bacteria 1145342
88 Ga0209129_1000022 3300025258 Bacteria 440876
89 Ga0209676_1000022 3300025292 Bacteria 605659
90 Ga0209025_1000007 3300025294 Bacteria 1145109
91 Ga0209758_1000012 3300025297 Bacteria 949866
92 Ga0209050_1000020 3300025298 Bacteria 605671
93 Ga0209257_1000001 3300025304 Bacteria 2274655
94 Ga0207680_10386936 3300025903 Bacteria 987
95 Ga0207647_10012780 3300025904 Bacteria 5834
96 Ga0207654_10005271 3300025911 Bacteria 6530
97 Ga0207654_10317891 3300025911 Bacteria 1063
98 Ga0207707_10000721 3300025912 Bacteria 32676
99 Ga0207695_10000084 3300025913 Bacteria 282392
100 Ga0207695_10000323 3300025913 Bacteria 114265
101 Ga0207695_10017176 3300025913 Bacteria 8433
102 Ga0207695_10340539 3300025913 Bacteria 1387
103 Ga0207695_10632909 3300025913 Bacteria 951
104 Ga0207671_10003626 3300025914 Bacteria 15252
105 Ga0207671_10007035 3300025914 Bacteria 9856
106 Ga0207671_10153665 3300025914 Bacteria 1779
107 Ga0207660_10001254 3300025917 Bacteria 17002
108 Ga0207662_10369298 3300025918 Bacteria 967
109 Ga0207652_10002045 3300025921 Bacteria 17358
110 Ga0207694_10190291 3300025924 Bacteria 1667
111 Ga0207650_10024604 3300025925 Bacteria 4283
112 Ga0207690_10482928 3300025932 Bacteria 1000
113 Ga0207706_10561472 3300025933 Unclassified 982
114 Ga0207670_10933513 3300025936 Bacteria 728
115 Ga0207689_10998889 3300025942 Bacteria 706
116 Ga0207667_10000009 3300025949 Bacteria 603135
117 Ga0207667_10000135 3300025949 Bacteria 111565
118 Ga0207667_12034044 3300025949 Unclassified 534
119 Ga0207712_10023060 3300025961 Bacteria 4103
120 Ga0207712_10128121 3300025961 Bacteria 1930
121 Ga0207712_10143263 3300025961 Bacteria 1836
122 Ga0207712_10203640 3300025961 Unclassified 1571
123 Ga0207712_11124226 3300025961 Bacteria 700
124 Ga0207658_11321312 3300025986 Bacteria 659
125 Ga0207677_10256559 3300026023 Bacteria 1423
126 Ga0207639_10007875 3300026041 Bacteria 7277
127 Ga0207702_10252016 3300026078 Bacteria 1658
128 Ga0207702_10640368 3300026078 Bacteria 1045
129 Ga0207676_10169315 3300026095 Unclassified 1901
130 Ga0207674_10004100 3300026116 Bacteria 17648
131 Ga0207698_10122263 3300026142 Bacteria 2206
132 Ga0268266_10000049 3300028379 Bacteria 307763
133 Ga0268264_10000313 3300028381 Bacteria 77820
134 Ga0268264_10001221 3300028381 Bacteria 24720
135 Ga0307517_10002048 3300028786 Bacteria 32795
136 Ga0307517_10088138 3300028786 Bacteria 2569
137 Ga0265340_10130525 3300031247 Bacteria 1153
138 Ga0265327_10038135 3300031251 Bacteria 2625
139 Ga0307513_10083325 3300031456 Bacteria 3289
140 Ga0307513_10503089 3300031456 Unclassified 929
141 Ga0307509_10067402 3300031507 Bacteria 3750
142 Ga0265313_10021797 3300031595 Unclassified 3494
143 Ga0307405_10000008 3300031731 Bacteria 264953
144 Ga0307407_10000037 3300031903 Bacteria 71023
145 Ga0307407_10016078 3300031903 Bacteria 3717
146 Ga0307416_100000001 3300032002 Bacteria 515017
147 Ga0307416_100000048 3300032002 Bacteria 120194
148 Ga0307414_10006098 3300032004 Bacteria 6690
149 Ga0307411_10515570 3300032005 Bacteria 1014
150 Ga0307411_11735985 3300032005 Bacteria 578
151 Ga0395899_0210146 3300037312 Bacteria 1353
152 Ga0395900_0000330 3300037418 Bacteria 69819
153 Ga0395900_0029340 3300037418 Bacteria 5644
154 Ga0395900_0053199 3300037418 Unclassified 4167
155 Ga0395898_0032848 3300037466 Bacteria 5181
156 Ga0395905_0000769 3300037471 Bacteria 42306
157 Ga0395905_0001627 3300037471 Bacteria 26707
158 Ga0395901_0002005 3300038443 Bacteria 20948
159 Ga0451807_2733501 3300041486 Bacteria 1831
160 Ga0466972_0019301 3300044658 Bacteria 3409
161 Ga0466968_0374332 3300044735 Bacteria 695
162 Ga0495638_0168032 3300046460 Bacteria 1260
163 Ga0495650_0054044 3300046471 Unclassified 1641
164 Ga0495650_0106423 3300046471 Bacteria 1047
165 Ga0495605_0084612 3300046474 Bacteria 1479
166 Ga0495606_0009459 3300046507 Bacteria 8247
167 Ga0495606_0021447 3300046507 Bacteria 4732
168 Ga0495616_0004631 3300046513 Bacteria 8633
169 Ga0495642_0103405 3300046528 Bacteria 1214
170 Ga0495597_0142704 3300046542 Bacteria 987
171 Ga0495633_0286487 3300046558 Bacteria 749
172 Ga0495668_0000050 3300046616 Bacteria 214716
173 Ga0495672_0009625 3300047320 Bacteria 6975
174 Ga0495672_0067124 3300047320 Bacteria 2044
175 Ga0495687_000001 3300047443 Bacteria 1215582
176 Ga0495685_041661 3300047447 Bacteria 1569
177 Ga0495686_0000249 3300047472 Bacteria 96604
178 Ga0495686_0293121 3300047472 Bacteria 900
179 Ga0495686_0368449 3300047472 Bacteria 777
180 Ga0495614_0023524 3300048089 Bacteria 2659
181 Ga0496101_0181280 3300048904 Bacteria 1622
182 Ga0496115_0360832 3300048918 Unclassified 1184
183 Ga0496115_0500563 3300048918 Bacteria 976
184 Ga0496126_0007733 3300048929 Bacteria 11722
185 Ga0495678_008377 3300049459 Bacteria 5222
186 Ga0501238_025790 3300049671 Bacteria 842
187 Ga0501241_000045 3300049758 Bacteria 36457
188 Ga0501044_0192461 3300049823 Unclassified 2002
189 nmdc:mga09592_1710090_c1 3300050508 Bacteria 507
190 Ga0500635_0061749 3300053080 Unclassified 1309
191 Ga0500583_0000538 3300053092 Bacteria 11507
192 Ga0500650_0097217 3300053098 Bacteria 1379
193 Ga0500557_020178 3300053105 Bacteria 1891
194 Ga0500568_0032194 3300053139 Unclassified 2157
195 Ga0500589_077611 3300053147 Bacteria 1488
196 Ga0500604_0026386 3300053151 Bacteria 1675
197 Ga0500622_0000012 3300053156 Bacteria 383183
198 Ga0500622_0000183 3300053156 Bacteria 67413
199 Ga0500622_0000610 3300053156 Bacteria 32495
200 Ga0500637_0253774 3300053178 Unclassified 980
201 Ga0500611_000083 3300053727 Bacteria 29347
202 2919441597 2919437846 Bacteria 6199444
203 2919693107 2919692658 Bacteria 5943958
204 2928081440 2928078545 Bacteria 6534839
205 2977233290 2977232053 Bacteria 5485925
206 Ga0105237_10005064
207 JGI25162J39368_1000005
208 JGI25152J39213_1000044
209 JGI25150J39212_1000006
210 JGI25151J46595_10000024
211 JGI25153J46596_10000026
212 rootH2_10026787
213 rootH2_10071794
214 rootH2_10071795
215 rootL2_10010023
216 rootL2_10062250
217 rootL2_10062251
218 rootH1_10107410
219 rootH1_10116303
220 Ga0055536_1000002
221 Ga0055530_10001950
222 Ga0065704_10079609
223 Ga0070670_100165317
224 Ga0070666_10164319
225 Ga0070682_100003510
226 Ga0070660_100244907
227 Ga0070660_100434104
228 Ga0070689_100335628
229 Ga0070691_10006944
230 Ga0070659_101105293
231 Ga0070662_100153866
232 Ga0070698_100070190
233 Ga0070698_100295396
234 Ga0068853_100024307
235 Ga0068853_100307660
236 Ga0070693_100037295
237 Ga0070665_100000001
238 Ga0068855_100000206
239 Ga0068855_100171234
240 Ga0068855_100841142
241 Ga0068855_102241224
242 Ga0068857_100000416
243 Ga0068857_100059209
244 Ga0068856_100001369
245 Ga0068856_100033066
246 Ga0068856_100142820
247 Ga0068852_100037777
248 Ga0068859_100169349
249 Ga0068864_100272036
250 Ga0068858_100951778
251 Ga0068860_100000111
252 Ga0068860_100135230
253 Ga0097621_100543297
254 Ga0075428_100944755
255 Ga0097620_100169354
256 Ga0105251_10218084
257 Ga0105240_10013673
258 Ga0105240_10033871
259 Ga0105240_10358278
260 Ga0105240_11343170
261 Ga0105240_11703702
262 Ga0105241_10000319
263 Ga0105241_10815503
264 Ga0105237_10069915
265 Ga0105237_10170753
266 Ga0105237_10383540
267 Ga0105249_10022037
268 Ga0105249_10192528
269 Ga0105239_10001973
270 Ga0105239_10022723
271 Ga0105239_10138602
272 Ga0105239_11086850
273 Ga0157373_11244393
274 Ga0157371_10305774
275 Ga0157370_10000479
276 Ga0157370_10010061
277 Ga0157370_10174756
278 Ga0157378_10044390
279 Ga0157378_10106367
280 Ga0157378_11294102
281 Ga0163162_10000101
282 Ga0163162_10138772
283 Ga0163162_10949091
284 Ga0157372_10049421
285 Ga0157372_10364300
286 Ga0157375_10252187
287 Ga0157380_10880561
288 Ga0182008_10000023
289 Ga0182006_1091958
290 Ga0183373_1002
291 Ga0209437_100043
292 Ga0207425_1000003
293 Ga0209129_1000022
294 Ga0209676_1000022
295 Ga0209025_1000007
296 Ga0209758_1000012
297 Ga0209050_1000020
298 Ga0209257_1000001
299 Ga0207680_10386936
300 Ga0207647_10012780
301 Ga0207654_10005271
302 Ga0207654_10317891
303 Ga0207707_10000721
304 Ga0207695_10000084
305 Ga0207695_10000323
306 Ga0207695_10017176
307 Ga0207695_10340539
308 Ga0207695_10632909
309 Ga0207671_10003626
310 Ga0207671_10007035
311 Ga0207671_10153665
312 Ga0207660_10001254
313 Ga0207662_10369298
314 Ga0207652_10002045
315 Ga0207694_10190291
316 Ga0207650_10024604
317 Ga0207690_10482928
318 Ga0207706_10561472
319 Ga0207670_10933513
320 Ga0207689_10998889
321 Ga0207667_10000009
322 Ga0207667_10000135
323 Ga0207667_12034044
324 Ga0207712_10023060
325 Ga0207712_10128121
326 Ga0207712_10143263
327 Ga0207712_10203640
328 Ga0207712_11124226
329 Ga0207658_11321312
330 Ga0207677_10256559
331 Ga0207639_10007875
332 Ga0207702_10252016
333 Ga0207702_10640368
334 Ga0207676_10169315
335 Ga0207674_10004100
336 Ga0207698_10122263
337 Ga0268266_10000049
338 Ga0268264_10000313
339 Ga0268264_10001221
340 Ga0307517_10002048
341 Ga0307517_10088138
342 Ga0265340_10130525
343 Ga0265327_10038135
344 Ga0307513_10083325
345 Ga0307513_10503089
346 Ga0307509_10067402
347 Ga0265313_10021797
348 Ga0307405_10000008
349 Ga0307407_10000037
350 Ga0307407_10016078
351 Ga0307416_100000001
352 Ga0307416_100000048
353 Ga0307414_10006098
354 Ga0307411_10515570
355 Ga0307411_11735985
356 Ga0395899_0210146
357 Ga0395900_0000330
358 Ga0395900_0029340
359 Ga0395900_0053199
360 Ga0395898_0032848
361 Ga0395905_0000769
362 Ga0395905_0001627
363 Ga0395901_0002005
364 Ga0451807_2733501
365 Ga0466972_0019301
366 Ga0466968_0374332
367 Ga0495638_0168032
368 Ga0495650_0054044
369 Ga0495650_0106423
370 Ga0495605_0084612
371 Ga0495606_0009459
372 Ga0495606_0021447
373 Ga0495616_0004631
374 Ga0495642_0103405
375 Ga0495597_0142704
376 Ga0495633_0286487
377 Ga0495668_0000050
378 Ga0495672_0009625
379 Ga0495672_0067124
380 Ga0495687_000001
381 Ga0495685_041661
382 Ga0495686_0000249
383 Ga0495686_0293121
384 Ga0495686_0368449
385 Ga0495614_0023524
386 Ga0496101_0181280
387 Ga0496115_0360832
388 Ga0496115_0500563
389 Ga0496126_0007733
390 Ga0495678_008377
391 Ga0501238_025790
392 Ga0501241_000045
393 Ga0501044_0192461
394 nmdc:mga09592_1710090_c1
395 Ga0500635_0061749
396 Ga0500583_0000538
397 Ga0500650_0097217
398 Ga0500557_020178
399 Ga0500568_0032194
400 Ga0500589_077611
401 Ga0500604_0026386
402 Ga0500622_0000012
403 Ga0500622_0000183
404 Ga0500622_0000610
405 Ga0500637_0253774
406 Ga0500611_000083
407 2919441597
408 2919693107
409 2928081440
410 2977233290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

45

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sev-assembly1.cif.gz_C-2 structure of dps from listeria innocua soaked with 10 mm zinc for 120 minutes 0.9218 16 156
5h46-assembly1.cif.gz_A mycobacterium smegmatis dps1 mutant - f47e 0.9204 7 157
2yw7-assembly1.cif.gz_G crystal structure of c-terminal deletion mutant of mycobacterium smegmatis dps 0.9181 13 156
1ji5-assembly1.cif.gz_A dlp-1 from bacillus anthracis 0.9174 15 157
5h46-assembly1.cif.gz_A mycobacterium smegmatis dps1 mutant - f47e 0.9147 7 157
ID Description Score Start End Superfamily
2yw7F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9184 10 156 1.20.1260.10
1ji5D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9181 15 157 1.20.1260.10
1velA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9141 6 157 1.20.1260.10
2yw7H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9138 12 157 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9133 10 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A5N7Z669-F1-model_v4 deleted 0.977 24 157
AF-A0A519VX28-F1-model_v4 DNA starvation/stationary phase protection protein 0.9651 30 157 GO:0008199
GO:0016722
AF-A0A519VX28-F1-model_v4 DNA starvation/stationary phase protection protein 0.9506 30 157 GO:0008199
GO:0016722
AF-A0A4R1M2E3-F1-model_v4 Starvation-inducible DNA-binding protein 0.9481 1 157 GO:0003677
GO:0008199
GO:0016722
AF-A0A536WE18-F1-model_v4 DNA starvation/stationary phase protection protein 0.9468 16 157 GO:0008199
GO:0016722

Map