F314288

General Info

Members Datasets Scaffolds Average Seq Length
205 109 408 205

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0009816|Ga0495609_0009816_1169_1888
Length 239
Sequence VWPGKLPEVSSDLLYAINLIKAAPFRAAFSFKLHFMIIKNIEAKIRLAVFISAGSLLTAIIIVGMNCFYAYKMVANAQKSIYILDKSVPILARQTDMQLNRPAEYRAHVDLFHSLFFSLTPDDNYMEYQMKKAMYLIDESGMQQYNDLKEKGFFNSILSSSSVLTLETDSVAIDMPKHYFRYYGKLKIDRRSSTVVRSLITEGYLKDIPRSDNNPHGVLITGWKTLENKDLEDVEKNTF

Samples

Sample ID Description Type Environment
1 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
86 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
89 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
90 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
91 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
92 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
93 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
98 2738541284 Pedobacter sp. YR016 Isolate Unclassified
99 2739367663 Pedobacter sp. YR510 Isolate Unclassified
100 2818991437 Pedobacter terrae 518 Isolate Unclassified
101 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
102 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
103 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
104 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
105 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
106 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
107 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
108 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
109 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 0
Rhizoplane 1.95
Rhizosphere 75.12
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495609_0009816 3300046538 Bacteria 4616
2 JGI24739J22299_10008761 3300001989 Bacteria 3773
3 JGI25152J39213_1005641 3300002773 Bacteria 3590
4 JGI25150J39212_1000029 3300002774 Bacteria 103974
5 JGI25151J46595_10000003 3300003187 Bacteria 715330
6 JGI25153J46596_10000111 3300003215 Bacteria 92915
7 rootH2_10071190 3300003320 Bacteria 6413
8 rootH2_10271350 3300003320 Bacteria 2267
9 rootL2_10006015 3300003322 Bacteria 19280
10 rootL2_10022401 3300003322 Bacteria 12985
11 rootL2_10291202 3300003322 Bacteria 2523
12 rootL2_10344376 3300003322 Bacteria 1134
13 rootH1_10018982 3300003323 Bacteria 37240
14 rootH1_10079289 3300003323 Bacteria 8955
15 rootH1_10146955 3300003323 Bacteria 7285
16 Ga0055536_1000012 3300003781 Bacteria 263217
17 Ga0055530_10001256 3300003791 Bacteria 19253
18 Ga0065714_10064431 3300005288 Bacteria 135024
19 Ga0065714_10064540 3300005288 Bacteria 39469
20 Ga0065714_10107013 3300005288 Bacteria 1539
21 Ga0070659_100312032 3300005366 Bacteria 1313
22 Ga0070663_100007664 3300005455 Bacteria 6587
23 Ga0068853_100710447 3300005539 Bacteria 959
24 Ga0068855_100002083 3300005563 Bacteria 24775
25 Ga0068855_100010925 3300005563 Bacteria 10958
26 Ga0068855_100014846 3300005563 Bacteria 9379
27 Ga0068854_100017184 3300005578 Bacteria 4837
28 Ga0068856_100000005 3300005614 Bacteria 225505
29 Ga0068856_100000100 3300005614 Bacteria 82857
30 Ga0068865_100000015 3300006881 Bacteria 129922
31 Ga0105244_10041652 3300009036 Bacteria 2379
32 Ga0105240_10000044 3300009093 Bacteria 250257
33 Ga0105240_10000173 3300009093 Bacteria 131281
34 Ga0105240_10000316 3300009093 Bacteria 92409
35 Ga0105240_10000686 3300009093 Bacteria 62303
36 Ga0105240_10003706 3300009093 Bacteria 23613
37 Ga0105240_10061761 3300009093 Plasmid 4668
38 Ga0105240_10129846 3300009093 Unclassified 3024
39 Ga0105240_10239788 3300009093 Bacteria 2102
40 Ga0105240_10306691 3300009093 Bacteria 1814
41 Ga0105240_10377678 3300009093 Bacteria 1601
42 Ga0105243_11449777 3300009148 Bacteria 709
43 Ga0105241_10000089 3300009174 Bacteria 68136
44 Ga0105241_10072397 3300009174 Bacteria 2678
45 Ga0105241_10081985 3300009174 Bacteria 2528
46 Ga0105241_10434112 3300009174 Bacteria 1159
47 Ga0105237_10000173 3300009545 Bacteria 90612
48 Ga0105237_10000176 3300009545 Bacteria 90175
49 Ga0105237_10000511 3300009545 Bacteria 54911
50 Ga0105237_10000786 3300009545 Bacteria 43345
51 Ga0105237_10182423 3300009545 Bacteria 2099
52 Ga0105237_10251344 3300009545 Bacteria 1770
53 Ga0105238_10000124 3300009551 Bacteria 85021
54 Ga0105238_10048711 3300009551 Bacteria 4269
55 Ga0105238_10234644 3300009551 Bacteria 1811
56 Ga0105238_10957616 3300009551 Bacteria 876
57 Ga0105239_10000001 3300010375 Bacteria 617353
58 Ga0105239_10000005 3300010375 Bacteria 496066
59 Ga0105239_10000053 3300010375 Bacteria 163705
60 Ga0105239_10000055 3300010375 Bacteria 158211
61 Ga0105239_10000177 3300010375 Bacteria 92286
62 Ga0105239_10005161 3300010375 Bacteria 15414
63 Ga0105239_10031687 3300010375 Bacteria 5810
64 Ga0105239_10529206 3300010375 Bacteria 1341
65 Ga0157373_10000053 3300013100 Bacteria 104200
66 Ga0157373_10054232 3300013100 Bacteria 2849
67 Ga0157373_10088526 3300013100 Bacteria 2181
68 Ga0157373_10297605 3300013100 Bacteria 1145
69 Ga0157371_10005321 3300013102 Bacteria 10891
70 Ga0157370_10000040 3300013104 Bacteria 134107
71 Ga0157370_10000392 3300013104 Bacteria 55046
72 Ga0157370_10003085 3300013104 Bacteria 19728
73 Ga0157370_10009166 3300013104 Bacteria 10610
74 Ga0157370_10254858 3300013104 Bacteria 1623
75 Ga0157370_10565130 3300013104 Bacteria 1042
76 Ga0157370_10569230 3300013104 Bacteria 1038
77 Ga0157369_10441174 3300013105 Bacteria 1348
78 Ga0157369_10658084 3300013105 Bacteria 1080
79 Ga0157374_10000063 3300013296 Bacteria 109371
80 Ga0157374_10010772 3300013296 Bacteria 7882
81 Ga0157374_10480177 3300013296 Bacteria 1246
82 Ga0157378_10245956 3300013297 Bacteria 1711
83 Ga0163162_10023031 3300013306 Bacteria 6143
84 Ga0163162_10459739 3300013306 Bacteria 1404
85 Ga0157372_10000353 3300013307 Bacteria 50337
86 Ga0182008_10000030 3300014497 Bacteria 169168
87 Ga0182008_10091455 3300014497 Bacteria 1500
88 Ga0182006_1000278 3300015261 Bacteria 45666
89 Ga0182007_10000001 3300015262 Bacteria 1127301
90 Ga0182007_10000023 3300015262 Bacteria 187131
91 Ga0163161_10007286 3300017792 Bacteria 7633
92 Ga0207425_1000004 3300025245 Bacteria 1092421
93 Ga0209129_1000005 3300025258 Bacteria 777812
94 Ga0209455_1001735 3300025272 Bacteria 9277
95 Ga0209455_1008826 3300025272 Bacteria 2700
96 Ga0209676_1000001 3300025292 Bacteria 1852142
97 Ga0209025_1000009 3300025294 Bacteria 1092561
98 Ga0209758_1000010 3300025297 Bacteria 1092782
99 Ga0209050_1000018 3300025298 Bacteria 723263
100 Ga0207655_1026451 3300025728 Bacteria 2786
101 Ga0207654_10000040 3300025911 Bacteria 105600
102 Ga0207654_10043834 3300025911 Bacteria 2537
103 Ga0207695_10000013 3300025913 Bacteria 821265
104 Ga0207695_10000053 3300025913 Bacteria 396740
105 Ga0207695_10000524 3300025913 Bacteria 81259
106 Ga0207695_10005791 3300025913 Bacteria 16268
107 Ga0207695_10066187 3300025913 Plasmid 3712
108 Ga0207695_10167536 3300025913 Bacteria 2124
109 Ga0207695_10222383 3300025913 Bacteria 1795
110 Ga0207671_10000136 3300025914 Bacteria 112191
111 Ga0207671_10000172 3300025914 Bacteria 99486
112 Ga0207671_10000237 3300025914 Bacteria 82854
113 Ga0207671_10001047 3300025914 Bacteria 33623
114 Ga0207694_10000244 3300025924 Bacteria 52258
115 Ga0207694_10101631 3300025924 Bacteria 2279
116 Ga0207694_10154165 3300025924 Bacteria 1852
117 Ga0207694_10827665 3300025924 Bacteria 782
118 Ga0207704_10000010 3300025938 Bacteria 188125
119 Ga0207667_10025702 3300025949 Bacteria 6442
120 Ga0207667_10072636 3300025949 Bacteria 3576
121 Ga0207640_10015291 3300025981 Bacteria 4440
122 Ga0207639_10390244 3300026041 Bacteria 1252
123 Ga0207678_10097226 3300026067 Bacteria 2516
124 Ga0207702_10000047 3300026078 Bacteria 143192
125 Ga0207702_10001891 3300026078 Bacteria 20486
126 Ga0307515_10000839 3300028794 Bacteria 70656
127 Ga0307515_10262881 3300028794 Bacteria 1459
128 Ga0265338_10042433 3300028800 Bacteria 4236
129 Ga0307408_100000444 3300031548 Bacteria 36433
130 Ga0307405_10000014 3300031731 Bacteria 226733
131 Ga0307405_10000020 3300031731 Bacteria 156779
132 Ga0307407_10000020 3300031903 Bacteria 126218
133 Ga0307409_100036707 3300031995 Bacteria 3606
134 Ga0307416_100000042 3300032002 Bacteria 130512
135 Ga0307414_10000089 3300032004 Bacteria 78588
136 Ga0307414_10000297 3300032004 Bacteria 29087
137 Ga0307414_10019354 3300032004 Bacteria 4217
138 Ga0307414_10395080 3300032004 Bacteria 1199
139 Ga0373941_0036542 3300035115 Bacteria 1494
140 Ga0395899_0000001 3300037312 Bacteria 1750322
141 Ga0395900_0000122 3300037418 Bacteria 133423
142 Ga0395900_0047273 3300037418 Bacteria 4431
143 Ga0395905_0038378 3300037471 Bacteria 4495
144 Ga0395905_0042066 3300037471 Bacteria 4287
145 Ga0451787_041904 3300041441 Bacteria 949
146 Ga0451795_0068144 3300041456 Bacteria 1908
147 Ga0451795_0492980 3300041456 Bacteria 3661
148 Ga0451795_0838109 3300041456 Bacteria 2918
149 Ga0451855_0285424 3300041511 Bacteria 2505
150 Ga0451855_0705223 3300041511 Bacteria 950
151 Ga0451855_1374161 3300041511 Bacteria 778
152 Ga0451855_1457080 3300041511 Bacteria 1724
153 Ga0451855_1655595 3300041511 Unclassified 1677
154 Ga0466966_0000714 3300044684 Bacteria 21065
155 Ga0495650_0000003 3300046471 Bacteria 900730
156 Ga0495650_0000036 3300046471 Bacteria 400633
157 Ga0495585_0000058 3300046492 Bacteria 112144
158 Ga0495610_0000172 3300046512 Bacteria 72424
159 Ga0495610_0114432 3300046512 Bacteria 1191
160 Ga0495648_0004008 3300046524 Bacteria 12727
161 Ga0495652_0142401 3300046529 Unclassified 1884
162 Ga0495633_0000142 3300046558 Bacteria 95597
163 Ga0495633_0074769 3300046558 Bacteria 1579
164 Ga0495668_0000153 3300046616 Bacteria 104580
165 Ga0495661_0000645 3300046665 Bacteria 35309
166 Ga0495661_0015246 3300046665 Bacteria 5131
167 Ga0495670_0265642 3300046691 Bacteria 916
168 Ga0495649_0000003 3300046694 Bacteria 880817
169 Ga0495660_0012200 3300046810 Bacteria 4987
170 Ga0495687_001019 3300047443 Bacteria 27958
171 Ga0495687_010669 3300047443 Bacteria 5017
172 Ga0495685_087235 3300047447 Unclassified 1036
173 Ga0495673_0068134 3300047469 Bacteria 1505
174 Ga0495686_0000138 3300047472 Bacteria 146224
175 Ga0495686_0002760 3300047472 Bacteria 16046
176 Ga0495686_0005198 3300047472 Bacteria 10361
177 Ga0495686_0143237 3300047472 Bacteria 1409
178 Ga0495614_0011939 3300048089 Bacteria 3817
179 Ga0495678_070215 3300049459 Bacteria 1286
180 Ga0501241_010401 3300049758 Bacteria 1693
181 Ga0500635_0016337 3300053080 Bacteria 2206
182 Ga0500635_0021680 3300053080 Bacteria 1982
183 Ga0500647_0078428 3300053091 Bacteria 1585
184 Ga0500651_0000181 3300053093 Bacteria 40952
185 Ga0500608_004492 3300053122 Bacteria 5414
186 Ga0500618_000262 3300053125 Bacteria 40957
187 Ga0500618_000329 3300053125 Bacteria 34392
188 Ga0500568_0107738 3300053139 Bacteria 1043
189 Ga0500624_000235 3300053157 Bacteria 20116
190 Ga0500624_000241 3300053157 Bacteria 19457
191 2738763366 2738541284 Bacteria 5199923
192 2739648653 2739367663 Bacteria 5040914
193 2819547025 2818991437 Bacteria 5805520
194 2819550422 2818991437 Bacteria 5805520
195 2839993007 2839989709 Bacteria 3773432
196 2839993077 2839989709 Bacteria 3773432
197 2852631566 2852627209 Bacteria 5896285
198 2884936057 2884933994 Bacteria 4535041
199 2896344035 2896344016 Bacteria 3811746
200 2902052764 2902048731 Bacteria 4976191
201 2910251132 2910245624 Bacteria 6935613
202 2919441389 2919437846 Bacteria 6199444
203 2946001544 2945997725 Bacteria 6404843
204 2977232412 2977232053 Bacteria 5485925
205 Ga0495609_0009816
206 JGI24739J22299_10008761
207 JGI25152J39213_1005641
208 JGI25150J39212_1000029
209 JGI25151J46595_10000003
210 JGI25153J46596_10000111
211 rootH2_10071190
212 rootH2_10271350
213 rootL2_10006015
214 rootL2_10022401
215 rootL2_10291202
216 rootL2_10344376
217 rootH1_10018982
218 rootH1_10079289
219 rootH1_10146955
220 Ga0055536_1000012
221 Ga0055530_10001256
222 Ga0065714_10064431
223 Ga0065714_10064540
224 Ga0065714_10107013
225 Ga0070659_100312032
226 Ga0070663_100007664
227 Ga0068853_100710447
228 Ga0068855_100002083
229 Ga0068855_100010925
230 Ga0068855_100014846
231 Ga0068854_100017184
232 Ga0068856_100000005
233 Ga0068856_100000100
234 Ga0068865_100000015
235 Ga0105244_10041652
236 Ga0105240_10000044
237 Ga0105240_10000173
238 Ga0105240_10000316
239 Ga0105240_10000686
240 Ga0105240_10003706
241 Ga0105240_10061761
242 Ga0105240_10129846
243 Ga0105240_10239788
244 Ga0105240_10306691
245 Ga0105240_10377678
246 Ga0105243_11449777
247 Ga0105241_10000089
248 Ga0105241_10072397
249 Ga0105241_10081985
250 Ga0105241_10434112
251 Ga0105237_10000173
252 Ga0105237_10000176
253 Ga0105237_10000511
254 Ga0105237_10000786
255 Ga0105237_10182423
256 Ga0105237_10251344
257 Ga0105238_10000124
258 Ga0105238_10048711
259 Ga0105238_10234644
260 Ga0105238_10957616
261 Ga0105239_10000001
262 Ga0105239_10000005
263 Ga0105239_10000053
264 Ga0105239_10000055
265 Ga0105239_10000177
266 Ga0105239_10005161
267 Ga0105239_10031687
268 Ga0105239_10529206
269 Ga0157373_10000053
270 Ga0157373_10054232
271 Ga0157373_10088526
272 Ga0157373_10297605
273 Ga0157371_10005321
274 Ga0157370_10000040
275 Ga0157370_10000392
276 Ga0157370_10003085
277 Ga0157370_10009166
278 Ga0157370_10254858
279 Ga0157370_10565130
280 Ga0157370_10569230
281 Ga0157369_10441174
282 Ga0157369_10658084
283 Ga0157374_10000063
284 Ga0157374_10010772
285 Ga0157374_10480177
286 Ga0157378_10245956
287 Ga0163162_10023031
288 Ga0163162_10459739
289 Ga0157372_10000353
290 Ga0182008_10000030
291 Ga0182008_10091455
292 Ga0182006_1000278
293 Ga0182007_10000001
294 Ga0182007_10000023
295 Ga0163161_10007286
296 Ga0207425_1000004
297 Ga0209129_1000005
298 Ga0209455_1001735
299 Ga0209455_1008826
300 Ga0209676_1000001
301 Ga0209025_1000009
302 Ga0209758_1000010
303 Ga0209050_1000018
304 Ga0207655_1026451
305 Ga0207654_10000040
306 Ga0207654_10043834
307 Ga0207695_10000013
308 Ga0207695_10000053
309 Ga0207695_10000524
310 Ga0207695_10005791
311 Ga0207695_10066187
312 Ga0207695_10167536
313 Ga0207695_10222383
314 Ga0207671_10000136
315 Ga0207671_10000172
316 Ga0207671_10000237
317 Ga0207671_10001047
318 Ga0207694_10000244
319 Ga0207694_10101631
320 Ga0207694_10154165
321 Ga0207694_10827665
322 Ga0207704_10000010
323 Ga0207667_10025702
324 Ga0207667_10072636
325 Ga0207640_10015291
326 Ga0207639_10390244
327 Ga0207678_10097226
328 Ga0207702_10000047
329 Ga0207702_10001891
330 Ga0307515_10000839
331 Ga0307515_10262881
332 Ga0265338_10042433
333 Ga0307408_100000444
334 Ga0307405_10000014
335 Ga0307405_10000020
336 Ga0307407_10000020
337 Ga0307409_100036707
338 Ga0307416_100000042
339 Ga0307414_10000089
340 Ga0307414_10000297
341 Ga0307414_10019354
342 Ga0307414_10395080
343 Ga0373941_0036542
344 Ga0395899_0000001
345 Ga0395900_0000122
346 Ga0395900_0047273
347 Ga0395905_0038378
348 Ga0395905_0042066
349 Ga0451787_041904
350 Ga0451795_0068144
351 Ga0451795_0492980
352 Ga0451795_0838109
353 Ga0451855_0285424
354 Ga0451855_0705223
355 Ga0451855_1374161
356 Ga0451855_1457080
357 Ga0451855_1655595
358 Ga0466966_0000714
359 Ga0495650_0000003
360 Ga0495650_0000036
361 Ga0495585_0000058
362 Ga0495610_0000172
363 Ga0495610_0114432
364 Ga0495648_0004008
365 Ga0495652_0142401
366 Ga0495633_0000142
367 Ga0495633_0074769
368 Ga0495668_0000153
369 Ga0495661_0000645
370 Ga0495661_0015246
371 Ga0495670_0265642
372 Ga0495649_0000003
373 Ga0495660_0012200
374 Ga0495687_001019
375 Ga0495687_010669
376 Ga0495685_087235
377 Ga0495673_0068134
378 Ga0495686_0000138
379 Ga0495686_0002760
380 Ga0495686_0005198
381 Ga0495686_0143237
382 Ga0495614_0011939
383 Ga0495678_070215
384 Ga0501241_010401
385 Ga0500635_0016337
386 Ga0500635_0021680
387 Ga0500647_0078428
388 Ga0500651_0000181
389 Ga0500608_004492
390 Ga0500618_000262
391 Ga0500618_000329
392 Ga0500568_0107738
393 Ga0500624_000235
394 Ga0500624_000241
395 2738763366
396 2739648653
397 2819547025
398 2819550422
399 2839993007
400 2839993077
401 2852631566
402 2884936057
403 2896344035
404 2902052764
405 2910251132
406 2919441389
407 2946001544
408 2977232412

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cc3-assembly1.cif.gz_B structure of agrobacterium tumefaciens virb8 protein 0.8359 65 192
5jbs-assembly1.cif.gz_A conformational changes during monomer-to-dimer transition of brucella suis virb8 0.8288 67 192
5wip-assembly1.cif.gz_D trae protein in complex with 2-(2-furyl)isonicotinic acid 0.8252 72 192
4akz-assembly1.cif.gz_A crystal structure of virb8 from brucella suis 0.8219 74 192
5wip-assembly2.cif.gz_C trae protein in complex with 2-(2-furyl)isonicotinic acid 0.8134 72 194
ID Description Score Start End Superfamily
2cc3B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8359 65 192 3.10.450.230
4akzD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.807 74 192 3.10.450.230
af_I6YGA5_49_159_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.783 77 189 3.10.450.230
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7821 83 189 3.10.450.50
af_O53973_67_188_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7695 65 189 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2R7JQB4-F1-model_v4 Conjugative transposon protein TraK 0.9842 83 202
AF-A0A6L3IJB7-F1-model_v4 Conjugative transposon protein TraK 0.9809 60 204
AF-R6FCD9-F1-model_v4 Conjugative transposon TraK protein 0.9809 69 197
AF-W4UUD7-F1-model_v4 Conjugative transposon protein TraK 0.9796 63 201
AF-A0A519YMU2-F1-model_v4 Conjugative transposon protein TraK 0.9775 69 201

Map