F313879

General Info

Members Datasets Scaffolds Average Seq Length
205 159 410 184

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10397787|Ga0157376_103977872
Length 213
Sequence VNDVLSAGSDPEKLSLDNNILYQMKSEKEKMLAGELYNAFDAQLSEERLNTRLLISQFNLSPENLPEERMAILKSLIPNAGPYLYIQPPFFCDYGTNIYIGEKVFFNFNCVILDVMQVTIGSETMFGPNVQIYTATHPVNWKERATGLEFAKPVMIGKNVWIGGSTVVCPGVTIGDRTIIGAGSVVTKNIPADVVAAGNPCRIIRPLNPEEGS

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
124 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
125 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
145 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
146 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
147 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
148 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
149 2738541278 Niastella sp. CF465 Isolate Unclassified
150 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
151 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
152 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
153 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
154 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
155 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
156 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
157 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
158 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
159 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 1.95
Rhizosphere 82.44
Stem 0
Stem Tuber 0
Unclassified 15.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10397787 3300014969 Bacteria 1331
2 rootH1_10011415 3300003316 Bacteria 4908
3 rootH1_10026142 3300003323 Bacteria 62137
4 Ga0055530_10033957 3300003791 Bacteria 1308
5 Ga0065704_10071488 3300005289 Bacteria 10948
6 Ga0065704_10085954 3300005289 Bacteria 3140
7 Ga0070658_10000414 3300005327 Bacteria 37009
8 Ga0070676_10241035 3300005328 Bacteria 1203
9 Ga0070690_100107573 3300005330 Bacteria 1856
10 Ga0070670_100050913 3300005331 Bacteria 3558
11 Ga0068869_100024298 3300005334 Unclassified 4197
12 Ga0068868_100187248 3300005338 Bacteria 1720
13 Ga0070689_100052889 3300005340 Unclassified 3142
14 Ga0070668_100874624 3300005347 Bacteria 802
15 Ga0070675_100110674 3300005354 Bacteria 2323
16 Ga0070674_100190722 3300005356 Bacteria 1577
17 Ga0070673_100117267 3300005364 Unclassified 2215
18 Ga0070667_100175917 3300005367 Unclassified 1891
19 Ga0070667_100523466 3300005367 Bacteria 1088
20 Ga0070711_100525139 3300005439 Bacteria 979
21 Ga0070700_100407160 3300005441 Bacteria 1024
22 Ga0070678_100230422 3300005456 Bacteria 1544
23 Ga0070662_100232618 3300005457 Bacteria 1475
24 Ga0070685_10033959 3300005466 Bacteria 2870
25 Ga0070684_100005785 3300005535 Bacteria 9509
26 Ga0070684_100274691 3300005535 Unclassified 1543
27 Ga0068853_100159616 3300005539 Unclassified 2034
28 Ga0070672_100039166 3300005543 Unclassified 3628
29 Ga0070665_100126011 3300005548 Bacteria 2563
30 Ga0070665_100144989 3300005548 Bacteria 2378
31 Ga0070665_100777801 3300005548 Bacteria 970
32 Ga0070665_100842377 3300005548 Bacteria 930
33 Ga0070664_100058151 3300005564 Unclassified 3288
34 Ga0068857_100063758 3300005577 Bacteria 3276
35 Ga0068859_100025661 3300005617 Bacteria 5911
36 Ga0068859_101328522 3300005617 Bacteria 792
37 Ga0068864_100013566 3300005618 Bacteria 6756
38 Ga0068863_100150379 3300005841 Unclassified 2227
39 Ga0068858_100680395 3300005842 Bacteria 1000
40 Ga0068860_100505818 3300005843 Bacteria 1206
41 Ga0068862_100375852 3300005844 Bacteria 1324
42 Ga0097621_100327163 3300006237 Bacteria 1359
43 Ga0097621_100585319 3300006237 Bacteria 1019
44 Ga0068871_100075302 3300006358 Bacteria 2786
45 Ga0075428_100463213 3300006844 Bacteria 1357
46 Ga0075431_100075468 3300006847 Bacteria 3479
47 Ga0075429_100412886 3300006880 Bacteria 1182
48 Ga0075429_100836556 3300006880 Bacteria 806
49 Ga0068865_100126273 3300006881 Bacteria 1910
50 Ga0097620_100025656 3300006931 Bacteria 5911
51 Ga0097620_101328541 3300006931 Bacteria 792
52 Ga0105240_10852332 3300009093 Bacteria 983
53 Ga0111539_10444057 3300009094 Bacteria 1510
54 Ga0111539_11266542 3300009094 Bacteria 856
55 Ga0105243_10000012 3300009148 Bacteria 300885
56 Ga0105246_10438367 3300011119 Unclassified 1095
57 Ga0157373_10002675 3300013100 Bacteria 13513
58 Ga0157371_10033929 3300013102 Bacteria 3665
59 Ga0157371_10082163 3300013102 Bacteria 2281
60 Ga0157369_10280539 3300013105 Unclassified 1735
61 Ga0157374_10017412 3300013296 Bacteria 6326
62 Ga0157374_10098690 3300013296 Unclassified 2797
63 Ga0157374_10679951 3300013296 Bacteria 1042
64 Ga0157378_10163696 3300013297 Bacteria 2082
65 Ga0163162_10021710 3300013306 Bacteria 6323
66 Ga0163162_10022971 3300013306 Bacteria 6152
67 Ga0157372_10069155 3300013307 Bacteria 3971
68 Ga0157372_10453767 3300013307 Bacteria 1494
69 Ga0157372_11011714 3300013307 Bacteria 962
70 Ga0157372_11106423 3300013307 Bacteria 916
71 Ga0157372_11219211 3300013307 Bacteria 869
72 Ga0157375_10009172 3300013308 Bacteria 8671
73 Ga0157375_10009836 3300013308 Bacteria 8410
74 Ga0163163_10054610 3300014325 Unclassified 3947
75 Ga0157377_10004811 3300014745 Bacteria 6268
76 Ga0157379_10039486 3300014968 Bacteria 4211
77 Ga0157379_10492829 3300014968 Bacteria 1135
78 Ga0157376_10955079 3300014969 Unclassified 878
79 Ga0213876_10009089 3300021384 Bacteria 5350
80 Ga0209050_1001129 3300025298 Bacteria 32179
81 Ga0207697_10045977 3300025315 Unclassified 1797
82 Ga0207647_10066109 3300025904 Unclassified 2193
83 Ga0207645_10134903 3300025907 Unclassified 1607
84 Ga0207693_10702421 3300025915 Bacteria 783
85 Ga0207663_10755334 3300025916 Bacteria 773
86 Ga0207649_10030755 3300025920 Unclassified 3184
87 Ga0207649_10341737 3300025920 Unclassified 1105
88 Ga0207652_10293393 3300025921 Bacteria 1467
89 Ga0207694_10181349 3300025924 Bacteria 1708
90 Ga0207644_10627630 3300025931 Bacteria 893
91 Ga0207706_10010970 3300025933 Bacteria 8262
92 Ga0207709_10000006 3300025935 Bacteria 800946
93 Ga0207670_10033056 3300025936 Unclassified 3331
94 Ga0207704_10024160 3300025938 Bacteria 3290
95 Ga0207689_10015826 3300025942 Bacteria 6387
96 Ga0207661_10011544 3300025944 Bacteria 6406
97 Ga0207679_10049718 3300025945 Unclassified 3060
98 Ga0207651_10252162 3300025960 Bacteria 1444
99 Ga0207658_10028055 3300025986 Bacteria 3962
100 Ga0207658_10212049 3300025986 Bacteria 1624
101 Ga0207658_10349000 3300025986 Bacteria 1288
102 Ga0207703_10829857 3300026035 Bacteria 883
103 Ga0207678_10008806 3300026067 Bacteria 8881
104 Ga0207708_10725576 3300026075 Bacteria 851
105 Ga0207676_10111013 3300026095 Bacteria 2294
106 Ga0207674_10079724 3300026116 Bacteria 3277
107 Ga0207675_100389336 3300026118 Unclassified 1372
108 Ga0207683_10517311 3300026121 Bacteria 1103
109 Ga0207683_10604820 3300026121 Unclassified 1015
110 Ga0207698_11327098 3300026142 Bacteria 734
111 Ga0268266_10000296 3300028379 Bacteria 80995
112 Ga0268266_10762011 3300028379 Bacteria 934
113 Ga0268264_11056848 3300028381 Bacteria 820
114 Ga0265338_10125395 3300028800 Bacteria 2038
115 Ga0307407_10330968 3300031903 Bacteria 1072
116 Ga0307414_10072409 3300032004 Bacteria 2489
117 Ga0307414_10184971 3300032004 Bacteria 1680
118 Ga0307414_10520825 3300032004 Bacteria 1055
119 Ga0436365_0762148 3300039437 Bacteria 11979
120 Ga0439439_0114501 3300041406 Viruses 749
121 Ga0451791_1007531 3300041451 Unclassified 825
122 Ga0439449_0025362 3300042007 Bacteria 2217
123 Ga0439457_020075 3300042014 Bacteria 1483
124 Ga0451577_0005014 3300042876 Bacteria 13712
125 Ga0466969_0000235 3300044656 Bacteria 30219
126 Ga0466966_0000280 3300044684 Bacteria 33412
127 Ga0466961_0305004 3300044693 Bacteria 972
128 Ga0453684_0010090 3300044712 Bacteria 16227
129 Ga0466970_0057086 3300044765 Bacteria 2087
130 Ga0466970_0167729 3300044765 Bacteria 1216
131 Ga0466959_0000015 3300045049 Bacteria 149242
132 Ga0466959_0154760 3300045049 Bacteria 1614
133 Ga0451576_0141232 3300045051 Bacteria 2511
134 Ga0451576_1287487 3300045051 Bacteria 762
135 Ga0495625_0062255 3300046660 Bacteria 2638
136 Ga0496109_1549735 3300048912 Unclassified 597
137 Ga0496110_0459370 3300048913 Unclassified 1160
138 Ga0496111_0648488 3300048914 Bacteria 770
139 Ga0496116_0008868 3300048919 Bacteria 8654
140 Ga0496116_0009672 3300048919 Bacteria 8198
141 Ga0496117_0000593 3300048920 Bacteria 59578
142 Ga0496117_0009928 3300048920 Bacteria 8759
143 Ga0496118_0024100 3300048921 Bacteria 5263
144 Ga0496118_0029156 3300048921 Bacteria 4634
145 Ga0496119_0109206 3300048922 Bacteria 1538
146 Ga0496121_0015652 3300048924 Bacteria 7913
147 Ga0496122_0003177 3300048925 Bacteria 21905
148 Ga0496123_0012783 3300048926 Bacteria 7119
149 Ga0496124_0162820 3300048927 Bacteria 1737
150 Ga0496124_0433920 3300048927 Bacteria 901
151 Ga0496126_0012045 3300048929 Bacteria 8887
152 Ga0496126_0362315 3300048929 Bacteria 1184
153 Ga0501034_0450632 3300049571 Bacteria 1205
154 Ga0501038_0254791 3300049574 Bacteria 1389
155 Ga0501043_0207717 3300049579 Bacteria 1518
156 Ga0501043_0376098 3300049579 Unclassified 1076
157 Ga0501046_0648009 3300049580 Bacteria 747
158 Ga0501047_0003355 3300049581 Bacteria 15169
159 Ga0501047_0201515 3300049581 Bacteria 1851
160 Ga0501070_0010057 3300049586 Bacteria 8002
161 Ga0501070_0011840 3300049586 Bacteria 7364
162 Ga0501070_0519266 3300049586 Bacteria 956
163 Ga0501074_0688971 3300049590 Bacteria 721
164 Ga0501202_073443 3300049652 Unclassified 792
165 Ga0501247_019352 3300049677 Bacteria 875
166 Ga0501257_012414 3300049686 Bacteria 1949
167 Ga0501257_030826 3300049686 Bacteria 1292
168 Ga0501080_0316299 3300049742 Bacteria 1414
169 Ga0501080_0339510 3300049742 Bacteria 1357
170 Ga0501083_0303722 3300049744 Unclassified 1038
171 Ga0501266_005965 3300049763 Bacteria 1513
172 Ga0501035_0003066 3300049822 Bacteria 16029
173 Ga0501035_0054021 3300049822 Bacteria 3590
174 Ga0501044_0001674 3300049823 Bacteria 26044
175 Ga0501044_0169933 3300049823 Bacteria 2152
176 nmdc:mga09592_602438_c1 3300050508 Unclassified 941
177 nmdc:mga06r32_368953_c1 3300050510 Bacteria 1419
178 nmdc:mga08y16_324206_c1 3300050511 Bacteria 1585
179 Ga0500644_0285465 3300053088 Unclassified 703
180 Ga0500646_0024778 3300053090 Bacteria 1617
181 Ga0500650_0104648 3300053098 Bacteria 1323
182 Ga0500555_024690 3300053103 Bacteria 1721
183 Ga0500589_075058 3300053147 Bacteria 1521
184 Ga0500589_103945 3300053147 Unclassified 1230
185 Ga0500622_0086777 3300053156 Bacteria 1559
186 Ga0590071_000250 3300059421 Bacteria 15541
187 Ga0590074_001643 3300059423 Bacteria 3643
188 Ga0590075_036042 3300059424 Bacteria 1260
189 Ga0590077_000475 3300059426 Bacteria 11291
190 2617915704 2617270889 Bacteria 9064343
191 2649119123 2648501241 Bacteria 5312320
192 2652976254 2651869818 Bacteria 5864031
193 2722729332 2721755487 Bacteria 6357185
194 2723602481 2721755693 Bacteria 6126117
195 2738729178 2738541278 Bacteria 9755573
196 2848554259 2848551377 Bacteria 3720646
197 2884637759 2884634485 Bacteria 3928637
198 2889418850 2889415604 Bacteria 8048700
199 2890737934 2890737413 Bacteria 4269751
200 2896345073 2896344016 Bacteria 3811746
201 2898715706 2898713307 Bacteria 4110805
202 2904780998 2904780799 Bacteria 5840761
203 2919180538 2919177583 Bacteria 5641607
204 3006990288 3006988479 Bacteria 4767936
205 642602946 642555144 Bacteria 9059191
206 Ga0157376_10397787
207 rootH1_10011415
208 rootH1_10026142
209 Ga0055530_10033957
210 Ga0065704_10071488
211 Ga0065704_10085954
212 Ga0070658_10000414
213 Ga0070676_10241035
214 Ga0070690_100107573
215 Ga0070670_100050913
216 Ga0068869_100024298
217 Ga0068868_100187248
218 Ga0070689_100052889
219 Ga0070668_100874624
220 Ga0070675_100110674
221 Ga0070674_100190722
222 Ga0070673_100117267
223 Ga0070667_100175917
224 Ga0070667_100523466
225 Ga0070711_100525139
226 Ga0070700_100407160
227 Ga0070678_100230422
228 Ga0070662_100232618
229 Ga0070685_10033959
230 Ga0070684_100005785
231 Ga0070684_100274691
232 Ga0068853_100159616
233 Ga0070672_100039166
234 Ga0070665_100126011
235 Ga0070665_100144989
236 Ga0070665_100777801
237 Ga0070665_100842377
238 Ga0070664_100058151
239 Ga0068857_100063758
240 Ga0068859_100025661
241 Ga0068859_101328522
242 Ga0068864_100013566
243 Ga0068863_100150379
244 Ga0068858_100680395
245 Ga0068860_100505818
246 Ga0068862_100375852
247 Ga0097621_100327163
248 Ga0097621_100585319
249 Ga0068871_100075302
250 Ga0075428_100463213
251 Ga0075431_100075468
252 Ga0075429_100412886
253 Ga0075429_100836556
254 Ga0068865_100126273
255 Ga0097620_100025656
256 Ga0097620_101328541
257 Ga0105240_10852332
258 Ga0111539_10444057
259 Ga0111539_11266542
260 Ga0105243_10000012
261 Ga0105246_10438367
262 Ga0157373_10002675
263 Ga0157371_10033929
264 Ga0157371_10082163
265 Ga0157369_10280539
266 Ga0157374_10017412
267 Ga0157374_10098690
268 Ga0157374_10679951
269 Ga0157378_10163696
270 Ga0163162_10021710
271 Ga0163162_10022971
272 Ga0157372_10069155
273 Ga0157372_10453767
274 Ga0157372_11011714
275 Ga0157372_11106423
276 Ga0157372_11219211
277 Ga0157375_10009172
278 Ga0157375_10009836
279 Ga0163163_10054610
280 Ga0157377_10004811
281 Ga0157379_10039486
282 Ga0157379_10492829
283 Ga0157376_10955079
284 Ga0213876_10009089
285 Ga0209050_1001129
286 Ga0207697_10045977
287 Ga0207647_10066109
288 Ga0207645_10134903
289 Ga0207693_10702421
290 Ga0207663_10755334
291 Ga0207649_10030755
292 Ga0207649_10341737
293 Ga0207652_10293393
294 Ga0207694_10181349
295 Ga0207644_10627630
296 Ga0207706_10010970
297 Ga0207709_10000006
298 Ga0207670_10033056
299 Ga0207704_10024160
300 Ga0207689_10015826
301 Ga0207661_10011544
302 Ga0207679_10049718
303 Ga0207651_10252162
304 Ga0207658_10028055
305 Ga0207658_10212049
306 Ga0207658_10349000
307 Ga0207703_10829857
308 Ga0207678_10008806
309 Ga0207708_10725576
310 Ga0207676_10111013
311 Ga0207674_10079724
312 Ga0207675_100389336
313 Ga0207683_10517311
314 Ga0207683_10604820
315 Ga0207698_11327098
316 Ga0268266_10000296
317 Ga0268266_10762011
318 Ga0268264_11056848
319 Ga0265338_10125395
320 Ga0307407_10330968
321 Ga0307414_10072409
322 Ga0307414_10184971
323 Ga0307414_10520825
324 Ga0436365_0762148
325 Ga0439439_0114501
326 Ga0451791_1007531
327 Ga0439449_0025362
328 Ga0439457_020075
329 Ga0451577_0005014
330 Ga0466969_0000235
331 Ga0466966_0000280
332 Ga0466961_0305004
333 Ga0453684_0010090
334 Ga0466970_0057086
335 Ga0466970_0167729
336 Ga0466959_0000015
337 Ga0466959_0154760
338 Ga0451576_0141232
339 Ga0451576_1287487
340 Ga0495625_0062255
341 Ga0496109_1549735
342 Ga0496110_0459370
343 Ga0496111_0648488
344 Ga0496116_0008868
345 Ga0496116_0009672
346 Ga0496117_0000593
347 Ga0496117_0009928
348 Ga0496118_0024100
349 Ga0496118_0029156
350 Ga0496119_0109206
351 Ga0496121_0015652
352 Ga0496122_0003177
353 Ga0496123_0012783
354 Ga0496124_0162820
355 Ga0496124_0433920
356 Ga0496126_0012045
357 Ga0496126_0362315
358 Ga0501034_0450632
359 Ga0501038_0254791
360 Ga0501043_0207717
361 Ga0501043_0376098
362 Ga0501046_0648009
363 Ga0501047_0003355
364 Ga0501047_0201515
365 Ga0501070_0010057
366 Ga0501070_0011840
367 Ga0501070_0519266
368 Ga0501074_0688971
369 Ga0501202_073443
370 Ga0501247_019352
371 Ga0501257_012414
372 Ga0501257_030826
373 Ga0501080_0316299
374 Ga0501080_0339510
375 Ga0501083_0303722
376 Ga0501266_005965
377 Ga0501035_0003066
378 Ga0501035_0054021
379 Ga0501044_0001674
380 Ga0501044_0169933
381 nmdc:mga09592_602438_c1
382 nmdc:mga06r32_368953_c1
383 nmdc:mga08y16_324206_c1
384 Ga0500644_0285465
385 Ga0500646_0024778
386 Ga0500650_0104648
387 Ga0500555_024690
388 Ga0500589_075058
389 Ga0500589_103945
390 Ga0500622_0086777
391 Ga0590071_000250
392 Ga0590074_001643
393 Ga0590075_036042
394 Ga0590077_000475
395 2617915704
396 2649119123
397 2652976254
398 2722729332
399 2723602481
400 2738729178
401 2848554259
402 2884637759
403 2889418850
404 2890737934
405 2896345073
406 2898715706
407 2904780998
408 2919180538
409 3006990288
410 642602946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12464

Mac

Maltose acetyltransferase hexapeptide capping motif

30

81

0.97

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

153

188

0.96

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

153

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p2o-assembly1.cif.gz_A crystal structure of maltose transacetylase from geobacillus kaustophilus p2(1) crystal form 0.8928 1 165
6ag8-assembly1.cif.gz_C crystal structure of maltose o-acetyltransferase from e. coli 0.8877 1 164
5u2k-assembly1.cif.gz_A crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group) 0.8723 1 166
4dcl-assembly1.cif.gz_A computationally designed self-assembling tetrahedron protein, t308, crystallized in space group f23 0.8719 1 166
4egg-assembly1.cif.gz_A computationally designed self-assembling tetrahedron protein, t310 0.8626 1 166
ID Description Score Start End Superfamily
3fttA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8596 2 166 2.160.10.10
3nz2J00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.847 2 165 2.160.10.10
af_Q54ED9_4_181_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8459 12 166 2.160.10.10
af_Q9SRU3_310_418_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8292 55 145 2.160.10.10
af_Q86A05_5_191_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8272 1 163 2.160.10.10
ID Description Score Start End GO Terms
AF-S0JDZ1-F1-model_v4 Acetyltransferase (EC 2.3.1.-) 0.9948 1 146 GO:0008870
AF-A0A350H6T7-F1-model_v4 Acetyltransferase (EC 2.3.1.-) 0.9892 1 140 GO:0008870
AF-A0A821RWT5-F1-model_v4 Maltose/galactoside acetyltransferase domain-containing protein 0.9883 1 104 GO:0008374
GO:0016407
AF-A0A822H0B6-F1-model_v4 Maltose/galactoside acetyltransferase domain-containing protein 0.9868 35 145 GO:0008870
AF-A0A1L5KUI3-F1-model_v4 Acetyltransferase (EC 2.3.1.-) 0.986 1 145 GO:0008870

Map