F314271

General Info

Members Datasets Scaffolds Average Seq Length
205 132 410 320

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0013747|Ga0495606_0013747_2841_3899
Length 352
Sequence MVKRAKAPAKRGRATPRPAKPKPFERWTLLDFLRYATSRFIEAELVFAHGTDDVLAEAAFLVCEALHLHPDQFEMFATVRTTEAETKKILGLIESRVATRKPAAYLVNKAYMLGLPFYVDERVIVPRSFIGELLESHFSEDGSLIEDPAMVKSVLDLCTGSGCLAILATDSFPNAQIDAVDLSKDALDVAARNVADYSLENRISLHQGDLFKPLGGKRYDLIVTNPPYVDAEGMAALPSECRFEPELAFDGGADGLDIVRRILNEAGNHLTPQGGLLCEIGRGRELLEAAFPQLPLLWLDTEESEGEVFWIGAGDLVPRTQRSAQPLRSGALQSRGRIKRRRPLRSRLCGAA

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
39 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
40 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
47 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
48 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
49 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
50 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
51 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
52 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
53 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
54 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
55 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
56 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
57 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
58 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
59 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
60 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
61 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
62 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
107 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
110 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
111 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
112 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
113 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
117 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
118 2643221651 Afipia sp. Root123D2 Isolate Unclassified
119 2818991467 Bosea vestrisii 3192 Isolate Unclassified
120 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
121 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
122 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
123 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
124 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
125 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
126 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
127 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
128 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
129 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
130 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
131 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
132 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.71
Metatranscriptomes 0
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.22
Nodule 3.9
Rhizoplane 0.98
Rhizosphere 72.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0013747 3300046507 Bacteria 6371
2 JGI25406J46586_10000043 3300003203 Bacteria 55866
3 JGI25153J46596_10003804 3300003215 Bacteria 8325
4 Ga0055543_1012843 3300004625 Bacteria 1671
5 Ga0065165_1004069 3300005262 Bacteria 9485
6 Ga0070658_10099192 3300005327 Bacteria 2407
7 Ga0070713_100068219 3300005436 Bacteria 2996
8 Ga0070665_100050501 3300005548 Bacteria 4173
9 Ga0081455_10010832 3300005937 Bacteria 9207
10 Ga0081455_10111115 3300005937 Bacteria 2178
11 Ga0081540_1008553 3300005983 Bacteria 7141
12 Ga0081540_1028909 3300005983 Bacteria 3101
13 Ga0081540_1047477 3300005983 Bacteria 2159
14 Ga0081539_10000324 3300005985 Bacteria 106549
15 Ga0081539_10033708 3300005985 Bacteria 3113
16 Ga0075368_10014557 3300006042 Bacteria 2907
17 Ga0075364_10002994 3300006051 Bacteria 9545
18 Ga0070712_100004741 3300006175 Bacteria 8406
19 Ga0075367_10001848 3300006178 Bacteria 9345
20 Ga0097621_100378638 3300006237 Bacteria 1264
21 Ga0075370_10038704 3300006353 Bacteria 2684
22 Ga0099794_10009301 3300007265 Bacteria 4125
23 Ga0105239_10160924 3300010375 Bacteria 2508
24 Ga0157371_10032132 3300013102 Bacteria 3778
25 Ga0157370_10119297 3300013104 Bacteria 2463
26 Ga0157378_10021903 3300013297 Bacteria 5619
27 Ga0209758_1001054 3300025297 Bacteria 36110
28 Ga0207426_1003118 3300025302 Bacteria 9460
29 Ga0207685_10031566 3300025905 Bacteria 1898
30 Ga0207693_10008491 3300025915 Bacteria 8408
31 Ga0207663_10134810 3300025916 Bacteria 1712
32 Ga0207657_10205631 3300025919 Bacteria 1582
33 Ga0207700_10519231 3300025928 Bacteria 1055
34 Ga0207664_10154990 3300025929 Bacteria 1949
35 Ga0209588_1012124 3300027671 Bacteria 2614
36 Ga0209813_10007351 3300027866 Bacteria 2742
37 Ga0268266_10403624 3300028379 Bacteria 1293
38 Ga0265325_10001902 3300031241 Bacteria 14413
39 Ga0307408_100103881 3300031548 Bacteria 2170
40 Ga0307416_100258607 3300032002 Bacteria 1700
41 Ga0307415_100500993 3300032126 Bacteria 1062
42 Ga0373955_0037487 3300035172 Bacteria 2578
43 Ga0373924_0099023 3300035410 Bacteria 1253
44 Ga0373933_0180967 3300035724 Bacteria 1344
45 Ga0395900_0054526 3300037418 Bacteria 4116
46 Ga0395898_0141682 3300037466 Bacteria 2302
47 Ga0395905_0420545 3300037471 Bacteria 1232
48 Ga0395901_0037019 3300038443 Bacteria 5046
49 Ga0395901_0124591 3300038443 Bacteria 2708
50 Ga0395901_0340046 3300038443 Bacteria 1551
51 Ga0495592_0093930 3300046454 Bacteria 2147
52 Ga0495651_0134088 3300046462 Bacteria 1804
53 Ga0495662_0080218 3300046476 Bacteria 1587
54 Ga0495630_0232225 3300046517 Bacteria 1409
55 Ga0495634_0199507 3300046642 Bacteria 1243
56 Ga0495635_0003139 3300046663 Bacteria 11370
57 Ga0495657_0005750 3300046675 Bacteria 9765
58 Ga0495657_0220533 3300046675 Bacteria 1150
59 Ga0495646_0020834 3300046680 Bacteria 4146
60 Ga0495613_0095851 3300046689 Bacteria 2146
61 Ga0495600_0029571 3300046809 Bacteria 3547
62 Ga0495672_0018162 3300047320 Bacteria 4680
63 Ga0495680_0013332 3300047322 Bacteria 7177
64 Ga0495675_0075127 3300047444 Bacteria 2129
65 Ga0495673_0070700 3300047469 Bacteria 1469
66 Ga0495686_0068337 3300047472 Bacteria 2192
67 Ga0495686_0071140 3300047472 Bacteria 2142
68 Ga0496107_0035247 3300048910 Bacteria 3587
69 Ga0496112_0000023 3300048915 Bacteria 156144
70 Ga0496117_0013537 3300048920 Bacteria 7111
71 Ga0496119_0000344 3300048922 Bacteria 65097
72 Ga0496119_0143338 3300048922 Bacteria 1288
73 Ga0496121_0001793 3300048924 Bacteria 34696
74 Ga0496121_0002081 3300048924 Bacteria 31581
75 Ga0496121_0064058 3300048924 Bacteria 2999
76 Ga0496122_0006143 3300048925 Bacteria 13966
77 Ga0496122_0132549 3300048925 Bacteria 1579
78 Ga0496123_0002104 3300048926 Bacteria 25565
79 Ga0496123_0010783 3300048926 Bacteria 8020
80 Ga0496123_0026062 3300048926 Bacteria 4391
81 Ga0496125_0000158 3300048928 Bacteria 151273
82 Ga0496125_0001222 3300048928 Bacteria 38526
83 Ga0496126_0005184 3300048929 Bacteria 15063
84 Ga0496126_0013803 3300048929 Bacteria 8191
85 Ga0496126_0082223 3300048929 Bacteria 2846
86 Ga0496126_0283670 3300048929 Bacteria 1371
87 Ga0501031_0003914 3300049568 Bacteria 9581
88 Ga0501031_0106006 3300049568 Bacteria 1834
89 Ga0501031_0270421 3300049568 Bacteria 1103
90 Ga0501032_0000503 3300049569 Bacteria 31656
91 Ga0501032_0072501 3300049569 Bacteria 2295
92 Ga0501032_0087378 3300049569 Bacteria 2070
93 Ga0501033_0000140 3300049570 Bacteria 70162
94 Ga0501033_0002625 3300049570 Bacteria 15123
95 Ga0501033_0020912 3300049570 Bacteria 4939
96 Ga0501033_0183944 3300049570 Bacteria 1497
97 Ga0501034_0000072 3300049571 Bacteria 179824
98 Ga0501034_0075119 3300049571 Bacteria 3387
99 Ga0501034_0243630 3300049571 Bacteria 1743
100 Ga0501034_0267731 3300049571 Bacteria 1650
101 Ga0501036_0000050 3300049572 Bacteria 75340
102 Ga0501036_0011109 3300049572 Bacteria 7447
103 Ga0501036_0136726 3300049572 Bacteria 2068
104 Ga0501036_0222328 3300049572 Bacteria 1585
105 Ga0501037_0000030 3300049573 Bacteria 136148
106 Ga0501037_0001932 3300049573 Bacteria 15019
107 Ga0501037_0081203 3300049573 Bacteria 2351
108 Ga0501037_0090207 3300049573 Bacteria 2217
109 Ga0501037_0133933 3300049573 Bacteria 1775
110 Ga0501038_0000039 3300049574 Bacteria 122904
111 Ga0501038_0016736 3300049574 Bacteria 6642
112 Ga0501038_0021155 3300049574 Bacteria 5843
113 Ga0501038_0036583 3300049574 Bacteria 4308
114 Ga0501038_0049571 3300049574 Bacteria 3630
115 Ga0501038_0179414 3300049574 Bacteria 1709
116 Ga0501038_0182453 3300049574 Bacteria 1693
117 Ga0501039_0000060 3300049575 Bacteria 85528
118 Ga0501039_0036119 3300049575 Bacteria 3812
119 Ga0501039_0048730 3300049575 Bacteria 3274
120 Ga0501039_0142945 3300049575 Bacteria 1879
121 Ga0501041_0183205 3300049577 Bacteria 1311
122 Ga0501042_0008371 3300049578 Bacteria 6822
123 Ga0501042_0112584 3300049578 Bacteria 1959
124 Ga0501043_0002562 3300049579 Bacteria 15362
125 Ga0501043_0010025 3300049579 Bacteria 7431
126 Ga0501043_0097635 3300049579 Bacteria 2309
127 Ga0501043_0179398 3300049579 Bacteria 1650
128 Ga0501043_0240739 3300049579 Bacteria 1395
129 Ga0501046_0000522 3300049580 Bacteria 38028
130 Ga0501046_0046532 3300049580 Bacteria 3443
131 Ga0501046_0113086 3300049580 Bacteria 2072
132 Ga0501046_0329844 3300049580 Bacteria 1111
133 Ga0501047_0055387 3300049581 Bacteria 3835
134 Ga0501047_0059648 3300049581 Bacteria 3683
135 Ga0501048_0000704 3300049582 Bacteria 24375
136 Ga0501048_0078374 3300049582 Bacteria 2331
137 Ga0501067_0000239 3300049583 Bacteria 30445
138 Ga0501067_0002890 3300049583 Bacteria 9451
139 Ga0501068_0000227 3300049584 Bacteria 27306
140 Ga0501068_0146078 3300049584 Bacteria 1484
141 Ga0501069_0005635 3300049585 Bacteria 6517
142 Ga0501069_0022040 3300049585 Bacteria 3461
143 Ga0501070_0021323 3300049586 Bacteria 5436
144 Ga0501071_0064949 3300049587 Bacteria 2649
145 Ga0501072_0001189 3300049588 Bacteria 19405
146 Ga0501073_0000009 3300049589 Bacteria 195649
147 Ga0501073_0006578 3300049589 Bacteria 8647
148 Ga0501074_0000049 3300049590 Bacteria 56854
149 Ga0501074_0006127 3300049590 Bacteria 8687
150 Ga0501076_0078688 3300049592 Bacteria 2646
151 Ga0501077_0044294 3300049593 Bacteria 2827
152 Ga0501079_0003154 3300049741 Bacteria 12089
153 Ga0501079_0054120 3300049741 Bacteria 3095
154 Ga0501080_0005405 3300049742 Bacteria 11390
155 Ga0501080_0186972 3300049742 Bacteria 1904
156 Ga0501080_0252074 3300049742 Bacteria 1609
157 Ga0501083_0000251 3300049744 Bacteria 34183
158 Ga0501083_0013140 3300049744 Bacteria 5785
159 Ga0501035_0000067 3300049822 Bacteria 129204
160 Ga0501035_0002563 3300049822 Bacteria 17750
161 Ga0501035_0123022 3300049822 Bacteria 2266
162 Ga0501035_0286648 3300049822 Bacteria 1390
163 Ga0501044_0000258 3300049823 Bacteria 67161
164 Ga0501044_0058960 3300049823 Bacteria 3934
165 Ga0501044_0133295 3300049823 Bacteria 2477
166 Ga0501044_0141139 3300049823 Bacteria 2397
167 Ga0501044_0210917 3300049823 Bacteria 1896
168 Ga0501045_0005432 3300049824 Bacteria 8825
169 Ga0501045_0124996 3300049824 Bacteria 1910
170 nmdc:mga00v17_4434_c1 3300050491 Bacteria 7305
171 nmdc:mga0yw44_480_c1 3300050492 Bacteria 14184
172 nmdc:mga04h51_8542_c1 3300050495 Bacteria 2742
173 nmdc:mga07m45_38853_c1 3300050496 Bacteria 2658
174 Ga0495601_0123434 3300053077 Bacteria 1683
175 Ga0495612_0011775 3300053078 Bacteria 3525
176 Ga0495619_0145891 3300053085 Bacteria 1631
177 Ga0500647_0004996 3300053091 Bacteria 5433
178 Ga0500651_0001062 3300053093 Bacteria 13560
179 Ga0500556_0000122 3300053104 Bacteria 67150
180 Ga0500595_002456 3300053119 Bacteria 9189
181 Ga0500595_020175 3300053119 Bacteria 2404
182 Ga0500642_0000383 3300053130 Bacteria 14747
183 Ga0500577_0001448 3300053142 Bacteria 6072
184 Ga0500604_0015817 3300053151 Bacteria 2071
185 Ga0500645_018430 3300053730 Bacteria 2180
186 Ga0501084_0020294 3300054114 Bacteria 5540
187 Ga0501084_0057814 3300054114 Bacteria 3244
188 Ga0501082_0035747 3300060353 Bacteria 4281
189 2513697861 2513237101 Bacteria 7952346
190 2517104426 2517093001 Bacteria 9002274
191 2644289823 2643221651 Bacteria 4798932
192 2819720809 2818991467 Bacteria 5893227
193 2842041933 2842038055 Bacteria 8002051
194 2842049976 2842045827 Bacteria 8006841
195 2874606600 2874604998 Bacteria 7834745
196 2874624079 2874620515 Bacteria 8290088
197 2876767496 2876761206 Bacteria 10111113
198 2885412423 2885409591 Bacteria 9235467
199 2889033972 2889033259 Bacteria 9099371
200 2904670790 2904666416 Bacteria 8226587
201 2917555333 2917554339 Bacteria 4987857
202 2919454923 2919450847 Bacteria 5631160
203 8001849330 8001845381 Bacteria 5804942
204 8006998190 8006994254 Bacteria 8309700
205 8019653601 8019648815 Bacteria 10014479
206 Ga0495606_0013747
207 JGI25406J46586_10000043
208 JGI25153J46596_10003804
209 Ga0055543_1012843
210 Ga0065165_1004069
211 Ga0070658_10099192
212 Ga0070713_100068219
213 Ga0070665_100050501
214 Ga0081455_10010832
215 Ga0081455_10111115
216 Ga0081540_1008553
217 Ga0081540_1028909
218 Ga0081540_1047477
219 Ga0081539_10000324
220 Ga0081539_10033708
221 Ga0075368_10014557
222 Ga0075364_10002994
223 Ga0070712_100004741
224 Ga0075367_10001848
225 Ga0097621_100378638
226 Ga0075370_10038704
227 Ga0099794_10009301
228 Ga0105239_10160924
229 Ga0157371_10032132
230 Ga0157370_10119297
231 Ga0157378_10021903
232 Ga0209758_1001054
233 Ga0207426_1003118
234 Ga0207685_10031566
235 Ga0207693_10008491
236 Ga0207663_10134810
237 Ga0207657_10205631
238 Ga0207700_10519231
239 Ga0207664_10154990
240 Ga0209588_1012124
241 Ga0209813_10007351
242 Ga0268266_10403624
243 Ga0265325_10001902
244 Ga0307408_100103881
245 Ga0307416_100258607
246 Ga0307415_100500993
247 Ga0373955_0037487
248 Ga0373924_0099023
249 Ga0373933_0180967
250 Ga0395900_0054526
251 Ga0395898_0141682
252 Ga0395905_0420545
253 Ga0395901_0037019
254 Ga0395901_0124591
255 Ga0395901_0340046
256 Ga0495592_0093930
257 Ga0495651_0134088
258 Ga0495662_0080218
259 Ga0495630_0232225
260 Ga0495634_0199507
261 Ga0495635_0003139
262 Ga0495657_0005750
263 Ga0495657_0220533
264 Ga0495646_0020834
265 Ga0495613_0095851
266 Ga0495600_0029571
267 Ga0495672_0018162
268 Ga0495680_0013332
269 Ga0495675_0075127
270 Ga0495673_0070700
271 Ga0495686_0068337
272 Ga0495686_0071140
273 Ga0496107_0035247
274 Ga0496112_0000023
275 Ga0496117_0013537
276 Ga0496119_0000344
277 Ga0496119_0143338
278 Ga0496121_0001793
279 Ga0496121_0002081
280 Ga0496121_0064058
281 Ga0496122_0006143
282 Ga0496122_0132549
283 Ga0496123_0002104
284 Ga0496123_0010783
285 Ga0496123_0026062
286 Ga0496125_0000158
287 Ga0496125_0001222
288 Ga0496126_0005184
289 Ga0496126_0013803
290 Ga0496126_0082223
291 Ga0496126_0283670
292 Ga0501031_0003914
293 Ga0501031_0106006
294 Ga0501031_0270421
295 Ga0501032_0000503
296 Ga0501032_0072501
297 Ga0501032_0087378
298 Ga0501033_0000140
299 Ga0501033_0002625
300 Ga0501033_0020912
301 Ga0501033_0183944
302 Ga0501034_0000072
303 Ga0501034_0075119
304 Ga0501034_0243630
305 Ga0501034_0267731
306 Ga0501036_0000050
307 Ga0501036_0011109
308 Ga0501036_0136726
309 Ga0501036_0222328
310 Ga0501037_0000030
311 Ga0501037_0001932
312 Ga0501037_0081203
313 Ga0501037_0090207
314 Ga0501037_0133933
315 Ga0501038_0000039
316 Ga0501038_0016736
317 Ga0501038_0021155
318 Ga0501038_0036583
319 Ga0501038_0049571
320 Ga0501038_0179414
321 Ga0501038_0182453
322 Ga0501039_0000060
323 Ga0501039_0036119
324 Ga0501039_0048730
325 Ga0501039_0142945
326 Ga0501041_0183205
327 Ga0501042_0008371
328 Ga0501042_0112584
329 Ga0501043_0002562
330 Ga0501043_0010025
331 Ga0501043_0097635
332 Ga0501043_0179398
333 Ga0501043_0240739
334 Ga0501046_0000522
335 Ga0501046_0046532
336 Ga0501046_0113086
337 Ga0501046_0329844
338 Ga0501047_0055387
339 Ga0501047_0059648
340 Ga0501048_0000704
341 Ga0501048_0078374
342 Ga0501067_0000239
343 Ga0501067_0002890
344 Ga0501068_0000227
345 Ga0501068_0146078
346 Ga0501069_0005635
347 Ga0501069_0022040
348 Ga0501070_0021323
349 Ga0501071_0064949
350 Ga0501072_0001189
351 Ga0501073_0000009
352 Ga0501073_0006578
353 Ga0501074_0000049
354 Ga0501074_0006127
355 Ga0501076_0078688
356 Ga0501077_0044294
357 Ga0501079_0003154
358 Ga0501079_0054120
359 Ga0501080_0005405
360 Ga0501080_0186972
361 Ga0501080_0252074
362 Ga0501083_0000251
363 Ga0501083_0013140
364 Ga0501035_0000067
365 Ga0501035_0002563
366 Ga0501035_0123022
367 Ga0501035_0286648
368 Ga0501044_0000258
369 Ga0501044_0058960
370 Ga0501044_0133295
371 Ga0501044_0141139
372 Ga0501044_0210917
373 Ga0501045_0005432
374 Ga0501045_0124996
375 nmdc:mga00v17_4434_c1
376 nmdc:mga0yw44_480_c1
377 nmdc:mga04h51_8542_c1
378 nmdc:mga07m45_38853_c1
379 Ga0495601_0123434
380 Ga0495612_0011775
381 Ga0495619_0145891
382 Ga0500647_0004996
383 Ga0500651_0001062
384 Ga0500556_0000122
385 Ga0500595_002456
386 Ga0500595_020175
387 Ga0500642_0000383
388 Ga0500577_0001448
389 Ga0500604_0015817
390 Ga0500645_018430
391 Ga0501084_0020294
392 Ga0501084_0057814
393 Ga0501082_0035747
394 2513697861
395 2517104426
396 2644289823
397 2819720809
398 2842041933
399 2842049976
400 2874606600
401 2874624079
402 2876767496
403 2885412423
404 2889033972
405 2904670790
406 2917555333
407 2919454923
408 8001849330
409 8006998190
410 8019653601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

132

237

0.92

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

144

226

0.89

PF13649

Methyltransf_25

Methyltransferase domain

154

242

0.87

PF09445

Methyltransf_15

RNA cap guanine-N2 methyltransferase

151

232

0.86

PF01170

UPF0020

RMKL-like, methyltransferase domain

142

236

0.83

PF13847

Methyltransf_31

Methyltransferase domain

150

310

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dnz-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8317 131 225
5eeg-assembly1.cif.gz_A crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with tetrazole-sah 0.8279 148 280
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8269 32 313
5wcf-assembly1.cif.gz_A human hmt1 hnrnp methyltransferase-like protein 6 (s. cerevisiae) 0.821 131 228
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8182 32 312
ID Description Score Start End Superfamily
af_P39199_14_104_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9361 28 117 1.10.8.10
af_P39199_105_279_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9183 118 296 3.40.50.150
af_P39199_14_104_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9167 28 117 1.10.8.10
af_K7MAL3_1_105_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9043 153 225 3.40.50.150
af_P39199_105_279_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9035 118 296 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2P5LW84-F1-model_v4 50S ribosomal protein L3 N(5)-glutamine methyltransferase 0.9585 25 317 GO:0003676
GO:0005829
GO:0005840
GO:0032259
GO:0036009
AF-A0A6I1JJ75-F1-model_v4 Protein-N(5)-glutamine methyltransferase PrmB methylates LSU ribosomal protein L3p 0.955 146 320 GO:0003676
GO:0005829
GO:0032259
GO:0036009
AF-F7QFB5-F1-model_v4 Putative adenine-specific methylase 0.9536 5 316 GO:0003676
GO:0005829
GO:0032259
GO:0036009
AF-A0A836T2X3-F1-model_v4 50S ribosomal protein L3 N(5)-glutamine methyltransferase (EC 2.1.1.298) 0.9515 152 320 GO:0003676
GO:0005829
GO:0005840
GO:0032259
GO:0036009
AF-A0A536WD45-F1-model_v4 50S ribosomal protein L3 N(5)-glutamine methyltransferase (EC 2.1.1.298) 0.9512 128 319 GO:0003676
GO:0005829
GO:0005840
GO:0032259
GO:0036009

Map