F314941

General Info

Members Datasets Scaffolds Average Seq Length
206 140 412 216

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10132697|Ga0075364_101326972
Length 227
Sequence MTSDLKDLKKMRYSICISGAAAGQTVVDSRDKAIVLGEAIARTGHILTTGATVGLPYFSAYGAKKAGGTSIGFSPASSLRSHVRKYRLPHDVFDFINFTGMDYVGRDLYLVQSSDAVITVGGRFGSLHEFTSALEARKPCGVLLGSGGTADLIPQLMKTLSPPAGDIVIYDDDPERLVKRMVEILDDKYEDIRTQLERDEHWYLKEGLADPSLADPDATSRVSNRRG

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
139 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
140 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.55
Nodule 0
Rhizoplane 0
Rhizosphere 65.05
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10132697 3300006051 Bacteria 1672
2 JGI24736J21556_1019229 3300001904 Unclassified 1079
3 JGI24741J21665_1000781 3300001915 Bacteria 9552
4 JGI24740J21852_10023517 3300001979 Bacteria 2103
5 JGI24737J22298_10000095 3300001990 Bacteria 26030
6 JGI24735J21928_10042103 3300002067 Unclassified 1330
7 JGI24742J22300_10000006 3300002244 Bacteria 41202
8 rootH2_10000244 3300003320 Bacteria 697651
9 rootH2_10089542 3300003320 Bacteria 3425
10 rootH2_10107295 3300003320 Unclassified 2367
11 rootL2_10109217 3300003322 Unclassified 2200
12 rootH1_10015736 3300003323 Bacteria 4219
13 rootH1_10219291 3300003323 Unclassified 1489
14 Ga0065704_10109593 3300005289 Bacteria 2000
15 Ga0070658_10004138 3300005327 Bacteria 11879
16 Ga0070658_10006099 3300005327 Bacteria 9774
17 Ga0070683_100000140 3300005329 Bacteria 46747
18 Ga0070683_100000657 3300005329 Bacteria 25014
19 Ga0070683_100183332 3300005329 Bacteria 1987
20 Ga0070680_100007503 3300005336 Bacteria 8317
21 Ga0070660_100000454 3300005339 Bacteria 27343
22 Ga0070692_10091115 3300005345 Bacteria 1657
23 Ga0070659_100000558 3300005366 Bacteria 27295
24 Ga0070667_100000001 3300005367 Bacteria 1108638
25 Ga0070663_100668140 3300005455 Bacteria 880
26 Ga0070678_100340006 3300005456 Bacteria 1287
27 Ga0068867_100314422 3300005459 Bacteria 1295
28 Ga0070679_100041151 3300005530 Bacteria 4600
29 Ga0070684_100001211 3300005535 Bacteria 18536
30 Ga0070684_100004041 3300005535 Bacteria 11104
31 Ga0070684_100018888 3300005535 Bacteria 5691
32 Ga0070684_100117569 3300005535 Bacteria 2389
33 Ga0068855_100000003 3300005563 Bacteria 589862
34 Ga0068855_100000211 3300005563 Bacteria 74558
35 Ga0068855_100093694 3300005563 Bacteria 3463
36 Ga0068855_100126687 3300005563 Bacteria 2919
37 Ga0068855_100814850 3300005563 Bacteria 991
38 Ga0068857_100000002 3300005577 Bacteria 241401
39 Ga0068857_100171667 3300005577 Bacteria 1971
40 Ga0068857_100917569 3300005577 Bacteria 840
41 Ga0068856_100000866 3300005614 Bacteria 32413
42 Ga0068852_100464400 3300005616 Bacteria 1255
43 Ga0068860_100025027 3300005843 Bacteria 5762
44 Ga0081539_10074073 3300005985 Unclassified 1814
45 Ga0070717_10299295 3300006028 Unclassified 1430
46 Ga0070717_10501526 3300006028 Unclassified 1097
47 Ga0075365_10000020 3300006038 Bacteria 64494
48 Ga0075368_10006658 3300006042 Bacteria 4051
49 Ga0075363_100000016 3300006048 Bacteria 38279
50 Ga0075364_10001546 3300006051 Bacteria 12566
51 Ga0075364_10001845 3300006051 Bacteria 11739
52 Ga0075364_10025265 3300006051 Bacteria 3780
53 Ga0075364_10032724 3300006051 Bacteria 3344
54 Ga0075364_10194566 3300006051 Archaea 1374
55 Ga0075364_10212757 3300006051 Unclassified 1311
56 Ga0075364_10467594 3300006051 Unclassified 862
57 Ga0075362_10000073 3300006177 Bacteria 27914
58 Ga0075367_10000034 3300006178 Bacteria 29945
59 Ga0075367_10003897 3300006178 Bacteria 7196
60 Ga0075369_10000005 3300006186 Bacteria 147699
61 Ga0075369_10000051 3300006186 Bacteria 29832
62 Ga0075369_10110927 3300006186 Bacteria 1236
63 Ga0075366_10000001 3300006195 Bacteria 569172
64 Ga0075366_10000044 3300006195 Bacteria 45021
65 Ga0075366_10000083 3300006195 Bacteria 37001
66 Ga0075366_10000684 3300006195 Bacteria 16042
67 Ga0075366_10059650 3300006195 Bacteria 2266
68 Ga0097621_100003413 3300006237 Bacteria 10943
69 Ga0075370_10020582 3300006353 Bacteria 3609
70 Ga0068871_100000156 3300006358 Bacteria 45103
71 Ga0105240_10294250 3300009093 Bacteria 1860
72 Ga0111539_10013550 3300009094 Bacteria 10192
73 Ga0105245_10000002 3300009098 Bacteria 634374
74 Ga0105245_10672329 3300009098 Unclassified 1067
75 Ga0105243_10015378 3300009148 Bacteria 5787
76 Ga0105241_10000003 3300009174 Bacteria 839043
77 Ga0105248_11040035 3300009177 Unclassified 925
78 Ga0105249_10003576 3300009553 Bacteria 13450
79 Ga0105030_103307 3300009987 Unclassified 1392
80 Ga0105028_100187 3300009993 Bacteria 6678
81 Ga0157373_10000042 3300013100 Bacteria 113564
82 Ga0157371_10000937 3300013102 Bacteria 32624
83 Ga0157370_10029349 3300013104 Bacteria 5399
84 Ga0157370_10115012 3300013104 Bacteria 2513
85 Ga0157369_10000261 3300013105 Bacteria 71207
86 Ga0157374_10000031 3300013296 Bacteria 204840
87 Ga0157374_10089394 3300013296 Bacteria 2934
88 Ga0157374_10823501 3300013296 Unclassified 944
89 Ga0157377_10080312 3300014745 Bacteria 1905
90 Ga0157377_10193639 3300014745 Bacteria 1286
91 Ga0157377_10465983 3300014745 Bacteria 876
92 Ga0207647_10000458 3300025904 Bacteria 33136
93 Ga0207705_10001105 3300025909 Bacteria 21924
94 Ga0207705_10070393 3300025909 Bacteria 2535
95 Ga0207654_10000002 3300025911 Bacteria 1460142
96 Ga0207695_10209809 3300025913 Bacteria 1859
97 Ga0207660_10031569 3300025917 Bacteria 3650
98 Ga0207657_10001246 3300025919 Bacteria 27202
99 Ga0207652_10019309 3300025921 Bacteria 5604
100 Ga0207652_10117112 3300025921 Bacteria 2367
101 Ga0207694_10173984 3300025924 Bacteria 1744
102 Ga0207687_10000001 3300025927 Bacteria 1130810
103 Ga0207690_10002364 3300025932 Bacteria 11445
104 Ga0207709_10098338 3300025935 Bacteria 1929
105 Ga0207661_10000021 3300025944 Bacteria 205381
106 Ga0207661_10012888 3300025944 Bacteria 6096
107 Ga0207661_10153026 3300025944 Bacteria 1995
108 Ga0207667_10000008 3300025949 Bacteria 625138
109 Ga0207667_10000466 3300025949 Bacteria 54272
110 Ga0207667_10191363 3300025949 Bacteria 2099
111 Ga0207712_10002267 3300025961 Bacteria 12484
112 Ga0207668_10471455 3300025972 Unclassified 1075
113 Ga0207658_10000003 3300025986 Bacteria 1151934
114 Ga0207678_11022172 3300026067 Bacteria 732
115 Ga0207702_10001222 3300026078 Bacteria 25994
116 Ga0207648_10332566 3300026089 Bacteria 1367
117 Ga0207674_10000001 3300026116 Bacteria 616581
118 Ga0207674_10096983 3300026116 Bacteria 2933
119 Ga0207674_10185553 3300026116 Bacteria 2030
120 Ga0207674_10724855 3300026116 Bacteria 960
121 Ga0207675_100260392 3300026118 Bacteria 1681
122 Ga0207698_10432522 3300026142 Bacteria 1266
123 Ga0209813_10000004 3300027866 Bacteria 139340
124 Ga0207428_10015820 3300027907 Bacteria 6511
125 Ga0268265_10155749 3300028380 Bacteria 1933
126 Ga0268264_10057382 3300028381 Bacteria 3257
127 Ga0265338_10014462 3300028800 Bacteria 8784
128 Ga0265327_10000017 3300031251 Bacteria 445264
129 Ga0265327_10000961 3300031251 Bacteria 41308
130 Ga0373927_0500409 3300035695 Unclassified 803
131 Ga0395899_0004607 3300037312 Bacteria 10743
132 Ga0395900_0055305 3300037418 Bacteria 4087
133 Ga0395898_0043702 3300037466 Bacteria 4414
134 Ga0395905_0027294 3300037471 Bacteria 5384
135 Ga0395901_0014544 3300038443 Bacteria 8000
136 Ga0495629_0111267 3300046459 Unclassified 1909
137 Ga0495622_0000082 3300046557 Bacteria 85266
138 Ga0495588_0000116 3300046674 Bacteria 135919
139 Ga0495647_0156052 3300046681 Unclassified 981
140 Ga0495658_0010755 3300046683 Bacteria 4583
141 Ga0495649_0000284 3300046694 Bacteria 44736
142 Ga0495600_0016560 3300046809 Bacteria 4681
143 Ga0495672_0000129 3300047320 Bacteria 112879
144 Ga0495593_0037394 3300047673 Unclassified 2626
145 Ga0496126_0336623 3300048929 Bacteria 1237
146 Ga0501031_0000163 3300049568 Bacteria 38332
147 Ga0501032_0025266 3300049569 Bacteria 4096
148 Ga0501034_0060274 3300049571 Bacteria 3812
149 Ga0501034_0390869 3300049571 Bacteria 1315
150 Ga0501036_0004824 3300049572 Bacteria 10897
151 Ga0501037_0000121 3300049573 Bacteria 72862
152 Ga0501038_0005584 3300049574 Bacteria 11670
153 Ga0501042_0187113 3300049578 Bacteria 1494
154 Ga0501043_0002322 3300049579 Bacteria 16107
155 Ga0501046_0000138 3300049580 Bacteria 77052
156 Ga0501046_0226708 3300049580 Unclassified 1382
157 Ga0501047_0000681 3300049581 Bacteria 35407
158 Ga0501048_0000361 3300049582 Bacteria 31413
159 Ga0501070_0012332 3300049586 Bacteria 7211
160 Ga0501073_0022103 3300049589 Bacteria 4584
161 Ga0501074_0804095 3300049590 Bacteria 662
162 Ga0501035_0000801 3300049822 Bacteria 33495
163 Ga0501044_0008015 3300049823 Bacteria 11607
164 nmdc:mga03683_1412_c1 3300050489 Bacteria 7162
165 nmdc:mga03683_20_c3 3300050489 Bacteria 29488
166 nmdc:mga03n38_22_c1 3300050490 Bacteria 38225
167 nmdc:mga00v17_120353_c1 3300050491 Bacteria 1671
168 nmdc:mga00v17_140683_c1 3300050491 Bacteria 1547
169 nmdc:mga00v17_17254_c1 3300050491 Bacteria 2998
170 nmdc:mga00v17_177814_c1 3300050491 Archaea 1373
171 nmdc:mga00v17_189073_c1 3300050491 Bacteria 1329
172 nmdc:mga00v17_2773_c1 3300050491 Bacteria 2510
173 nmdc:mga00v17_894_c1 3300050491 Bacteria 16126
174 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
175 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
176 nmdc:mga0k408_12963_c1 3300050493 Bacteria 4564
177 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
178 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
179 nmdc:mga0k408_337_c1 3300050493 Bacteria 25651
180 nmdc:mga0k408_51728_c1 3300050493 Bacteria 2029
181 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
182 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
183 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
184 nmdc:mga07m45_3390_c1 3300050496 Bacteria 6453
185 nmdc:mga08y16_23051_c1 3300050511 Bacteria 6573
186 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
187 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
188 nmdc:mga0sz30_98106_c1 3300050516 Bacteria 1278
189 Ga0500643_000010 3300053087 Bacteria 408084
190 Ga0500643_000038 3300053087 Bacteria 178974
191 Ga0500644_0000555 3300053088 Bacteria 14996
192 Ga0500583_0000137 3300053092 Bacteria 31497
193 Ga0500583_0168173 3300053092 Bacteria 1091
194 Ga0500651_0393360 3300053093 Bacteria 780
195 Ga0500566_0000001 3300053094 Bacteria 1101031
196 Ga0500555_000001 3300053103 Bacteria 1353713
197 Ga0500562_000002 3300053108 Bacteria 977234
198 Ga0500614_000001 3300053123 Bacteria 1274484
199 Ga0500614_002680 3300053123 Bacteria 3934
200 Ga0500561_0000001 3300053137 Bacteria 957685
201 Ga0500577_0007980 3300053142 Bacteria 2995
202 Ga0500589_000016 3300053147 Bacteria 107090
203 Ga0500616_0232489 3300053153 Bacteria 797
204 Ga0500649_000013 3300053722 Bacteria 73694
205 Ga0500611_000287 3300053727 Bacteria 5361
206 Ga0587094_038592 3300059513 Bacteria 769
207 Ga0075364_10132697
208 JGI24736J21556_1019229
209 JGI24741J21665_1000781
210 JGI24740J21852_10023517
211 JGI24737J22298_10000095
212 JGI24735J21928_10042103
213 JGI24742J22300_10000006
214 rootH2_10000244
215 rootH2_10089542
216 rootH2_10107295
217 rootL2_10109217
218 rootH1_10015736
219 rootH1_10219291
220 Ga0065704_10109593
221 Ga0070658_10004138
222 Ga0070658_10006099
223 Ga0070683_100000140
224 Ga0070683_100000657
225 Ga0070683_100183332
226 Ga0070680_100007503
227 Ga0070660_100000454
228 Ga0070692_10091115
229 Ga0070659_100000558
230 Ga0070667_100000001
231 Ga0070663_100668140
232 Ga0070678_100340006
233 Ga0068867_100314422
234 Ga0070679_100041151
235 Ga0070684_100001211
236 Ga0070684_100004041
237 Ga0070684_100018888
238 Ga0070684_100117569
239 Ga0068855_100000003
240 Ga0068855_100000211
241 Ga0068855_100093694
242 Ga0068855_100126687
243 Ga0068855_100814850
244 Ga0068857_100000002
245 Ga0068857_100171667
246 Ga0068857_100917569
247 Ga0068856_100000866
248 Ga0068852_100464400
249 Ga0068860_100025027
250 Ga0081539_10074073
251 Ga0070717_10299295
252 Ga0070717_10501526
253 Ga0075365_10000020
254 Ga0075368_10006658
255 Ga0075363_100000016
256 Ga0075364_10001546
257 Ga0075364_10001845
258 Ga0075364_10025265
259 Ga0075364_10032724
260 Ga0075364_10194566
261 Ga0075364_10212757
262 Ga0075364_10467594
263 Ga0075362_10000073
264 Ga0075367_10000034
265 Ga0075367_10003897
266 Ga0075369_10000005
267 Ga0075369_10000051
268 Ga0075369_10110927
269 Ga0075366_10000001
270 Ga0075366_10000044
271 Ga0075366_10000083
272 Ga0075366_10000684
273 Ga0075366_10059650
274 Ga0097621_100003413
275 Ga0075370_10020582
276 Ga0068871_100000156
277 Ga0105240_10294250
278 Ga0111539_10013550
279 Ga0105245_10000002
280 Ga0105245_10672329
281 Ga0105243_10015378
282 Ga0105241_10000003
283 Ga0105248_11040035
284 Ga0105249_10003576
285 Ga0105030_103307
286 Ga0105028_100187
287 Ga0157373_10000042
288 Ga0157371_10000937
289 Ga0157370_10029349
290 Ga0157370_10115012
291 Ga0157369_10000261
292 Ga0157374_10000031
293 Ga0157374_10089394
294 Ga0157374_10823501
295 Ga0157377_10080312
296 Ga0157377_10193639
297 Ga0157377_10465983
298 Ga0207647_10000458
299 Ga0207705_10001105
300 Ga0207705_10070393
301 Ga0207654_10000002
302 Ga0207695_10209809
303 Ga0207660_10031569
304 Ga0207657_10001246
305 Ga0207652_10019309
306 Ga0207652_10117112
307 Ga0207694_10173984
308 Ga0207687_10000001
309 Ga0207690_10002364
310 Ga0207709_10098338
311 Ga0207661_10000021
312 Ga0207661_10012888
313 Ga0207661_10153026
314 Ga0207667_10000008
315 Ga0207667_10000466
316 Ga0207667_10191363
317 Ga0207712_10002267
318 Ga0207668_10471455
319 Ga0207658_10000003
320 Ga0207678_11022172
321 Ga0207702_10001222
322 Ga0207648_10332566
323 Ga0207674_10000001
324 Ga0207674_10096983
325 Ga0207674_10185553
326 Ga0207674_10724855
327 Ga0207675_100260392
328 Ga0207698_10432522
329 Ga0209813_10000004
330 Ga0207428_10015820
331 Ga0268265_10155749
332 Ga0268264_10057382
333 Ga0265338_10014462
334 Ga0265327_10000017
335 Ga0265327_10000961
336 Ga0373927_0500409
337 Ga0395899_0004607
338 Ga0395900_0055305
339 Ga0395898_0043702
340 Ga0395905_0027294
341 Ga0395901_0014544
342 Ga0495629_0111267
343 Ga0495622_0000082
344 Ga0495588_0000116
345 Ga0495647_0156052
346 Ga0495658_0010755
347 Ga0495649_0000284
348 Ga0495600_0016560
349 Ga0495672_0000129
350 Ga0495593_0037394
351 Ga0496126_0336623
352 Ga0501031_0000163
353 Ga0501032_0025266
354 Ga0501034_0060274
355 Ga0501034_0390869
356 Ga0501036_0004824
357 Ga0501037_0000121
358 Ga0501038_0005584
359 Ga0501042_0187113
360 Ga0501043_0002322
361 Ga0501046_0000138
362 Ga0501046_0226708
363 Ga0501047_0000681
364 Ga0501048_0000361
365 Ga0501070_0012332
366 Ga0501073_0022103
367 Ga0501074_0804095
368 Ga0501035_0000801
369 Ga0501044_0008015
370 nmdc:mga03683_1412_c1
371 nmdc:mga03683_20_c3
372 nmdc:mga03n38_22_c1
373 nmdc:mga00v17_120353_c1
374 nmdc:mga00v17_140683_c1
375 nmdc:mga00v17_17254_c1
376 nmdc:mga00v17_177814_c1
377 nmdc:mga00v17_189073_c1
378 nmdc:mga00v17_2773_c1
379 nmdc:mga00v17_894_c1
380 nmdc:mga0yw44_2_c1
381 nmdc:mga0k408_114_c1
382 nmdc:mga0k408_12963_c1
383 nmdc:mga0k408_17_c2
384 nmdc:mga0k408_1_c1
385 nmdc:mga0k408_337_c1
386 nmdc:mga0k408_51728_c1
387 nmdc:mga06z11_44_c1
388 nmdc:mga06z11_6_c1
389 nmdc:mga04h51_4_c1
390 nmdc:mga07m45_3390_c1
391 nmdc:mga08y16_23051_c1
392 nmdc:mga0sz30_1_c1
393 nmdc:mga0sz30_23_c1
394 nmdc:mga0sz30_98106_c1
395 Ga0500643_000010
396 Ga0500643_000038
397 Ga0500644_0000555
398 Ga0500583_0000137
399 Ga0500583_0168173
400 Ga0500651_0393360
401 Ga0500566_0000001
402 Ga0500555_000001
403 Ga0500562_000002
404 Ga0500614_000001
405 Ga0500614_002680
406 Ga0500561_0000001
407 Ga0500577_0007980
408 Ga0500589_000016
409 Ga0500616_0232489
410 Ga0500649_000013
411 Ga0500611_000287
412 Ga0587094_038592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18306

LDcluster4

SLOG cluster4 family

12

178

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iz5-assembly1.cif.gz_A function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8956 11 185
2iz5-assembly1.cif.gz_C function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.892 11 185
2iz5-assembly1.cif.gz_B function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8914 11 185
2iz6-assembly1.cif.gz_A-2 structure of the chlamydomonas rheinhardtii moco carrier protein 0.8882 10 185
2iz5-assembly1.cif.gz_A function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8801 11 185
ID Description Score Start End Superfamily
2iz7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8711 11 187 3.40.50.450
2iz7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8612 11 187 3.40.50.450
af_I6XEF6_16_197_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8263 10 183 3.40.50.450
1rcuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8254 14 184 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.814 13 182 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A832U3M6-F1-model_v4 TIGR00725 family protein 0.9615 10 186 GO:0005829
AF-A0A2H0TJ05-F1-model_v4 TIGR00725 family protein 0.9612 10 139 GO:0005829
AF-A0A0G0HSY1-F1-model_v4 Uncharacterized protein 0.9592 12 117
AF-A0A0G1Q589-F1-model_v4 TIGR00725 family protein 0.9586 29 188
AF-A0A7V3EV22-F1-model_v4 TIGR00725 family protein 0.9563 10 138 GO:0005829

Map