F314130

General Info

Members Datasets Scaffolds Average Seq Length
205 165 189 216

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0276105|Ga0395901_0276105_404_1192
Length 246
Sequence VALSAEFECSGVGVECQVAGNAPAARQRRKDTMLKVYGFSKVNPLARGRTRDLRVLWALEEMQLPFEIAGMDHPAHDLSTEAYRRLSPFEQIPAIDDDGLVLSESAAIVIYLAKKSGRLLPRDRAGEAQVMRWCFAAMNTVEPPLLGLMLLDWTSDGSCGRHREFLAGWVHRVLTNLQRWLADREFVATSDFTVADILMAHVLSAGVKDDKAIAPYPAVAAYRDRCMVRPAWKRTIEAYGARVEAG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2721755523 Delftia sp. HK171 Isolate Unclassified
14 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
15 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
16 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 1.46
Rhizoplane 3.9
Rhizosphere 69.27
Stem 0
Stem Tuber 0
Unclassified 13.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003615 3300003320 Bacteria 47811
2 Ga0055536_1000838 3300003781 Bacteria 20291
3 Ga0055536_1010188 3300003781 Bacteria 3766
4 Ga0055536_1047664 3300003781 Bacteria 964
5 Ga0065704_10172151 3300005289 Bacteria 1285
6 Ga0070658_10001846 3300005327 Bacteria 17839
7 Ga0070677_10002618 3300005333 Bacteria 5757
8 Ga0070666_10055911 3300005335 Bacteria 2664
9 Ga0070680_100537273 3300005336 Unclassified 1001
10 Ga0068868_100027159 3300005338 Bacteria 4366
11 Ga0070660_100001022 3300005339 Bacteria 18783
12 Ga0070691_10048487 3300005341 Unclassified 2021
13 Ga0070668_100061805 3300005347 Bacteria 2902
14 Ga0070675_100011905 3300005354 Bacteria 6816
15 Ga0070671_100000742 3300005355 Bacteria 23351
16 Ga0070671_100075183 3300005355 Bacteria 2822
17 Ga0070674_100007862 3300005356 Bacteria 6308
18 Ga0070674_100097740 3300005356 Bacteria 2133
19 Ga0070673_100027833 3300005364 Bacteria 4195
20 Ga0070659_100030594 3300005366 Bacteria 4167
21 Ga0070667_100031506 3300005367 Bacteria 4421
22 Ga0070700_100354229 3300005441 Bacteria 1089
23 Ga0070663_100038845 3300005455 Bacteria 3323
24 Ga0070678_100009526 3300005456 Bacteria 5889
25 Ga0070681_10590833 3300005458 Unclassified 1024
26 Ga0068853_100079226 3300005539 Bacteria 2872
27 Ga0070672_100002183 3300005543 Bacteria 12348
28 Ga0070672_100060093 3300005543 Bacteria 2992
29 Ga0070665_100003186 3300005548 Bacteria 17653
30 Ga0070665_100137174 3300005548 Unclassified 2449
31 Ga0068855_100011376 3300005563 Bacteria 10745
32 Ga0068859_100674912 3300005617 Bacteria 1125
33 Ga0068851_10000435 3300005834 Bacteria 18666
34 Ga0068870_10001608 3300005840 Bacteria 9190
35 Ga0068870_10460583 3300005840 Bacteria 840
36 Ga0068863_100261873 3300005841 Bacteria 1672
37 Ga0068860_100019989 3300005843 Bacteria 6490
38 Ga0075362_10170245 3300006177 Bacteria 1052
39 Ga0097621_100004208 3300006237 Bacteria 9986
40 Ga0097621_100007208 3300006237 Bacteria 7935
41 Ga0068871_100024187 3300006358 Bacteria 4707
42 Ga0068871_100588245 3300006358 Unclassified 1011
43 Ga0068865_100087650 3300006881 Bacteria 2250
44 Ga0097620_100674964 3300006931 Bacteria 1125
45 Ga0079104_1000167 3300006946 Bacteria 93750
46 Ga0105240_10042888 3300009093 Bacteria 5763
47 Ga0105240_10158109 3300009093 Bacteria 2694
48 Ga0111539_10373193 3300009094 Bacteria 1661
49 Ga0105245_10278211 3300009098 Bacteria 1635
50 Ga0105243_10205120 3300009148 Bacteria 1732
51 Ga0105241_10211211 3300009174 Bacteria 1626
52 Ga0105242_10464676 3300009176 Bacteria 1196
53 Ga0105242_10801150 3300009176 Bacteria 933
54 Ga0105248_10133284 3300009177 Bacteria 2803
55 Ga0105238_10002602 3300009551 Bacteria 17990
56 Ga0105238_10818906 3300009551 Bacteria 947
57 Ga0157371_10048433 3300013102 Unclassified 3021
58 Ga0157370_10019729 3300013104 Bacteria 6749
59 Ga0157374_10045097 3300013296 Bacteria 4080
60 Ga0157374_10143901 3300013296 Bacteria 2315
61 Ga0157374_11360141 3300013296 Bacteria 733
62 Ga0157378_10146664 3300013297 Bacteria 2196
63 Ga0157372_10279685 3300013307 Bacteria 1940
64 Ga0157375_11444118 3300013308 Bacteria 811
65 Ga0163161_10007290 3300017792 Bacteria 7631
66 Ga0163161_10135411 3300017792 Bacteria 1862
67 Ga0207425_1016026 3300025245 Bacteria 1670
68 Ga0209673_1029160 3300025273 Bacteria 1761
69 Ga0209675_1002804 3300025291 Bacteria 8687
70 Ga0209676_1001020 3300025292 Bacteria 32581
71 Ga0209676_1002366 3300025292 Bacteria 13574
72 Ga0209758_1021510 3300025297 Bacteria 3004
73 Ga0209758_1034818 3300025297 Bacteria 1996
74 Ga0209256_1000546 3300025299 Bacteria 54037
75 Ga0209257_1000080 3300025304 Bacteria 312038
76 Ga0209257_1001398 3300025304 Bacteria 28850
77 Ga0209257_1014383 3300025304 Bacteria 3403
78 Ga0207656_10005590 3300025321 Bacteria 4456
79 Ga0207682_10001911 3300025893 Bacteria 9457
80 Ga0207645_10004702 3300025907 Bacteria 10044
81 Ga0207643_10050649 3300025908 Bacteria 2355
82 Ga0207643_10279927 3300025908 Bacteria 1034
83 Ga0207705_10000058 3300025909 Bacteria 155967
84 Ga0207707_10003186 3300025912 Bacteria 14568
85 Ga0207695_10971465 3300025913 Bacteria 729
86 Ga0207660_10000422 3300025917 Bacteria 27929
87 Ga0207657_10000671 3300025919 Bacteria 36483
88 Ga0207652_10000205 3300025921 Bacteria 62657
89 Ga0207694_10147853 3300025924 Bacteria 1892
90 Ga0207659_10071291 3300025926 Bacteria 2537
91 Ga0207644_10069008 3300025931 Bacteria 2580
92 Ga0207690_10122322 3300025932 Unclassified 1892
93 Ga0207709_10000143 3300025935 Bacteria 99457
94 Ga0207669_10523690 3300025937 Bacteria 952
95 Ga0207704_10320864 3300025938 Bacteria 1195
96 Ga0207691_10000162 3300025940 Bacteria 62729
97 Ga0207691_10013625 3300025940 Bacteria 7771
98 Ga0207711_10258940 3300025941 Bacteria 1598
99 Ga0207667_10018693 3300025949 Bacteria 7764
100 Ga0207658_10070608 3300025986 Bacteria 2642
101 Ga0207639_10053861 3300026041 Bacteria 3072
102 Ga0207678_10052576 3300026067 Bacteria 3513
103 Ga0207641_10172739 3300026088 Bacteria 1974
104 Ga0207675_100923897 3300026118 Bacteria 889
105 Ga0207683_10000188 3300026121 Bacteria 52889
106 Ga0207683_10104723 3300026121 Bacteria 2528
107 Ga0207698_10001343 3300026142 Bacteria 14326
108 Ga0207698_10044784 3300026142 Bacteria 3328
109 Ga0209281_1000017 3300027111 Bacteria 583251
110 Ga0268266_10000642 3300028379 Bacteria 47516
111 Ga0268266_10106233 3300028379 Bacteria 2481
112 Ga0268264_10116404 3300028381 Bacteria 2349
113 Ga0307517_10056850 3300028786 Bacteria 3805
114 Ga0307515_10003775 3300028794 Bacteria 31740
115 Ga0307515_10214744 3300028794 Bacteria 1757
116 Ga0307515_10377274 3300028794 Bacteria 1052
117 Ga0265324_10090096 3300029957 Bacteria 1043
118 Ga0265340_10000586 3300031247 Bacteria 20219
119 Ga0307513_10000020 3300031456 Bacteria 228745
120 Ga0307513_10215959 3300031456 Bacteria 1744
121 Ga0307509_10153583 3300031507 Bacteria 2213
122 Ga0307408_100688338 3300031548 Bacteria 918
123 Ga0307508_10000357 3300031616 Bacteria 55613
124 Ga0307508_10450898 3300031616 Bacteria 879
125 Ga0307514_10006151 3300031649 Bacteria 10532
126 Ga0307516_10000038 3300031730 Bacteria 147103
127 Ga0307516_10000689 3300031730 Bacteria 45886
128 Ga0307516_10206482 3300031730 Bacteria 1681
129 Ga0307406_10480047 3300031901 Bacteria 1004
130 Ga0307414_10660861 3300032004 Bacteria 943
131 Ga0307507_10154044 3300033179 Bacteria 1719
132 Ga0395905_0006945 3300037471 Bacteria 11315
133 Ga0395901_0276105 3300038443 Bacteria 1747
134 Ga0439439_0010372 3300041406 Bacteria 2225
135 Ga0451793_0872496 3300041452 Bacteria 781
136 Ga0451797_1326776 3300041453 Bacteria 782
137 Ga0451795_0784358 3300041456 Bacteria 1581
138 Ga0451795_1194427 3300041456 Bacteria 1439
139 Ga0451807_2729783 3300041486 Bacteria 1009
140 Ga0451833_0515966 3300041491 Bacteria 1529
141 Ga0451853_3561766 3300041512 Bacteria 3146
142 Ga0450908_014458 3300042184 Unclassified 1419
143 Ga0466969_0000031 3300044656 Bacteria 86708
144 Ga0466965_0088068 3300044683 Bacteria 1576
145 Ga0466966_0018673 3300044684 Bacteria 4570
146 Ga0466971_0062437 3300044719 Bacteria 1686
147 Ga0466970_0228571 3300044765 Bacteria 1039
148 Ga0466959_0114444 3300045049 Bacteria 1922
149 Ga0495650_0002544 3300046471 Bacteria 14530
150 Ga0495632_0001312 3300046519 Bacteria 21028
151 Ga0495621_0164925 3300046539 Bacteria 878
152 Ga0495681_0025797 3300047470 Bacteria 3071
153 Ga0496104_0025156 3300048907 Bacteria 5486
154 Ga0496108_0772392 3300048911 Bacteria 830
155 Ga0496110_0066236 3300048913 Bacteria 3194
156 Ga0496126_0534310 3300048929 Unclassified 933
157 Ga0501031_0023668 3300049568 Bacteria 4003
158 Ga0501032_0005797 3300049569 Bacteria 9139
159 Ga0501032_0020471 3300049569 Bacteria 4607
160 Ga0501033_0038559 3300049570 Bacteria 3571
161 Ga0501033_0275390 3300049570 Unclassified 1189
162 Ga0501036_0306681 3300049572 Bacteria 1327
163 Ga0501037_0014268 3300049573 Bacteria 5855
164 Ga0501038_0024539 3300049574 Bacteria 5379
165 Ga0501038_0086331 3300049574 Bacteria 2636
166 Ga0501038_0261616 3300049574 Unclassified 1367
167 Ga0501043_0026640 3300049579 Bacteria 4536
168 Ga0501046_0025829 3300049580 Bacteria 4802
169 Ga0501047_0153413 3300049581 Bacteria 2178
170 Ga0501070_0000017 3300049586 Bacteria 173127
171 Ga0501074_0340784 3300049590 Unclassified 1064
172 Ga0501080_0000444 3300049742 Bacteria 32129
173 Ga0501035_0001450 3300049822 Bacteria 24304
174 Ga0501035_0003807 3300049822 Bacteria 14376
175 Ga0501044_0003825 3300049823 Bacteria 16895
176 Ga0501044_0073528 3300049823 Bacteria 3474
177 Ga0501044_0177539 3300049823 Bacteria 2098
178 Ga0501044_0350265 3300049823 Bacteria 1396
179 nmdc:mga07m45_115319_c1 3300050496 Bacteria 1549
180 nmdc:mga07m45_258623_c1 3300050496 Bacteria 1013
181 nmdc:mga0a205_619164_c1 3300050515 Bacteria 935
182 Ga0500562_003460 3300053108 Bacteria 3958
183 Ga0500623_010601 3300053127 Bacteria 4644
184 Ga0500642_0048853 3300053130 Bacteria 1860
185 Ga0500652_000053 3300053131 Bacteria 53776
186 Ga0500561_0033010 3300053137 Bacteria 1320
187 Ga0500577_0080123 3300053142 Bacteria 1300
188 Ga0500622_0000549 3300053156 Bacteria 34409
189 Ga0466962_0191874 3300061719 Bacteria 997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0010372 Ga0439439_0010372_936_1580 206
2 iso_pu_bacteria 2721755523 2722881587 208
3 iso_pu_bacteria 2585428057 2587727439 209
4 iso_pu_bacteria 2585428058 2587735360 209
5 iso_pu_bacteria 2588253510 2588295047 209
6 iso_pu_bacteria 2643221559 2643817039 209
7 iso_pu_bacteria 2643221586 2643939460 209
8 iso_pu_bacteria 2643221592 2643971020 209
9 iso_pu_bacteria 2643221612 2644078139 209
10 iso_pu_bacteria 2643221625 2644141873 209
11 iso_pu_bacteria 2643221639 2644221485 209
12 iso_pu_bacteria 2643221646 2644257751 209
13 iso_pu_bacteria 2643221648 2644275302 209
14 iso_pu_bacteria 2643221727 2644696442 209
15 iso_pu_bacteria 2921643360 2921644023 209
16 3300005840 Ga0068870_10460583 Ga0068870_104605832 210
17 3300005548 Ga0070665_100003186 Ga0070665_10000318621 211
18 3300013307 Ga0157372_10279685 Ga0157372_102796852 211
19 3300028379 Ga0268266_10000642 Ga0268266_1000064250 211
20 3300032004 Ga0307414_10660861 Ga0307414_106608611 211
21 3300041486 Ga0451807_2729783 Ga0451807_2729783_264_929 211
22 iso_pu_bacteria 2896429255 2896431554 211
23 3300003781 Ga0055536_1000838 Ga0055536_100083826 212
24 3300003781 Ga0055536_1010188 Ga0055536_10101882 212
25 3300003781 Ga0055536_1047664 Ga0055536_10476641 212
26 3300005289 Ga0065704_10172151 Ga0065704_101721511 212
27 3300005333 Ga0070677_10002618 Ga0070677_100026182 212
28 3300005335 Ga0070666_10055911 Ga0070666_100559113 212
29 3300005338 Ga0068868_100027159 Ga0068868_1000271597 212
30 3300005347 Ga0070668_100061805 Ga0070668_1000618052 212
31 3300005354 Ga0070675_100011905 Ga0070675_1000119054 212
32 3300005355 Ga0070671_100000742 Ga0070671_10000074225 212
33 3300005355 Ga0070671_100075183 Ga0070671_1000751832 212
34 3300005356 Ga0070674_100007862 Ga0070674_1000078625 212
35 3300005364 Ga0070673_100027833 Ga0070673_1000278335 212
36 3300005367 Ga0070667_100031506 Ga0070667_1000315062 212
37 3300005441 Ga0070700_100354229 Ga0070700_1003542291 212
38 3300005456 Ga0070678_100009526 Ga0070678_1000095263 212
39 3300005543 Ga0070672_100060093 Ga0070672_1000600934 212
40 3300005548 Ga0070665_100137174 Ga0070665_1001371746 212
41 3300005840 Ga0068870_10001608 Ga0068870_100016087 212
42 3300005841 Ga0068863_100261873 Ga0068863_1002618731 212
43 3300005843 Ga0068860_100019989 Ga0068860_10001998910 212
44 3300006237 Ga0097621_100007208 Ga0097621_1000072089 212
45 3300006881 Ga0068865_100087650 Ga0068865_1000876504 212
46 3300006946 Ga0079104_1000167 Ga0079104_10001678 212
47 3300009148 Ga0105243_10205120 Ga0105243_102051202 212
48 3300009176 Ga0105242_10801150 Ga0105242_108011501 212
49 3300013296 Ga0157374_10045097 Ga0157374_100450972 212
50 3300013297 Ga0157378_10146664 Ga0157378_101466643 212
51 3300013308 Ga0157375_11444118 Ga0157375_114441181 212
52 3300017792 Ga0163161_10007290 Ga0163161_100072906 212
53 3300025245 Ga0207425_1016026 Ga0207425_10160261 212
54 3300025291 Ga0209675_1002804 Ga0209675_10028041 212
55 3300025292 Ga0209676_1001020 Ga0209676_100102035 212
56 3300025292 Ga0209676_1002366 Ga0209676_100236614 212
57 3300025297 Ga0209758_1021510 Ga0209758_10215102 212
58 3300025297 Ga0209758_1034818 Ga0209758_10348181 212
59 3300025299 Ga0209256_1000546 Ga0209256_100054616 212
60 3300025304 Ga0209257_1000080 Ga0209257_100008016 212
61 3300025304 Ga0209257_1001398 Ga0209257_100139821 212
62 3300025893 Ga0207682_10001911 Ga0207682_100019119 212
63 3300025907 Ga0207645_10004702 Ga0207645_1000470211 212
64 3300025908 Ga0207643_10050649 Ga0207643_100506492 212
65 3300025926 Ga0207659_10071291 Ga0207659_100712912 212
66 3300025931 Ga0207644_10069008 Ga0207644_100690084 212
67 3300025935 Ga0207709_10000143 Ga0207709_1000014364 212
68 3300025938 Ga0207704_10320864 Ga0207704_103208642 212
69 3300025940 Ga0207691_10000162 Ga0207691_1000016258 212
70 3300025986 Ga0207658_10070608 Ga0207658_100706083 212
71 3300026088 Ga0207641_10172739 Ga0207641_101727393 212
72 3300026121 Ga0207683_10000188 Ga0207683_1000018810 212
73 3300026142 Ga0207698_10044784 Ga0207698_100447843 212
74 3300027111 Ga0209281_1000017 Ga0209281_1000017372 212
75 3300028379 Ga0268266_10106233 Ga0268266_101062333 212
76 3300028381 Ga0268264_10116404 Ga0268264_101164043 212
77 3300031901 Ga0307406_10480047 Ga0307406_104800472 212
78 3300042184 Ga0450908_014458 Ga0450908_014458_484_1125 212
79 3300046471 Ga0495650_0002544 Ga0495650_0002544_8694_9335 212
80 3300046539 Ga0495621_0164925 Ga0495621_0164925_30_671 212
81 3300050496 nmdc:mga07m45_258623_c1 nmdc:mga07m45_258623_c1_359_1000 212
82 iso_pu_bacteria 2839138175 2839138839 212
83 3300005356 Ga0070674_100097740 Ga0070674_1000977404 213
84 3300005543 Ga0070672_100002183 Ga0070672_10000218310 213
85 3300005617 Ga0068859_100674912 Ga0068859_1006749122 213
86 3300005834 Ga0068851_10000435 Ga0068851_100004353 213
87 3300006177 Ga0075362_10170245 Ga0075362_101702452 213
88 3300006237 Ga0097621_100004208 Ga0097621_1000042084 213
89 3300006358 Ga0068871_100024187 Ga0068871_1000241875 213
90 3300006931 Ga0097620_100674964 Ga0097620_1006749642 213
91 3300009093 Ga0105240_10042888 Ga0105240_100428883 213
92 3300009093 Ga0105240_10158109 Ga0105240_101581093 213
93 3300009094 Ga0111539_10373193 Ga0111539_103731932 213
94 3300009098 Ga0105245_10278211 Ga0105245_102782112 213
95 3300009176 Ga0105242_10464676 Ga0105242_104646761 213
96 3300009177 Ga0105248_10133284 Ga0105248_101332841 213
97 3300009551 Ga0105238_10818906 Ga0105238_108189061 213
98 3300013296 Ga0157374_10143901 Ga0157374_101439013 213
99 3300013296 Ga0157374_11360141 Ga0157374_113601411 213
100 3300017792 Ga0163161_10135411 Ga0163161_101354112 213
101 3300025273 Ga0209673_1029160 Ga0209673_10291602 213
102 3300025304 Ga0209257_1014383 Ga0209257_10143833 213
103 3300025321 Ga0207656_10005590 Ga0207656_100055904 213
104 3300025908 Ga0207643_10279927 Ga0207643_102799271 213
105 3300025913 Ga0207695_10971465 Ga0207695_109714651 213
106 3300025937 Ga0207669_10523690 Ga0207669_105236901 213
107 3300025940 Ga0207691_10013625 Ga0207691_100136253 213
108 3300025941 Ga0207711_10258940 Ga0207711_102589402 213
109 3300026118 Ga0207675_100923897 Ga0207675_1009238972 213
110 3300026121 Ga0207683_10104723 Ga0207683_101047233 213
111 3300026142 Ga0207698_10001343 Ga0207698_1000134310 213
112 3300028786 Ga0307517_10056850 Ga0307517_100568503 213
113 3300028794 Ga0307515_10003775 Ga0307515_100037759 213
114 3300028794 Ga0307515_10214744 Ga0307515_102147442 213
115 3300028794 Ga0307515_10377274 Ga0307515_103772741 213
116 3300029957 Ga0265324_10090096 Ga0265324_100900962 213
117 3300031456 Ga0307513_10000020 Ga0307513_10000020175 213
118 3300031456 Ga0307513_10215959 Ga0307513_102159592 213
119 3300031507 Ga0307509_10153583 Ga0307509_101535832 213
120 3300031548 Ga0307408_100688338 Ga0307408_1006883382 213
121 3300031616 Ga0307508_10000357 Ga0307508_1000035748 213
122 3300031616 Ga0307508_10450898 Ga0307508_104508981 213
123 3300031649 Ga0307514_10006151 Ga0307514_100061516 213
124 3300031730 Ga0307516_10000038 Ga0307516_10000038115 213
125 3300031730 Ga0307516_10000689 Ga0307516_100006893 213
126 3300031730 Ga0307516_10206482 Ga0307516_102064821 213
127 3300033179 Ga0307507_10154044 Ga0307507_101540443 213
128 3300037471 Ga0395905_0006945 Ga0395905_0006945_4693_5337 213
129 3300038443 Ga0395901_0276105 Ga0395901_0276105_404_1192 213
130 3300041452 Ga0451793_0872496 Ga0451793_0872496_85_729 213
131 3300041453 Ga0451797_1326776 Ga0451797_1326776_102_746 213
132 3300041456 Ga0451795_0784358 Ga0451795_0784358_577_1221 213
133 3300041456 Ga0451795_1194427 Ga0451795_1194427_446_1090 213
134 3300041491 Ga0451833_0515966 Ga0451833_0515966_628_1272 213
135 3300041512 Ga0451853_3561766 Ga0451853_3561766_720_1553 213
136 3300044656 Ga0466969_0000031 Ga0466969_0000031_76311_76955 213
137 3300044683 Ga0466965_0088068 Ga0466965_0088068_625_1269 213
138 3300044684 Ga0466966_0018673 Ga0466966_0018673_48_692 213
139 3300044719 Ga0466971_0062437 Ga0466971_0062437_15_659 213
140 3300044765 Ga0466970_0228571 Ga0466970_0228571_287_931 213
141 3300045049 Ga0466959_0114444 Ga0466959_0114444_316_960 213
142 3300046519 Ga0495632_0001312 Ga0495632_0001312_4144_4788 213
143 3300047470 Ga0495681_0025797 Ga0495681_0025797_369_1013 213
144 3300048907 Ga0496104_0025156 Ga0496104_0025156_11_655 213
145 3300048911 Ga0496108_0772392 Ga0496108_0772392_54_698 213
146 3300048913 Ga0496110_0066236 Ga0496110_0066236_765_1424 213
147 3300049568 Ga0501031_0023668 Ga0501031_0023668_1073_1720 213
148 3300049569 Ga0501032_0005797 Ga0501032_0005797_6735_7382 213
149 3300049570 Ga0501033_0038559 Ga0501033_0038559_1161_1808 213
150 3300049572 Ga0501036_0306681 Ga0501036_0306681_16_663 213
151 3300049574 Ga0501038_0086331 Ga0501038_0086331_664_1311 213
152 3300049580 Ga0501046_0025829 Ga0501046_0025829_782_1429 213
153 3300049822 Ga0501035_0003807 Ga0501035_0003807_1758_2405 213
154 3300049823 Ga0501044_0073528 Ga0501044_0073528_1352_1999 213
155 3300050496 nmdc:mga07m45_115319_c1 nmdc:mga07m45_115319_c1_321_965 213
156 3300050515 nmdc:mga0a205_619164_c1 nmdc:mga0a205_619164_c1_275_919 213
157 3300053108 Ga0500562_003460 Ga0500562_003460_1269_1913 213
158 3300053127 Ga0500623_010601 Ga0500623_010601_44_688 213
159 3300053130 Ga0500642_0048853 Ga0500642_0048853_298_942 213
160 3300053131 Ga0500652_000053 Ga0500652_000053_24460_25104 213
161 3300053137 Ga0500561_0033010 Ga0500561_0033010_187_831 213
162 3300053142 Ga0500577_0080123 Ga0500577_0080123_524_1168 213
163 3300053156 Ga0500622_0000549 Ga0500622_0000549_17769_18413 213
164 3300061719 Ga0466962_0191874 Ga0466962_0191874_11_655 213
165 3300006358 Ga0068871_100588245 Ga0068871_1005882451 215
166 3300031247 Ga0265340_10000586 Ga0265340_1000058610 216
167 3300048929 Ga0496126_0534310 Ga0496126_0534310_177_827 216
168 3300049570 Ga0501033_0275390 Ga0501033_0275390_65_715 216
169 3300049574 Ga0501038_0261616 Ga0501038_0261616_547_1197 216
170 3300003320 rootH2_10003615 rootH2_1000361534 217
171 3300005327 Ga0070658_10001846 Ga0070658_1000184615 217
172 3300005336 Ga0070680_100537273 Ga0070680_1005372731 217
173 3300005339 Ga0070660_100001022 Ga0070660_10000102210 217
174 3300005341 Ga0070691_10048487 Ga0070691_100484871 217
175 3300005366 Ga0070659_100030594 Ga0070659_1000305943 217
176 3300005455 Ga0070663_100038845 Ga0070663_1000388452 217
177 3300005458 Ga0070681_10590833 Ga0070681_105908331 217
178 3300005539 Ga0068853_100079226 Ga0068853_1000792263 217
179 3300005563 Ga0068855_100011376 Ga0068855_1000113769 217
180 3300009174 Ga0105241_10211211 Ga0105241_102112112 217
181 3300009551 Ga0105238_10002602 Ga0105238_100026029 217
182 3300013102 Ga0157371_10048433 Ga0157371_100484332 217
183 3300013104 Ga0157370_10019729 Ga0157370_100197295 217
184 3300025909 Ga0207705_10000058 Ga0207705_1000005839 217
185 3300025912 Ga0207707_10003186 Ga0207707_100031865 217
186 3300025917 Ga0207660_10000422 Ga0207660_1000042224 217
187 3300025919 Ga0207657_10000671 Ga0207657_1000067137 217
188 3300025921 Ga0207652_10000205 Ga0207652_1000020536 217
189 3300025924 Ga0207694_10147853 Ga0207694_101478532 217
190 3300025932 Ga0207690_10122322 Ga0207690_101223223 217
191 3300025949 Ga0207667_10018693 Ga0207667_100186937 217
192 3300026041 Ga0207639_10053861 Ga0207639_100538612 217
193 3300026067 Ga0207678_10052576 Ga0207678_100525763 217
194 3300049569 Ga0501032_0020471 Ga0501032_0020471_625_1290 217
195 3300049573 Ga0501037_0014268 Ga0501037_0014268_4682_5347 217
196 3300049574 Ga0501038_0024539 Ga0501038_0024539_1364_2029 217
197 3300049579 Ga0501043_0026640 Ga0501043_0026640_3314_3979 217
198 3300049581 Ga0501047_0153413 Ga0501047_0153413_675_1340 217
199 3300049586 Ga0501070_0000017 Ga0501070_0000017_138268_138933 217
200 3300049590 Ga0501074_0340784 Ga0501074_0340784_129_794 217
201 3300049742 Ga0501080_0000444 Ga0501080_0000444_16679_17344 217
202 3300049822 Ga0501035_0001450 Ga0501035_0001450_15111_15776 217
203 3300049823 Ga0501044_0003825 Ga0501044_0003825_2803_3468 217
204 3300049823 Ga0501044_0177539 Ga0501044_0177539_647_1300 217
205 3300049823 Ga0501044_0350265 Ga0501044_0350265_572_1225 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

166

230

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

45

114

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

53

115

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

53

119

0.9

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

156

239

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9373 2 208
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.936 2 208
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9223 2 217
3lq7-assembly2.cif.gz_C-2 crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9204 2 210
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9106 1 205
ID Description Score Start End Superfamily
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.944 88 205 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9392 88 205 1.20.1050.10
af_I1JFH5_1_87_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9363 1 85 3.40.30.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9301 88 205 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9287 88 205 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A552U8G6-F1-model_v4 Glutathione S-transferase family protein 0.9616 2 210 GO:0016740
AF-A0A346N4Z6-F1-model_v4 Glutathione S-transferase family protein 0.9593 2 208 GO:0016740
AF-A0A2S8B884-F1-model_v4 Glutathione S-transferase 0.9563 2 210 GO:0016740
AF-A0A0B1ZQC0-F1-model_v4 Glutathione S-transferase 0.9557 2 210
AF-A0A519KRG8-F1-model_v4 Glutathione S-transferase family protein 0.9552 1 204 GO:0016740

Feature Viewer

pLDDT pTM Quality
93.33 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map