F314531

General Info

Members Datasets Scaffolds Average Seq Length
205 140 204 127

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003151029|8003151831
Length 155
Sequence ALSRLIYKGFKNVINLNTFAHNYRSLFTLIMKDYKKHFIVPAPPEDVYRALTNPATIQLWSGEPAEMSTEPGSEFSLWEGSIAGRNLEFVEDKKIVQQWYFGEQEEDSIVTIILHPDKKGTSAELKHTNIPDDAYADIVEGWQDAYFGALIDFYL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
115 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
116 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
117 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
118 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
119 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
134 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
138 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.34
Nodule 0
Rhizoplane 0.98
Rhizosphere 59.51
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000907 3300001979 Bacteria 13126
2 JGI24740J21852_10033696 3300001979 Bacteria 1622
3 JGI24739J22299_10001266 3300001989 Bacteria 9481
4 JGI24739J22299_10065621 3300001989 Bacteria 1138
5 JGI24737J22298_10010250 3300001990 Bacteria 3097
6 JGI24737J22298_10027176 3300001990 Bacteria 1805
7 JGI24735J21928_10000014 3300002067 Bacteria 186670
8 JGI24735J21928_10075144 3300002067 Bacteria 967
9 JGI24744J21845_10034341 3300002077 Bacteria 962
10 JGI25154J39366_1000080 3300002738 Bacteria 89374
11 JGI25153J46596_10002970 3300003215 Bacteria 9606
12 JGI25153J46596_10044853 3300003215 Bacteria 1325
13 rootH1_10011769 3300003316 Bacteria 30836
14 rootH1_10063734 3300003316 Bacteria 8438
15 rootH1_10104008 3300003316 Bacteria 2405
16 rootH2_10048579 3300003320 Bacteria 7015
17 rootH2_10084109 3300003320 Bacteria 2308
18 rootH2_10159029 3300003320 Bacteria 1968
19 rootH2_10163259 3300003320 Bacteria 1790
20 rootH2_10298699 3300003320 Bacteria 1258
21 rootL2_10078568 3300003322 Unclassified 2431
22 rootL2_10097982 3300003322 Bacteria 4014
23 rootL2_10266032 3300003322 Bacteria 1605
24 rootL2_10338961 3300003322 Unclassified 1908
25 rootL2_10363167 3300003322 Bacteria 1601
26 rootH1_10011673 3300003323 Unclassified 3719
27 rootH1_10024917 3300003323 Bacteria 14293
28 rootH1_10042780 3300003323 Bacteria 19962
29 rootH1_10088337 3300003323 Bacteria 2877
30 rootH1_10138311 3300003323 Bacteria 9621
31 rootH1_10138434 3300003323 Bacteria 2409
32 JGI25160J50197_1003826 3300003354 Bacteria 6613
33 Ga0055526_1009695 3300003771 Bacteria 4591
34 Ga0055526_1010472 3300003771 Bacteria 4307
35 Ga0055528_1000595 3300003790 Bacteria 27213
36 Ga0055530_10001657 3300003791 Bacteria 15859
37 Ga0065165_1000280 3300005262 Bacteria 87088
38 Ga0065165_1050118 3300005262 Bacteria 1190
39 Ga0070658_10635696 3300005327 Bacteria 926
40 Ga0070683_100063250 3300005329 Bacteria 3442
41 Ga0070663_100006209 3300005455 Bacteria 7161
42 Ga0068867_100096121 3300005459 Bacteria 2255
43 Ga0070684_100086488 3300005535 Bacteria 2782
44 Ga0068852_101252034 3300005616 Bacteria 763
45 Ga0068864_100611655 3300005618 Bacteria 1058
46 Ga0068864_101101284 3300005618 Bacteria 790
47 Ga0068863_100072218 3300005841 Bacteria 3265
48 Ga0068863_100105290 3300005841 Bacteria 2684
49 Ga0075366_10042477 3300006195 Bacteria 2691
50 Ga0097621_100003569 3300006237 Bacteria 10751
51 Ga0068871_100005675 3300006358 Bacteria 8756
52 Ga0097620_100024625 3300006931 Bacteria 6039
53 Ga0105240_10476410 3300009093 Bacteria 1392
54 Ga0105237_10509022 3300009545 Bacteria 1211
55 Ga0105239_10198888 3300010375 Bacteria 2245
56 Ga0157373_10000205 3300013100 Bacteria 48796
57 Ga0157373_10001025 3300013100 Bacteria 21601
58 Ga0157373_10748222 3300013100 Bacteria 718
59 Ga0157371_10000216 3300013102 Bacteria 83975
60 Ga0157371_10003467 3300013102 Bacteria 14292
61 Ga0157371_10019705 3300013102 Bacteria 4968
62 Ga0157371_10091430 3300013102 Bacteria 2155
63 Ga0157370_10015705 3300013104 Bacteria 7690
64 Ga0157369_10000039 3300013105 Bacteria 188947
65 Ga0157369_10034199 3300013105 Bacteria 5580
66 Ga0157369_10092530 3300013105 Bacteria 3227
67 Ga0157369_10184076 3300013105 Bacteria 2197
68 Ga0157374_10238437 3300013296 Bacteria 1788
69 Ga0157374_10388396 3300013296 Bacteria 1391
70 Ga0157374_10901924 3300013296 Bacteria 902
71 Ga0157378_10042092 3300013297 Bacteria 4053
72 Ga0157378_13021302 3300013297 Bacteria 522
73 Ga0163162_10529310 3300013306 Bacteria 1308
74 Ga0163162_12273711 3300013306 Bacteria 623
75 Ga0157372_10000001 3300013307 Bacteria 791349
76 Ga0157372_10000196 3300013307 Bacteria 66430
77 Ga0157372_10001888 3300013307 Bacteria 22728
78 Ga0157372_10002192 3300013307 Bacteria 21241
79 Ga0157372_10022070 3300013307 Bacteria 6884
80 Ga0157376_10368469 3300014969 Bacteria 1380
81 Ga0157376_12369179 3300014969 Bacteria 570
82 Ga0182005_1000732 3300015265 Bacteria 15016
83 Ga0163161_11057690 3300017792 Bacteria 695
84 Ga0207427_107058 3300025231 Bacteria 1350
85 Ga0209258_100036 3300025242 Bacteria 428859
86 Ga0209646_1000091 3300025246 Bacteria 188727
87 Ga0209026_1000466 3300025250 Bacteria 31172
88 Ga0209026_1000691 3300025250 Bacteria 20158
89 Ga0209148_1000139 3300025254 Bacteria 167011
90 Ga0209148_1029079 3300025254 Unclassified 837
91 Ga0209129_1024748 3300025258 Bacteria 1053
92 Ga0209233_1000396 3300025261 Bacteria 36455
93 Ga0209673_1000014 3300025273 Bacteria 537082
94 Ga0209673_1000018 3300025273 Bacteria 458281
95 Ga0209564_1000465 3300025295 Bacteria 67957
96 Ga0209564_1002499 3300025295 Bacteria 14320
97 Ga0209758_1001032 3300025297 Bacteria 36527
98 Ga0209758_1004063 3300025297 Bacteria 12608
99 Ga0209758_1023608 3300025297 Bacteria 2774
100 Ga0209050_1000177 3300025298 Bacteria 146637
101 Ga0207426_1000251 3300025302 Bacteria 117462
102 Ga0207426_1000435 3300025302 Bacteria 67658
103 Ga0207426_1018170 3300025302 Unclassified 2482
104 Ga0207426_1079765 3300025302 Bacteria 891
105 Ga0209257_1000008 3300025304 Bacteria 1294570
106 Ga0209257_1002645 3300025304 Bacteria 17239
107 Ga0207647_10000104 3300025904 Bacteria 65696
108 Ga0207647_10073197 3300025904 Bacteria 2065
109 Ga0207705_10621726 3300025909 Unclassified 840
110 Ga0207671_11365744 3300025914 Bacteria 550
111 Ga0207681_10485677 3300025923 Bacteria 1009
112 Ga0207668_11515453 3300025972 Bacteria 605
113 Ga0207678_10014764 3300026067 Bacteria 6874
114 Ga0207641_10168303 3300026088 Bacteria 1998
115 Ga0207641_10229174 3300026088 Bacteria 1726
116 Ga0207648_10125783 3300026089 Bacteria 2255
117 Ga0207676_10471692 3300026095 Bacteria 1187
118 Ga0207698_12151798 3300026142 Bacteria 571
119 Ga0209999_1065309 3300027543 Bacteria 695
120 Ga0268266_11326564 3300028379 Bacteria 695
121 Ga0265327_10008400 3300031251 Bacteria 7697
122 Ga0265327_10096518 3300031251 Bacteria 1433
123 Ga0307408_100000570 3300031548 Bacteria 31760
124 Ga0307408_100004169 3300031548 Bacteria 9848
125 Ga0307405_11790286 3300031731 Unclassified 546
126 Ga0307412_10001724 3300031911 Bacteria 12097
127 Ga0307409_101119083 3300031995 Bacteria 809
128 Ga0307416_100136322 3300032002 Bacteria 2221
129 Ga0307414_10159118 3300032004 Bacteria 1792
130 Ga0307414_10279690 3300032004 Bacteria 1402
131 Ga0307414_10379227 3300032004 Bacteria 1222
132 Ga0307415_100851853 3300032126 Bacteria 836
133 Ga0307507_10000064 3300033179 Bacteria 161226
134 Ga0395899_0000342 3300037312 Bacteria 57838
135 Ga0395905_0151207 3300037471 Bacteria 2184
136 Ga0395901_0480233 3300038443 Unclassified 1268
137 Ga0451797_0177069 3300041453 Unclassified 686
138 Ga0451807_1939157 3300041486 Bacteria 1896
139 Ga0439431_0015171 3300041997 Bacteria 1792
140 Ga0439445_0037691 3300042004 Bacteria 1276
141 Ga0439457_034197 3300042014 Bacteria 1129
142 Ga0466969_0033922 3300044656 Bacteria 2588
143 Ga0466966_0087085 3300044684 Bacteria 1941
144 Ga0466960_0272236 3300044901 Bacteria 947
145 Ga0466959_1067082 3300045049 Bacteria 537
146 Ga0466958_0026100 3300045836 Bacteria 3451
147 Ga0495627_011290 3300046453 Bacteria 3209
148 Ga0495592_0203788 3300046454 Bacteria 1333
149 Ga0495638_0136594 3300046460 Bacteria 1435
150 Ga0495650_0000003 3300046471 Bacteria 900730
151 Ga0495582_0465831 3300046473 Unclassified 730
152 Ga0495585_0000510 3300046492 Bacteria 36718
153 Ga0495606_0000145 3300046507 Bacteria 122857
154 Ga0495610_0018406 3300046512 Bacteria 3948
155 Ga0495616_0002336 3300046513 Bacteria 12660
156 Ga0495616_0014742 3300046513 Bacteria 4364
157 Ga0495618_0288974 3300046514 Bacteria 1021
158 Ga0495630_0722077 3300046517 Bacteria 762
159 Ga0495652_0157348 3300046529 Bacteria 1768
160 Ga0495633_0000019 3300046558 Bacteria 233769
161 Ga0495633_0009952 3300046558 Bacteria 5221
162 Ga0495668_0002295 3300046616 Bacteria 16070
163 Ga0495625_0000005 3300046660 Bacteria 596135
164 Ga0495625_0101546 3300046660 Bacteria 1975
165 Ga0495661_0040874 3300046665 Bacteria 2872
166 Ga0495670_0329166 3300046691 Bacteria 821
167 Ga0495671_0307075 3300046692 Bacteria 763
168 Ga0495649_0000003 3300046694 Bacteria 880817
169 Ga0495604_0194580 3300047317 Bacteria 1411
170 Ga0495687_014926 3300047443 Bacteria 3970
171 Ga0496121_0000043 3300048924 Bacteria 341882
172 Ga0496126_0041567 3300048929 Bacteria 4253
173 Ga0495678_269726 3300049459 Bacteria 500
174 Ga0501206_114270 3300049653 Bacteria 502
175 Ga0501223_037570 3300049663 Unclassified 941
176 Ga0501253_038522 3300049683 Unclassified 951
177 Ga0501259_002852 3300049688 Unclassified 2772
178 Ga0501225_0213251 3300049705 Bacteria 618
179 Ga0501241_000326 3300049758 Bacteria 10515
180 Ga0501044_0093327 3300049823 Bacteria 3035
181 nmdc:mga0k408_481739_c1 3300050493 Bacteria 736
182 Ga0500578_0158513 3300053086 Bacteria 1406
183 Ga0500644_0000286 3300053088 Bacteria 27924
184 Ga0500646_0027059 3300053090 Bacteria 1558
185 Ga0500583_0302744 3300053092 Unclassified 782
186 Ga0500651_0119758 3300053093 Bacteria 1599
187 Ga0500607_054753 3300053121 Bacteria 2111
188 Ga0500652_017451 3300053131 Bacteria 2631
189 Ga0500658_0217025 3300053134 Bacteria 876
190 Ga0500559_0084851 3300053136 Bacteria 1444
191 Ga0500561_0103890 3300053137 Unclassified 854
192 Ga0500568_0026368 3300053139 Bacteria 2440
193 Ga0500577_0003672 3300053142 Unclassified 4002
194 Ga0500590_062063 3300053148 Bacteria 1876
195 Ga0500616_0002418 3300053153 Bacteria 15554
196 Ga0500616_0023764 3300053153 Bacteria 3412
197 Ga0500616_0030762 3300053153 Bacteria 2945
198 Ga0500622_0001023 3300053156 Bacteria 23439
199 Ga0500622_0001106 3300053156 Bacteria 22462
200 Ga0500622_0006845 3300053156 Bacteria 6551
201 Ga0500622_0242921 3300053156 Bacteria 794
202 Ga0500624_000483 3300053157 Bacteria 11780
203 Ga0500633_0018859 3300053160 Unclassified 2052
204 Ga0500636_0008600 3300053177 Bacteria 5913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001979 JGI24740J21852_10000907 JGI24740J21852_1000090711 125
2 3300001979 JGI24740J21852_10033696 JGI24740J21852_100336962 125
3 3300001989 JGI24739J22299_10001266 JGI24739J22299_1000126610 125
4 3300001989 JGI24739J22299_10065621 JGI24739J22299_100656212 125
5 3300001990 JGI24737J22298_10010250 JGI24737J22298_100102502 125
6 3300001990 JGI24737J22298_10027176 JGI24737J22298_100271763 125
7 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001490 125
8 3300002067 JGI24735J21928_10075144 JGI24735J21928_100751442 125
9 3300002077 JGI24744J21845_10034341 JGI24744J21845_100343412 125
10 3300002738 JGI25154J39366_1000080 JGI25154J39366_100008056 125
11 3300003215 JGI25153J46596_10002970 JGI25153J46596_100029705 125
12 3300003215 JGI25153J46596_10044853 JGI25153J46596_100448532 125
13 3300003316 rootH1_10011769 rootH1_100117693 125
14 3300003316 rootH1_10063734 rootH1_100637348 125
15 3300003316 rootH1_10104008 rootH1_101040083 125
16 3300003320 rootH2_10048579 rootH2_100485795 125
17 3300003320 rootH2_10084109 rootH2_100841093 125
18 3300003320 rootH2_10159029 rootH2_101590292 125
19 3300003320 rootH2_10163259 rootH2_101632592 125
20 3300003320 rootH2_10298699 rootH2_102986992 125
21 3300003322 rootL2_10078568 rootL2_100785683 125
22 3300003322 rootL2_10097982 rootL2_100979827 125
23 3300003322 rootL2_10266032 rootL2_102660321 125
24 3300003322 rootL2_10338961 rootL2_103389612 125
25 3300003322 rootL2_10363167 rootL2_103631672 125
26 3300003323 rootH1_10011673 rootH1_100116735 125
27 3300003323 rootH1_10024917 rootH1_100249173 125
28 3300003323 rootH1_10042780 rootH1_100427808 125
29 3300003323 rootH1_10088337 rootH1_100883373 125
30 3300003323 rootH1_10138311 rootH1_101383112 125
31 3300003323 rootH1_10138434 rootH1_101384343 125
32 3300003354 JGI25160J50197_1003826 JGI25160J50197_10038264 125
33 3300003771 Ga0055526_1009695 Ga0055526_10096952 125
34 3300003771 Ga0055526_1010472 Ga0055526_10104721 125
35 3300003790 Ga0055528_1000595 Ga0055528_100059527 125
36 3300003791 Ga0055530_10001657 Ga0055530_1000165712 125
37 3300005262 Ga0065165_1000280 Ga0065165_100028076 125
38 3300005262 Ga0065165_1050118 Ga0065165_10501182 125
39 3300005327 Ga0070658_10635696 Ga0070658_106356962 125
40 3300005329 Ga0070683_100063250 Ga0070683_1000632503 125
41 3300005455 Ga0070663_100006209 Ga0070663_1000062097 125
42 3300005459 Ga0068867_100096121 Ga0068867_1000961211 125
43 3300005535 Ga0070684_100086488 Ga0070684_1000864882 125
44 3300005616 Ga0068852_101252034 Ga0068852_1012520342 125
45 3300005618 Ga0068864_100611655 Ga0068864_1006116552 125
46 3300005618 Ga0068864_101101284 Ga0068864_1011012841 125
47 3300005841 Ga0068863_100072218 Ga0068863_1000722183 125
48 3300005841 Ga0068863_100105290 Ga0068863_1001052902 125
49 3300006195 Ga0075366_10042477 Ga0075366_100424774 125
50 3300006237 Ga0097621_100003569 Ga0097621_1000035694 125
51 3300006358 Ga0068871_100005675 Ga0068871_10000567511 125
52 3300006931 Ga0097620_100024625 Ga0097620_1000246255 125
53 3300009093 Ga0105240_10476410 Ga0105240_104764102 125
54 3300009545 Ga0105237_10509022 Ga0105237_105090221 125
55 3300010375 Ga0105239_10198888 Ga0105239_101988882 125
56 3300013100 Ga0157373_10000205 Ga0157373_1000020528 125
57 3300013100 Ga0157373_10001025 Ga0157373_1000102513 125
58 3300013100 Ga0157373_10748222 Ga0157373_107482221 125
59 3300013102 Ga0157371_10000216 Ga0157371_1000021655 125
60 3300013102 Ga0157371_10003467 Ga0157371_100034678 125
61 3300013102 Ga0157371_10019705 Ga0157371_100197057 125
62 3300013102 Ga0157371_10091430 Ga0157371_100914301 125
63 3300013104 Ga0157370_10015705 Ga0157370_100157055 125
64 3300013105 Ga0157369_10000039 Ga0157369_10000039136 125
65 3300013105 Ga0157369_10034199 Ga0157369_100341993 125
66 3300013105 Ga0157369_10092530 Ga0157369_100925304 125
67 3300013105 Ga0157369_10184076 Ga0157369_101840763 125
68 3300013296 Ga0157374_10238437 Ga0157374_102384373 125
69 3300013296 Ga0157374_10388396 Ga0157374_103883962 125
70 3300013296 Ga0157374_10901924 Ga0157374_109019241 125
71 3300013297 Ga0157378_10042092 Ga0157378_100420924 125
72 3300013297 Ga0157378_13021302 Ga0157378_130213021 125
73 3300013306 Ga0163162_10529310 Ga0163162_105293102 125
74 3300013306 Ga0163162_12273711 Ga0163162_122737112 125
75 3300013307 Ga0157372_10000001 Ga0157372_10000001221 125
76 3300013307 Ga0157372_10000196 Ga0157372_1000019613 125
77 3300013307 Ga0157372_10001888 Ga0157372_100018886 125
78 3300013307 Ga0157372_10002192 Ga0157372_1000219221 125
79 3300013307 Ga0157372_10022070 Ga0157372_100220704 125
80 3300014969 Ga0157376_10368469 Ga0157376_103684692 125
81 3300014969 Ga0157376_12369179 Ga0157376_123691791 125
82 3300015265 Ga0182005_1000732 Ga0182005_10007328 125
83 3300017792 Ga0163161_11057690 Ga0163161_110576901 125
84 3300025231 Ga0207427_107058 Ga0207427_1070582 125
85 3300025242 Ga0209258_100036 Ga0209258_100036293 125
86 3300025246 Ga0209646_1000091 Ga0209646_100009110 125
87 3300025250 Ga0209026_1000466 Ga0209026_100046615 125
88 3300025250 Ga0209026_1000691 Ga0209026_100069119 125
89 3300025254 Ga0209148_1000139 Ga0209148_10001393 125
90 3300025254 Ga0209148_1029079 Ga0209148_10290792 125
91 3300025258 Ga0209129_1024748 Ga0209129_10247482 125
92 3300025261 Ga0209233_1000396 Ga0209233_100039631 125
93 3300025273 Ga0209673_1000014 Ga0209673_1000014184 125
94 3300025273 Ga0209673_1000018 Ga0209673_1000018132 125
95 3300025295 Ga0209564_1000465 Ga0209564_100046568 125
96 3300025295 Ga0209564_1002499 Ga0209564_10024997 125
97 3300025297 Ga0209758_1001032 Ga0209758_10010322 125
98 3300025297 Ga0209758_1004063 Ga0209758_100406310 125
99 3300025297 Ga0209758_1023608 Ga0209758_10236082 125
100 3300025298 Ga0209050_1000177 Ga0209050_100017730 125
101 3300025302 Ga0207426_1000251 Ga0207426_100025147 125
102 3300025302 Ga0207426_1000435 Ga0207426_100043573 125
103 3300025302 Ga0207426_1018170 Ga0207426_10181703 125
104 3300025302 Ga0207426_1079765 Ga0207426_10797651 125
105 3300025304 Ga0209257_1000008 Ga0209257_100000884 125
106 3300025304 Ga0209257_1002645 Ga0209257_100264513 125
107 3300025904 Ga0207647_10000104 Ga0207647_1000010454 125
108 3300025904 Ga0207647_10073197 Ga0207647_100731971 125
109 3300025909 Ga0207705_10621726 Ga0207705_106217261 125
110 3300025914 Ga0207671_11365744 Ga0207671_113657441 125
111 3300025923 Ga0207681_10485677 Ga0207681_104856772 125
112 3300025972 Ga0207668_11515453 Ga0207668_115154532 125
113 3300026067 Ga0207678_10014764 Ga0207678_100147647 125
114 3300026088 Ga0207641_10168303 Ga0207641_101683032 125
115 3300026088 Ga0207641_10229174 Ga0207641_102291741 125
116 3300026089 Ga0207648_10125783 Ga0207648_101257833 125
117 3300026095 Ga0207676_10471692 Ga0207676_104716922 125
118 3300026142 Ga0207698_12151798 Ga0207698_121517981 125
119 3300027543 Ga0209999_1065309 Ga0209999_10653092 125
120 3300028379 Ga0268266_11326564 Ga0268266_113265642 125
121 3300031251 Ga0265327_10008400 Ga0265327_100084006 125
122 3300031251 Ga0265327_10096518 Ga0265327_100965181 125
123 3300031548 Ga0307408_100000570 Ga0307408_1000005705 125
124 3300031548 Ga0307408_100004169 Ga0307408_1000041695 125
125 3300031731 Ga0307405_11790286 Ga0307405_117902862 125
126 3300031911 Ga0307412_10001724 Ga0307412_1000172415 125
127 3300031995 Ga0307409_101119083 Ga0307409_1011190832 125
128 3300032002 Ga0307416_100136322 Ga0307416_1001363222 125
129 3300032004 Ga0307414_10159118 Ga0307414_101591182 125
130 3300032004 Ga0307414_10279690 Ga0307414_102796902 125
131 3300032004 Ga0307414_10379227 Ga0307414_103792272 125
132 3300032126 Ga0307415_100851853 Ga0307415_1008518531 125
133 3300033179 Ga0307507_10000064 Ga0307507_10000064102 125
134 3300037312 Ga0395899_0000342 Ga0395899_0000342_32396_32776 125
135 3300037471 Ga0395905_0151207 Ga0395905_0151207_861_1241 125
136 3300038443 Ga0395901_0480233 Ga0395901_0480233_355_735 125
137 3300041453 Ga0451797_0177069 Ga0451797_0177069_81_458 125
138 3300041486 Ga0451807_1939157 Ga0451807_1939157_327_704 125
139 3300041997 Ga0439431_0015171 Ga0439431_0015171_728_1108 125
140 3300042004 Ga0439445_0037691 Ga0439445_0037691_460_840 125
141 3300042014 Ga0439457_034197 Ga0439457_034197_560_940 125
142 3300044656 Ga0466969_0033922 Ga0466969_0033922_554_934 125
143 3300044684 Ga0466966_0087085 Ga0466966_0087085_212_592 125
144 3300044901 Ga0466960_0272236 Ga0466960_0272236_59_436 125
145 3300045049 Ga0466959_1067082 Ga0466959_1067082_25_405 125
146 3300045836 Ga0466958_0026100 Ga0466958_0026100_2856_3236 125
147 3300046453 Ga0495627_011290 Ga0495627_011290_2150_2530 125
148 3300046454 Ga0495592_0203788 Ga0495592_0203788_413_790 125
149 3300046460 Ga0495638_0136594 Ga0495638_0136594_117_500 125
150 3300046471 Ga0495650_0000003 Ga0495650_0000003_91025_91408 125
151 3300046473 Ga0495582_0465831 Ga0495582_0465831_37_414 125
152 3300046492 Ga0495585_0000510 Ga0495585_0000510_6623_7006 125
153 3300046507 Ga0495606_0000145 Ga0495606_0000145_38363_38746 125
154 3300046512 Ga0495610_0018406 Ga0495610_0018406_1027_1410 125
155 3300046513 Ga0495616_0002336 Ga0495616_0002336_3736_4119 125
156 3300046513 Ga0495616_0014742 Ga0495616_0014742_739_1122 125
157 3300046514 Ga0495618_0288974 Ga0495618_0288974_602_979 125
158 3300046517 Ga0495630_0722077 Ga0495630_0722077_180_557 125
159 3300046529 Ga0495652_0157348 Ga0495652_0157348_592_975 125
160 3300046558 Ga0495633_0000019 Ga0495633_0000019_94810_95190 125
161 3300046558 Ga0495633_0009952 Ga0495633_0009952_1202_1585 125
162 3300046616 Ga0495668_0002295 Ga0495668_0002295_11884_12264 125
163 3300046660 Ga0495625_0000005 Ga0495625_0000005_208091_208474 125
164 3300046660 Ga0495625_0101546 Ga0495625_0101546_1278_1661 125
165 3300046665 Ga0495661_0040874 Ga0495661_0040874_1813_2196 125
166 3300046691 Ga0495670_0329166 Ga0495670_0329166_169_549 125
167 3300046692 Ga0495671_0307075 Ga0495671_0307075_161_544 125
168 3300046694 Ga0495649_0000003 Ga0495649_0000003_208113_208496 125
169 3300047317 Ga0495604_0194580 Ga0495604_0194580_142_519 125
170 3300047443 Ga0495687_014926 Ga0495687_014926_3155_3538 125
171 3300048924 Ga0496121_0000043 Ga0496121_0000043_314108_314485 125
172 3300048929 Ga0496126_0041567 Ga0496126_0041567_3176_3556 125
173 3300049459 Ga0495678_269726 Ga0495678_269726_33_416 125
174 3300049653 Ga0501206_114270 Ga0501206_114270_76_462 125
175 3300049663 Ga0501223_037570 Ga0501223_037570_148_528 125
176 3300049683 Ga0501253_038522 Ga0501253_038522_423_803 125
177 3300049688 Ga0501259_002852 Ga0501259_002852_906_1286 125
178 3300049705 Ga0501225_0213251 Ga0501225_0213251_50_433 125
179 3300049758 Ga0501241_000326 Ga0501241_000326_7077_7457 125
180 3300049823 Ga0501044_0093327 Ga0501044_0093327_1356_1733 125
181 3300050493 nmdc:mga0k408_481739_c1 nmdc:mga0k408_481739_c1_146_529 125
182 3300053086 Ga0500578_0158513 Ga0500578_0158513_452_835 125
183 3300053088 Ga0500644_0000286 Ga0500644_0000286_26593_26970 125
184 3300053090 Ga0500646_0027059 Ga0500646_0027059_1017_1394 125
185 3300053092 Ga0500583_0302744 Ga0500583_0302744_360_737 125
186 3300053093 Ga0500651_0119758 Ga0500651_0119758_543_923 125
187 3300053121 Ga0500607_054753 Ga0500607_054753_1303_1680 125
188 3300053131 Ga0500652_017451 Ga0500652_017451_501_878 125
189 3300053134 Ga0500658_0217025 Ga0500658_0217025_386_763 125
190 3300053136 Ga0500559_0084851 Ga0500559_0084851_1011_1388 125
191 3300053137 Ga0500561_0103890 Ga0500561_0103890_171_548 125
192 3300053139 Ga0500568_0026368 Ga0500568_0026368_1155_1532 125
193 3300053142 Ga0500577_0003672 Ga0500577_0003672_2956_3333 125
194 3300053148 Ga0500590_062063 Ga0500590_062063_1247_1624 125
195 3300053153 Ga0500616_0002418 Ga0500616_0002418_6354_6737 125
196 3300053153 Ga0500616_0023764 Ga0500616_0023764_2201_2578 125
197 3300053153 Ga0500616_0030762 Ga0500616_0030762_732_1115 125
198 3300053156 Ga0500622_0001023 Ga0500622_0001023_6761_7144 125
199 3300053156 Ga0500622_0001106 Ga0500622_0001106_9101_9481 125
200 3300053156 Ga0500622_0006845 Ga0500622_0006845_3524_3907 125
201 3300053156 Ga0500622_0242921 Ga0500622_0242921_212_595 125
202 3300053157 Ga0500624_000483 Ga0500624_000483_10897_11280 125
203 3300053160 Ga0500633_0018859 Ga0500633_0018859_44_421 125
204 3300053177 Ga0500636_0008600 Ga0500636_0008600_3883_4260 125
205 iso_pu_bacteria 8003151029 8003151831 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

41

152

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ni8-assembly1.cif.gz_A crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum 0.9029 3 118
6xle-assembly1.cif.gz_D full-length hsc82 in complex with two aha1 ctd in the presence of amp-pnp 0.8859 2 120
7dme-assembly1.cif.gz_A solution structure of human aha1 0.8762 3 123
6xlb-assembly1.cif.gz_D1 apo full-length hsc82 in complex with aha1 0.8698 3 120
1x53-assembly1.cif.gz_A the solution structure of the c-terminal domain of human activator of 90 kda heat shock protein atpase homolog 1 0.8631 2 120
ID Description Score Start End Superfamily
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9287 2 123 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.924 2 123 3.30.530.20
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.923 2 123 3.30.530.20
af_A0A1D8PU72_210_343_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9104 2 124 3.30.530.20
af_Q4E5D5_198_328_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9075 3 120 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1H7Q4C8-F1-model_v4 Activator of Hsp90 ATPase homolog 1-like protein 1.005 1 125
AF-A0A1F3BXB1-F1-model_v4 ATPase 0.9993 1 124
AF-C7PPK8-F1-model_v4 deleted 0.9991 1 124
AF-A0A1C4FNZ4-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9985 1 125
AF-A0A512BET0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9967 2 124

Feature Viewer

pLDDT pTM Quality
97.02 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map