F314288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 205 | 109 | 408 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300046538|Ga0495609_0009816|Ga0495609_0009816_1169_1888 |
| Length | 239 |
| Sequence | VWPGKLPEVSSDLLYAINLIKAAPFRAAFSFKLHFMIIKNIEAKIRLAVFISAGSLLTAIIIVGMNCFYAYKMVANAQKSIYILDKSVPILARQTDMQLNRPAEYRAHVDLFHSLFFSLTPDDNYMEYQMKKAMYLIDESGMQQYNDLKEKGFFNSILSSSSVLTLETDSVAIDMPKHYFRYYGKLKIDRRSSTVVRSLITEGYLKDIPRSDNNPHGVLITGWKTLENKDLEDVEKNTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 20 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 36 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 38 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 41 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 58 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 59 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 60 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 61 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 62 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 63 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 64 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 65 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 66 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 67 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 68 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 69 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 70 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 71 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 72 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 73 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 91 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 92 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 93 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 94 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 95 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 96 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 97 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 98 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 99 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 100 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 101 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 102 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 103 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 104 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 105 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 106 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 107 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 108 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 109 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.17 |
| Metatranscriptomes | 0 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.71 |
| Nodule | 0 |
| Rhizoplane | 1.95 |
| Rhizosphere | 75.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495609_0009816 | 3300046538 | Bacteria | 4616 |
| 2 | JGI24739J22299_10008761 | 3300001989 | Bacteria | 3773 |
| 3 | JGI25152J39213_1005641 | 3300002773 | Bacteria | 3590 |
| 4 | JGI25150J39212_1000029 | 3300002774 | Bacteria | 103974 |
| 5 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 6 | JGI25153J46596_10000111 | 3300003215 | Bacteria | 92915 |
| 7 | rootH2_10071190 | 3300003320 | Bacteria | 6413 |
| 8 | rootH2_10271350 | 3300003320 | Bacteria | 2267 |
| 9 | rootL2_10006015 | 3300003322 | Bacteria | 19280 |
| 10 | rootL2_10022401 | 3300003322 | Bacteria | 12985 |
| 11 | rootL2_10291202 | 3300003322 | Bacteria | 2523 |
| 12 | rootL2_10344376 | 3300003322 | Bacteria | 1134 |
| 13 | rootH1_10018982 | 3300003323 | Bacteria | 37240 |
| 14 | rootH1_10079289 | 3300003323 | Bacteria | 8955 |
| 15 | rootH1_10146955 | 3300003323 | Bacteria | 7285 |
| 16 | Ga0055536_1000012 | 3300003781 | Bacteria | 263217 |
| 17 | Ga0055530_10001256 | 3300003791 | Bacteria | 19253 |
| 18 | Ga0065714_10064431 | 3300005288 | Bacteria | 135024 |
| 19 | Ga0065714_10064540 | 3300005288 | Bacteria | 39469 |
| 20 | Ga0065714_10107013 | 3300005288 | Bacteria | 1539 |
| 21 | Ga0070659_100312032 | 3300005366 | Bacteria | 1313 |
| 22 | Ga0070663_100007664 | 3300005455 | Bacteria | 6587 |
| 23 | Ga0068853_100710447 | 3300005539 | Bacteria | 959 |
| 24 | Ga0068855_100002083 | 3300005563 | Bacteria | 24775 |
| 25 | Ga0068855_100010925 | 3300005563 | Bacteria | 10958 |
| 26 | Ga0068855_100014846 | 3300005563 | Bacteria | 9379 |
| 27 | Ga0068854_100017184 | 3300005578 | Bacteria | 4837 |
| 28 | Ga0068856_100000005 | 3300005614 | Bacteria | 225505 |
| 29 | Ga0068856_100000100 | 3300005614 | Bacteria | 82857 |
| 30 | Ga0068865_100000015 | 3300006881 | Bacteria | 129922 |
| 31 | Ga0105244_10041652 | 3300009036 | Bacteria | 2379 |
| 32 | Ga0105240_10000044 | 3300009093 | Bacteria | 250257 |
| 33 | Ga0105240_10000173 | 3300009093 | Bacteria | 131281 |
| 34 | Ga0105240_10000316 | 3300009093 | Bacteria | 92409 |
| 35 | Ga0105240_10000686 | 3300009093 | Bacteria | 62303 |
| 36 | Ga0105240_10003706 | 3300009093 | Bacteria | 23613 |
| 37 | Ga0105240_10061761 | 3300009093 | Plasmid | 4668 |
| 38 | Ga0105240_10129846 | 3300009093 | Unclassified | 3024 |
| 39 | Ga0105240_10239788 | 3300009093 | Bacteria | 2102 |
| 40 | Ga0105240_10306691 | 3300009093 | Bacteria | 1814 |
| 41 | Ga0105240_10377678 | 3300009093 | Bacteria | 1601 |
| 42 | Ga0105243_11449777 | 3300009148 | Bacteria | 709 |
| 43 | Ga0105241_10000089 | 3300009174 | Bacteria | 68136 |
| 44 | Ga0105241_10072397 | 3300009174 | Bacteria | 2678 |
| 45 | Ga0105241_10081985 | 3300009174 | Bacteria | 2528 |
| 46 | Ga0105241_10434112 | 3300009174 | Bacteria | 1159 |
| 47 | Ga0105237_10000173 | 3300009545 | Bacteria | 90612 |
| 48 | Ga0105237_10000176 | 3300009545 | Bacteria | 90175 |
| 49 | Ga0105237_10000511 | 3300009545 | Bacteria | 54911 |
| 50 | Ga0105237_10000786 | 3300009545 | Bacteria | 43345 |
| 51 | Ga0105237_10182423 | 3300009545 | Bacteria | 2099 |
| 52 | Ga0105237_10251344 | 3300009545 | Bacteria | 1770 |
| 53 | Ga0105238_10000124 | 3300009551 | Bacteria | 85021 |
| 54 | Ga0105238_10048711 | 3300009551 | Bacteria | 4269 |
| 55 | Ga0105238_10234644 | 3300009551 | Bacteria | 1811 |
| 56 | Ga0105238_10957616 | 3300009551 | Bacteria | 876 |
| 57 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 58 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 59 | Ga0105239_10000053 | 3300010375 | Bacteria | 163705 |
| 60 | Ga0105239_10000055 | 3300010375 | Bacteria | 158211 |
| 61 | Ga0105239_10000177 | 3300010375 | Bacteria | 92286 |
| 62 | Ga0105239_10005161 | 3300010375 | Bacteria | 15414 |
| 63 | Ga0105239_10031687 | 3300010375 | Bacteria | 5810 |
| 64 | Ga0105239_10529206 | 3300010375 | Bacteria | 1341 |
| 65 | Ga0157373_10000053 | 3300013100 | Bacteria | 104200 |
| 66 | Ga0157373_10054232 | 3300013100 | Bacteria | 2849 |
| 67 | Ga0157373_10088526 | 3300013100 | Bacteria | 2181 |
| 68 | Ga0157373_10297605 | 3300013100 | Bacteria | 1145 |
| 69 | Ga0157371_10005321 | 3300013102 | Bacteria | 10891 |
| 70 | Ga0157370_10000040 | 3300013104 | Bacteria | 134107 |
| 71 | Ga0157370_10000392 | 3300013104 | Bacteria | 55046 |
| 72 | Ga0157370_10003085 | 3300013104 | Bacteria | 19728 |
| 73 | Ga0157370_10009166 | 3300013104 | Bacteria | 10610 |
| 74 | Ga0157370_10254858 | 3300013104 | Bacteria | 1623 |
| 75 | Ga0157370_10565130 | 3300013104 | Bacteria | 1042 |
| 76 | Ga0157370_10569230 | 3300013104 | Bacteria | 1038 |
| 77 | Ga0157369_10441174 | 3300013105 | Bacteria | 1348 |
| 78 | Ga0157369_10658084 | 3300013105 | Bacteria | 1080 |
| 79 | Ga0157374_10000063 | 3300013296 | Bacteria | 109371 |
| 80 | Ga0157374_10010772 | 3300013296 | Bacteria | 7882 |
| 81 | Ga0157374_10480177 | 3300013296 | Bacteria | 1246 |
| 82 | Ga0157378_10245956 | 3300013297 | Bacteria | 1711 |
| 83 | Ga0163162_10023031 | 3300013306 | Bacteria | 6143 |
| 84 | Ga0163162_10459739 | 3300013306 | Bacteria | 1404 |
| 85 | Ga0157372_10000353 | 3300013307 | Bacteria | 50337 |
| 86 | Ga0182008_10000030 | 3300014497 | Bacteria | 169168 |
| 87 | Ga0182008_10091455 | 3300014497 | Bacteria | 1500 |
| 88 | Ga0182006_1000278 | 3300015261 | Bacteria | 45666 |
| 89 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 90 | Ga0182007_10000023 | 3300015262 | Bacteria | 187131 |
| 91 | Ga0163161_10007286 | 3300017792 | Bacteria | 7633 |
| 92 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 93 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 94 | Ga0209455_1001735 | 3300025272 | Bacteria | 9277 |
| 95 | Ga0209455_1008826 | 3300025272 | Bacteria | 2700 |
| 96 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 97 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 98 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 99 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 100 | Ga0207655_1026451 | 3300025728 | Bacteria | 2786 |
| 101 | Ga0207654_10000040 | 3300025911 | Bacteria | 105600 |
| 102 | Ga0207654_10043834 | 3300025911 | Bacteria | 2537 |
| 103 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 104 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 105 | Ga0207695_10000524 | 3300025913 | Bacteria | 81259 |
| 106 | Ga0207695_10005791 | 3300025913 | Bacteria | 16268 |
| 107 | Ga0207695_10066187 | 3300025913 | Plasmid | 3712 |
| 108 | Ga0207695_10167536 | 3300025913 | Bacteria | 2124 |
| 109 | Ga0207695_10222383 | 3300025913 | Bacteria | 1795 |
| 110 | Ga0207671_10000136 | 3300025914 | Bacteria | 112191 |
| 111 | Ga0207671_10000172 | 3300025914 | Bacteria | 99486 |
| 112 | Ga0207671_10000237 | 3300025914 | Bacteria | 82854 |
| 113 | Ga0207671_10001047 | 3300025914 | Bacteria | 33623 |
| 114 | Ga0207694_10000244 | 3300025924 | Bacteria | 52258 |
| 115 | Ga0207694_10101631 | 3300025924 | Bacteria | 2279 |
| 116 | Ga0207694_10154165 | 3300025924 | Bacteria | 1852 |
| 117 | Ga0207694_10827665 | 3300025924 | Bacteria | 782 |
| 118 | Ga0207704_10000010 | 3300025938 | Bacteria | 188125 |
| 119 | Ga0207667_10025702 | 3300025949 | Bacteria | 6442 |
| 120 | Ga0207667_10072636 | 3300025949 | Bacteria | 3576 |
| 121 | Ga0207640_10015291 | 3300025981 | Bacteria | 4440 |
| 122 | Ga0207639_10390244 | 3300026041 | Bacteria | 1252 |
| 123 | Ga0207678_10097226 | 3300026067 | Bacteria | 2516 |
| 124 | Ga0207702_10000047 | 3300026078 | Bacteria | 143192 |
| 125 | Ga0207702_10001891 | 3300026078 | Bacteria | 20486 |
| 126 | Ga0307515_10000839 | 3300028794 | Bacteria | 70656 |
| 127 | Ga0307515_10262881 | 3300028794 | Bacteria | 1459 |
| 128 | Ga0265338_10042433 | 3300028800 | Bacteria | 4236 |
| 129 | Ga0307408_100000444 | 3300031548 | Bacteria | 36433 |
| 130 | Ga0307405_10000014 | 3300031731 | Bacteria | 226733 |
| 131 | Ga0307405_10000020 | 3300031731 | Bacteria | 156779 |
| 132 | Ga0307407_10000020 | 3300031903 | Bacteria | 126218 |
| 133 | Ga0307409_100036707 | 3300031995 | Bacteria | 3606 |
| 134 | Ga0307416_100000042 | 3300032002 | Bacteria | 130512 |
| 135 | Ga0307414_10000089 | 3300032004 | Bacteria | 78588 |
| 136 | Ga0307414_10000297 | 3300032004 | Bacteria | 29087 |
| 137 | Ga0307414_10019354 | 3300032004 | Bacteria | 4217 |
| 138 | Ga0307414_10395080 | 3300032004 | Bacteria | 1199 |
| 139 | Ga0373941_0036542 | 3300035115 | Bacteria | 1494 |
| 140 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 141 | Ga0395900_0000122 | 3300037418 | Bacteria | 133423 |
| 142 | Ga0395900_0047273 | 3300037418 | Bacteria | 4431 |
| 143 | Ga0395905_0038378 | 3300037471 | Bacteria | 4495 |
| 144 | Ga0395905_0042066 | 3300037471 | Bacteria | 4287 |
| 145 | Ga0451787_041904 | 3300041441 | Bacteria | 949 |
| 146 | Ga0451795_0068144 | 3300041456 | Bacteria | 1908 |
| 147 | Ga0451795_0492980 | 3300041456 | Bacteria | 3661 |
| 148 | Ga0451795_0838109 | 3300041456 | Bacteria | 2918 |
| 149 | Ga0451855_0285424 | 3300041511 | Bacteria | 2505 |
| 150 | Ga0451855_0705223 | 3300041511 | Bacteria | 950 |
| 151 | Ga0451855_1374161 | 3300041511 | Bacteria | 778 |
| 152 | Ga0451855_1457080 | 3300041511 | Bacteria | 1724 |
| 153 | Ga0451855_1655595 | 3300041511 | Unclassified | 1677 |
| 154 | Ga0466966_0000714 | 3300044684 | Bacteria | 21065 |
| 155 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 156 | Ga0495650_0000036 | 3300046471 | Bacteria | 400633 |
| 157 | Ga0495585_0000058 | 3300046492 | Bacteria | 112144 |
| 158 | Ga0495610_0000172 | 3300046512 | Bacteria | 72424 |
| 159 | Ga0495610_0114432 | 3300046512 | Bacteria | 1191 |
| 160 | Ga0495648_0004008 | 3300046524 | Bacteria | 12727 |
| 161 | Ga0495652_0142401 | 3300046529 | Unclassified | 1884 |
| 162 | Ga0495633_0000142 | 3300046558 | Bacteria | 95597 |
| 163 | Ga0495633_0074769 | 3300046558 | Bacteria | 1579 |
| 164 | Ga0495668_0000153 | 3300046616 | Bacteria | 104580 |
| 165 | Ga0495661_0000645 | 3300046665 | Bacteria | 35309 |
| 166 | Ga0495661_0015246 | 3300046665 | Bacteria | 5131 |
| 167 | Ga0495670_0265642 | 3300046691 | Bacteria | 916 |
| 168 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 169 | Ga0495660_0012200 | 3300046810 | Bacteria | 4987 |
| 170 | Ga0495687_001019 | 3300047443 | Bacteria | 27958 |
| 171 | Ga0495687_010669 | 3300047443 | Bacteria | 5017 |
| 172 | Ga0495685_087235 | 3300047447 | Unclassified | 1036 |
| 173 | Ga0495673_0068134 | 3300047469 | Bacteria | 1505 |
| 174 | Ga0495686_0000138 | 3300047472 | Bacteria | 146224 |
| 175 | Ga0495686_0002760 | 3300047472 | Bacteria | 16046 |
| 176 | Ga0495686_0005198 | 3300047472 | Bacteria | 10361 |
| 177 | Ga0495686_0143237 | 3300047472 | Bacteria | 1409 |
| 178 | Ga0495614_0011939 | 3300048089 | Bacteria | 3817 |
| 179 | Ga0495678_070215 | 3300049459 | Bacteria | 1286 |
| 180 | Ga0501241_010401 | 3300049758 | Bacteria | 1693 |
| 181 | Ga0500635_0016337 | 3300053080 | Bacteria | 2206 |
| 182 | Ga0500635_0021680 | 3300053080 | Bacteria | 1982 |
| 183 | Ga0500647_0078428 | 3300053091 | Bacteria | 1585 |
| 184 | Ga0500651_0000181 | 3300053093 | Bacteria | 40952 |
| 185 | Ga0500608_004492 | 3300053122 | Bacteria | 5414 |
| 186 | Ga0500618_000262 | 3300053125 | Bacteria | 40957 |
| 187 | Ga0500618_000329 | 3300053125 | Bacteria | 34392 |
| 188 | Ga0500568_0107738 | 3300053139 | Bacteria | 1043 |
| 189 | Ga0500624_000235 | 3300053157 | Bacteria | 20116 |
| 190 | Ga0500624_000241 | 3300053157 | Bacteria | 19457 |
| 191 | 2738763366 | 2738541284 | Bacteria | 5199923 |
| 192 | 2739648653 | 2739367663 | Bacteria | 5040914 |
| 193 | 2819547025 | 2818991437 | Bacteria | 5805520 |
| 194 | 2819550422 | 2818991437 | Bacteria | 5805520 |
| 195 | 2839993007 | 2839989709 | Bacteria | 3773432 |
| 196 | 2839993077 | 2839989709 | Bacteria | 3773432 |
| 197 | 2852631566 | 2852627209 | Bacteria | 5896285 |
| 198 | 2884936057 | 2884933994 | Bacteria | 4535041 |
| 199 | 2896344035 | 2896344016 | Bacteria | 3811746 |
| 200 | 2902052764 | 2902048731 | Bacteria | 4976191 |
| 201 | 2910251132 | 2910245624 | Bacteria | 6935613 |
| 202 | 2919441389 | 2919437846 | Bacteria | 6199444 |
| 203 | 2946001544 | 2945997725 | Bacteria | 6404843 |
| 204 | 2977232412 | 2977232053 | Bacteria | 5485925 |
| 205 | Ga0495609_0009816 | |||
| 206 | JGI24739J22299_10008761 | |||
| 207 | JGI25152J39213_1005641 | |||
| 208 | JGI25150J39212_1000029 | |||
| 209 | JGI25151J46595_10000003 | |||
| 210 | JGI25153J46596_10000111 | |||
| 211 | rootH2_10071190 | |||
| 212 | rootH2_10271350 | |||
| 213 | rootL2_10006015 | |||
| 214 | rootL2_10022401 | |||
| 215 | rootL2_10291202 | |||
| 216 | rootL2_10344376 | |||
| 217 | rootH1_10018982 | |||
| 218 | rootH1_10079289 | |||
| 219 | rootH1_10146955 | |||
| 220 | Ga0055536_1000012 | |||
| 221 | Ga0055530_10001256 | |||
| 222 | Ga0065714_10064431 | |||
| 223 | Ga0065714_10064540 | |||
| 224 | Ga0065714_10107013 | |||
| 225 | Ga0070659_100312032 | |||
| 226 | Ga0070663_100007664 | |||
| 227 | Ga0068853_100710447 | |||
| 228 | Ga0068855_100002083 | |||
| 229 | Ga0068855_100010925 | |||
| 230 | Ga0068855_100014846 | |||
| 231 | Ga0068854_100017184 | |||
| 232 | Ga0068856_100000005 | |||
| 233 | Ga0068856_100000100 | |||
| 234 | Ga0068865_100000015 | |||
| 235 | Ga0105244_10041652 | |||
| 236 | Ga0105240_10000044 | |||
| 237 | Ga0105240_10000173 | |||
| 238 | Ga0105240_10000316 | |||
| 239 | Ga0105240_10000686 | |||
| 240 | Ga0105240_10003706 | |||
| 241 | Ga0105240_10061761 | |||
| 242 | Ga0105240_10129846 | |||
| 243 | Ga0105240_10239788 | |||
| 244 | Ga0105240_10306691 | |||
| 245 | Ga0105240_10377678 | |||
| 246 | Ga0105243_11449777 | |||
| 247 | Ga0105241_10000089 | |||
| 248 | Ga0105241_10072397 | |||
| 249 | Ga0105241_10081985 | |||
| 250 | Ga0105241_10434112 | |||
| 251 | Ga0105237_10000173 | |||
| 252 | Ga0105237_10000176 | |||
| 253 | Ga0105237_10000511 | |||
| 254 | Ga0105237_10000786 | |||
| 255 | Ga0105237_10182423 | |||
| 256 | Ga0105237_10251344 | |||
| 257 | Ga0105238_10000124 | |||
| 258 | Ga0105238_10048711 | |||
| 259 | Ga0105238_10234644 | |||
| 260 | Ga0105238_10957616 | |||
| 261 | Ga0105239_10000001 | |||
| 262 | Ga0105239_10000005 | |||
| 263 | Ga0105239_10000053 | |||
| 264 | Ga0105239_10000055 | |||
| 265 | Ga0105239_10000177 | |||
| 266 | Ga0105239_10005161 | |||
| 267 | Ga0105239_10031687 | |||
| 268 | Ga0105239_10529206 | |||
| 269 | Ga0157373_10000053 | |||
| 270 | Ga0157373_10054232 | |||
| 271 | Ga0157373_10088526 | |||
| 272 | Ga0157373_10297605 | |||
| 273 | Ga0157371_10005321 | |||
| 274 | Ga0157370_10000040 | |||
| 275 | Ga0157370_10000392 | |||
| 276 | Ga0157370_10003085 | |||
| 277 | Ga0157370_10009166 | |||
| 278 | Ga0157370_10254858 | |||
| 279 | Ga0157370_10565130 | |||
| 280 | Ga0157370_10569230 | |||
| 281 | Ga0157369_10441174 | |||
| 282 | Ga0157369_10658084 | |||
| 283 | Ga0157374_10000063 | |||
| 284 | Ga0157374_10010772 | |||
| 285 | Ga0157374_10480177 | |||
| 286 | Ga0157378_10245956 | |||
| 287 | Ga0163162_10023031 | |||
| 288 | Ga0163162_10459739 | |||
| 289 | Ga0157372_10000353 | |||
| 290 | Ga0182008_10000030 | |||
| 291 | Ga0182008_10091455 | |||
| 292 | Ga0182006_1000278 | |||
| 293 | Ga0182007_10000001 | |||
| 294 | Ga0182007_10000023 | |||
| 295 | Ga0163161_10007286 | |||
| 296 | Ga0207425_1000004 | |||
| 297 | Ga0209129_1000005 | |||
| 298 | Ga0209455_1001735 | |||
| 299 | Ga0209455_1008826 | |||
| 300 | Ga0209676_1000001 | |||
| 301 | Ga0209025_1000009 | |||
| 302 | Ga0209758_1000010 | |||
| 303 | Ga0209050_1000018 | |||
| 304 | Ga0207655_1026451 | |||
| 305 | Ga0207654_10000040 | |||
| 306 | Ga0207654_10043834 | |||
| 307 | Ga0207695_10000013 | |||
| 308 | Ga0207695_10000053 | |||
| 309 | Ga0207695_10000524 | |||
| 310 | Ga0207695_10005791 | |||
| 311 | Ga0207695_10066187 | |||
| 312 | Ga0207695_10167536 | |||
| 313 | Ga0207695_10222383 | |||
| 314 | Ga0207671_10000136 | |||
| 315 | Ga0207671_10000172 | |||
| 316 | Ga0207671_10000237 | |||
| 317 | Ga0207671_10001047 | |||
| 318 | Ga0207694_10000244 | |||
| 319 | Ga0207694_10101631 | |||
| 320 | Ga0207694_10154165 | |||
| 321 | Ga0207694_10827665 | |||
| 322 | Ga0207704_10000010 | |||
| 323 | Ga0207667_10025702 | |||
| 324 | Ga0207667_10072636 | |||
| 325 | Ga0207640_10015291 | |||
| 326 | Ga0207639_10390244 | |||
| 327 | Ga0207678_10097226 | |||
| 328 | Ga0207702_10000047 | |||
| 329 | Ga0207702_10001891 | |||
| 330 | Ga0307515_10000839 | |||
| 331 | Ga0307515_10262881 | |||
| 332 | Ga0265338_10042433 | |||
| 333 | Ga0307408_100000444 | |||
| 334 | Ga0307405_10000014 | |||
| 335 | Ga0307405_10000020 | |||
| 336 | Ga0307407_10000020 | |||
| 337 | Ga0307409_100036707 | |||
| 338 | Ga0307416_100000042 | |||
| 339 | Ga0307414_10000089 | |||
| 340 | Ga0307414_10000297 | |||
| 341 | Ga0307414_10019354 | |||
| 342 | Ga0307414_10395080 | |||
| 343 | Ga0373941_0036542 | |||
| 344 | Ga0395899_0000001 | |||
| 345 | Ga0395900_0000122 | |||
| 346 | Ga0395900_0047273 | |||
| 347 | Ga0395905_0038378 | |||
| 348 | Ga0395905_0042066 | |||
| 349 | Ga0451787_041904 | |||
| 350 | Ga0451795_0068144 | |||
| 351 | Ga0451795_0492980 | |||
| 352 | Ga0451795_0838109 | |||
| 353 | Ga0451855_0285424 | |||
| 354 | Ga0451855_0705223 | |||
| 355 | Ga0451855_1374161 | |||
| 356 | Ga0451855_1457080 | |||
| 357 | Ga0451855_1655595 | |||
| 358 | Ga0466966_0000714 | |||
| 359 | Ga0495650_0000003 | |||
| 360 | Ga0495650_0000036 | |||
| 361 | Ga0495585_0000058 | |||
| 362 | Ga0495610_0000172 | |||
| 363 | Ga0495610_0114432 | |||
| 364 | Ga0495648_0004008 | |||
| 365 | Ga0495652_0142401 | |||
| 366 | Ga0495633_0000142 | |||
| 367 | Ga0495633_0074769 | |||
| 368 | Ga0495668_0000153 | |||
| 369 | Ga0495661_0000645 | |||
| 370 | Ga0495661_0015246 | |||
| 371 | Ga0495670_0265642 | |||
| 372 | Ga0495649_0000003 | |||
| 373 | Ga0495660_0012200 | |||
| 374 | Ga0495687_001019 | |||
| 375 | Ga0495687_010669 | |||
| 376 | Ga0495685_087235 | |||
| 377 | Ga0495673_0068134 | |||
| 378 | Ga0495686_0000138 | |||
| 379 | Ga0495686_0002760 | |||
| 380 | Ga0495686_0005198 | |||
| 381 | Ga0495686_0143237 | |||
| 382 | Ga0495614_0011939 | |||
| 383 | Ga0495678_070215 | |||
| 384 | Ga0501241_010401 | |||
| 385 | Ga0500635_0016337 | |||
| 386 | Ga0500635_0021680 | |||
| 387 | Ga0500647_0078428 | |||
| 388 | Ga0500651_0000181 | |||
| 389 | Ga0500608_004492 | |||
| 390 | Ga0500618_000262 | |||
| 391 | Ga0500618_000329 | |||
| 392 | Ga0500568_0107738 | |||
| 393 | Ga0500624_000235 | |||
| 394 | Ga0500624_000241 | |||
| 395 | 2738763366 | |||
| 396 | 2739648653 | |||
| 397 | 2819547025 | |||
| 398 | 2819550422 | |||
| 399 | 2839993007 | |||
| 400 | 2839993077 | |||
| 401 | 2852631566 | |||
| 402 | 2884936057 | |||
| 403 | 2896344035 | |||
| 404 | 2902052764 | |||
| 405 | 2910251132 | |||
| 406 | 2919441389 | |||
| 407 | 2946001544 | |||
| 408 | 2977232412 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cc3-assembly1.cif.gz_B | structure of agrobacterium tumefaciens virb8 protein | 0.8359 | 65 | 192 |
| 5jbs-assembly1.cif.gz_A | conformational changes during monomer-to-dimer transition of brucella suis virb8 | 0.8288 | 67 | 192 |
| 5wip-assembly1.cif.gz_D | trae protein in complex with 2-(2-furyl)isonicotinic acid | 0.8252 | 72 | 192 |
| 4akz-assembly1.cif.gz_A | crystal structure of virb8 from brucella suis | 0.8219 | 74 | 192 |
| 5wip-assembly2.cif.gz_C | trae protein in complex with 2-(2-furyl)isonicotinic acid | 0.8134 | 72 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cc3B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.8359 | 65 | 192 | 3.10.450.230 |
| 4akzD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.807 | 74 | 192 | 3.10.450.230 |
| af_I6YGA5_49_159_3.10.450.230 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.783 | 77 | 189 | 3.10.450.230 |
| af_P71754_77_184_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7821 | 83 | 189 | 3.10.450.50 |
| af_O53973_67_188_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7695 | 65 | 189 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7JQB4-F1-model_v4 | Conjugative transposon protein TraK | 0.9842 | 83 | 202 |
|
| AF-A0A6L3IJB7-F1-model_v4 | Conjugative transposon protein TraK | 0.9809 | 60 | 204 |
|
| AF-R6FCD9-F1-model_v4 | Conjugative transposon TraK protein | 0.9809 | 69 | 197 |
|
| AF-W4UUD7-F1-model_v4 | Conjugative transposon protein TraK | 0.9796 | 63 | 201 |
|
| AF-A0A519YMU2-F1-model_v4 | Conjugative transposon protein TraK | 0.9775 | 69 | 201 |
|