F315415

General Info

Members Datasets Scaffolds Average Seq Length
206 139 203 388

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0909022|Ga0436361_0909022_871_2145
Length 418
Sequence VGRLLSTVPPSRAIRTAAFGKEEVMDDIWLASALWIGLALAASVLSVWVAVSVALTEIVVGAIAGNVIGLPLAPWVNFLAGFGAILLTFLAGAEIDPLVVRKHFRSSISIGVVGFLAPYAGVLLFARYGAGWPAGISLSTTSVAVVYAVMVETGFNRTEIGKIILAACFVNDLGTVLALGLVFARYDVWLALFAGVTAGTLWLLGKFAPRLLEALGDRVSEPQTKFVALVLLFLGGLASVAGSEAVLPAYLVGMVLAPTFLKDRELPNRMHIVAFTILTPFYFLKAGSLVEAHAVAASAGLIATYLAIKMITKFVGILPLTRVFAFDPREGMYTTLLMSTGLTFGSISALFGLTNHIIDQRQYTILVTAVIGSAVVPTLIAQRWFQPAFKLMEGIDAAPAPVPSSASSPVTGLPNQQR

Samples

Sample ID Description Type Environment
1 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
2 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
3 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
31 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
44 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.49
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 1.46
Rhizoplane 0.97
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1000275 3300003371 Bacteria 4417
2 Ga0070680_100094757 3300005336 Bacteria 2474
3 Ga0070687_100112678 3300005343 Unclassified 1542
4 Ga0070668_100164880 3300005347 Bacteria 1800
5 Ga0070667_100023595 3300005367 Bacteria 5106
6 Ga0070714_100117529 3300005435 Bacteria 2362
7 Ga0070700_100042973 3300005441 Bacteria 2778
8 Ga0070708_100024360 3300005445 Bacteria 5162
9 Ga0070708_100054909 3300005445 Bacteria 3541
10 Ga0070663_100141830 3300005455 Bacteria 1835
11 Ga0070681_10016732 3300005458 Bacteria 7320
12 Ga0070681_10021126 3300005458 Bacteria 6523
13 Ga0070706_100002218 3300005467 Bacteria 19735
14 Ga0070706_100009864 3300005467 Bacteria 8875
15 Ga0070706_100016923 3300005467 Bacteria 6736
16 Ga0070706_100197359 3300005467 Bacteria 1880
17 Ga0070707_100005748 3300005468 Bacteria 11568
18 Ga0070707_100052710 3300005468 Bacteria 3901
19 Ga0070707_100061402 3300005468 Bacteria 3604
20 Ga0070707_100132179 3300005468 Bacteria 2427
21 Ga0070707_100176359 3300005468 Bacteria 2083
22 Ga0070698_100008508 3300005471 Bacteria 11077
23 Ga0070698_100208012 3300005471 Unclassified 1892
24 Ga0070699_100007996 3300005518 Bacteria 9183
25 Ga0070699_100025817 3300005518 Bacteria 5063
26 Ga0070699_100160765 3300005518 Unclassified 1988
27 Ga0070679_100026756 3300005530 Bacteria 5672
28 Ga0070697_100001766 3300005536 Bacteria 16508
29 Ga0070697_100043212 3300005536 Bacteria 3648
30 Ga0070697_100058548 3300005536 Bacteria 3136
31 Ga0070695_100000447 3300005545 Bacteria 21465
32 Ga0070696_100013015 3300005546 Bacteria 5582
33 Ga0068861_100071990 3300005719 Bacteria 2681
34 Ga0070712_100046483 3300006175 Bacteria 3001
35 Ga0075428_100106575 3300006844 Plasmid 3055
36 Ga0075433_10196548 3300006852 Bacteria 1794
37 Ga0075434_100184637 3300006871 Unclassified 2106
38 Ga0099794_10018590 3300007265 Bacteria 3118
39 Ga0111539_10161723 3300009094 Plasmid 2618
40 Ga0114129_10004595 3300009147 Bacteria 19485
41 Ga0114129_10089602 3300009147 Bacteria 4265
42 Ga0114129_10208777 3300009147 Plasmid 2641
43 Ga0114129_10370723 3300009147 Bacteria 1892
44 Ga0123340_1000026 3300009763 Bacteria 46465
45 Ga0123341_1000042 3300009765 Bacteria 58276
46 Ga0157370_10017939 3300013104 Bacteria 7127
47 Ga0157372_10232089 3300013307 Bacteria 2139
48 Ga0163161_10055905 3300017792 Bacteria 2866
49 Ga0213875_10004683 3300021388 Bacteria 7452
50 Ga0207684_10000810 3300025910 Bacteria 36160
51 Ga0207684_10003735 3300025910 Bacteria 14717
52 Ga0207684_10070472 3300025910 Bacteria 2971
53 Ga0207684_10081302 3300025910 Bacteria 2757
54 Ga0207707_10078542 3300025912 Bacteria 2882
55 Ga0207660_10062877 3300025917 Unclassified 2675
56 Ga0207652_10014609 3300025921 Bacteria 6367
57 Ga0207646_10000699 3300025922 Bacteria 43480
58 Ga0207646_10026579 3300025922 Bacteria 5281
59 Ga0207646_10179466 3300025922 Bacteria 1912
60 Ga0207678_10233007 3300026067 Bacteria 1577
61 Ga0207708_10022740 3300026075 Bacteria 4735
62 Ga0265356_1003502 3300028017 Bacteria 1978
63 Ga0265356_1007098 3300028017 Bacteria 1298
64 Ga0265326_10004896 3300028558 Bacteria 4243
65 Ga0265334_10014345 3300028573 Bacteria 3304
66 Ga0265318_10024659 3300028577 Bacteria 2383
67 Ga0265323_10002139 3300028653 Bacteria 9208
68 Ga0265323_10005987 3300028653 Bacteria 5143
69 Ga0265322_10003218 3300028654 Unclassified 4956
70 Ga0265338_10000033 3300028800 Bacteria 251901
71 Ga0265338_10128783 3300028800 Bacteria 2003
72 Ga0265324_10054510 3300029957 Bacteria 1372
73 Ga0265760_10000263 3300031090 Bacteria 14190
74 Ga0265330_10044097 3300031235 Bacteria 1971
75 Ga0265328_10012538 3300031239 Bacteria 3371
76 Ga0265325_10012352 3300031241 Bacteria 4887
77 Ga0265325_10038898 3300031241 Bacteria 2507
78 Ga0265340_10075920 3300031247 Unclassified 1587
79 Ga0265339_10013281 3300031249 Bacteria 4996
80 Ga0265331_10042170 3300031250 Unclassified 2214
81 Ga0265316_10006776 3300031344 Bacteria 10906
82 Ga0265316_10022858 3300031344 Bacteria 5261
83 Ga0265316_10052269 3300031344 Bacteria 3206
84 Ga0265316_10063029 3300031344 Bacteria 2876
85 Ga0307408_100046999 3300031548 Bacteria 3089
86 Ga0265313_10039744 3300031595 Unclassified 2332
87 Ga0265314_10015842 3300031711 Bacteria 5971
88 Ga0265342_10026788 3300031712 Bacteria 3609
89 Ga0265342_10084756 3300031712 Unclassified 1824
90 Ga0373944_0003692 3300035089 Bacteria 3959
91 Ga0373923_0018409 3300035111 Bacteria 2688
92 Ga0373941_0006271 3300035115 Bacteria 2855
93 Ga0373943_0001580 3300035170 Bacteria 10312
94 Ga0373943_0020346 3300035170 Bacteria 3058
95 Ga0373955_0140905 3300035172 Bacteria 1414
96 Ga0373931_0011077 3300035691 Bacteria 4348
97 Ga0373931_0080493 3300035691 Bacteria 1796
98 Ga0373935_0057045 3300035692 Bacteria 2491
99 Ga0373927_0008950 3300035695 Bacteria 6723
100 Ga0373927_0011450 3300035695 Bacteria 5907
101 Ga0373933_0035870 3300035724 Bacteria 2900
102 Ga0373933_0184844 3300035724 Bacteria 1330
103 Ga0373947_0000372 3300035725 Bacteria 25344
104 Ga0373947_0057350 3300035725 Bacteria 2356
105 Ga0373937_0017306 3300036401 Bacteria 6419
106 Ga0373937_0028323 3300036401 Bacteria 5068
107 Ga0373925_0002858 3300037068 Bacteria 13624
108 Ga0373925_0089695 3300037068 Unclassified 2349
109 Ga0436364_0533917 3300037853 Bacteria 9986
110 Ga0436361_0091512 3300039447 Bacteria 1992
111 Ga0436361_0909022 3300039447 Bacteria 2363
112 Ga0436363_0194616 3300039450 Bacteria 1514
113 Ga0439435_0001859 3300042436 Bacteria 4037
114 Ga0439460_0000736 3300042461 Bacteria 7332
115 Ga0495629_0002804 3300046459 Bacteria 13292
116 Ga0495629_0006077 3300046459 Bacteria 8970
117 Ga0495580_0112541 3300046472 Bacteria 1890
118 Ga0495582_0000987 3300046473 Bacteria 15918
119 Ga0495582_0008469 3300046473 Bacteria 5676
120 Ga0495639_0012844 3300046475 Bacteria 3613
121 Ga0495662_0006986 3300046476 Bacteria 5607
122 Ga0495664_0000144 3300046477 Bacteria 35748
123 Ga0495610_0000749 3300046512 Bacteria 30647
124 Ga0495618_0003392 3300046514 Bacteria 9914
125 Ga0495620_0001040 3300046515 Bacteria 17034
126 Ga0495630_0009233 3300046517 Bacteria 7089
127 Ga0495630_0049600 3300046517 Bacteria 3141
128 Ga0495652_0028917 3300046529 Bacteria 4871
129 Ga0495665_0006053 3300046531 Bacteria 6525
130 Ga0495665_0022800 3300046531 Bacteria 3363
131 Ga0495640_0027521 3300046533 Bacteria 4099
132 Ga0495640_0077604 3300046533 Bacteria 2214
133 Ga0495645_0002881 3300046543 Bacteria 11681
134 Ga0495667_0191420 3300046559 Bacteria 1311
135 Ga0495634_0002694 3300046642 Bacteria 14601
136 Ga0495634_0004110 3300046642 Bacteria 11526
137 Ga0495634_0050255 3300046642 Bacteria 2801
138 Ga0495635_0001658 3300046663 Bacteria 14993
139 Ga0495635_0021489 3300046663 Bacteria 4499
140 Ga0495658_0002002 3300046683 Bacteria 10378
141 Ga0495658_0027653 3300046683 Bacteria 3054
142 Ga0495658_0066823 3300046683 Bacteria 2078
143 Ga0495613_0004124 3300046689 Bacteria 10870
144 Ga0495613_0139079 3300046689 Bacteria 1736
145 Ga0495624_0004176 3300046690 Bacteria 10614
146 Ga0495624_0018362 3300046690 Bacteria 4677
147 Ga0495581_0009267 3300047315 Bacteria 5697
148 Ga0495581_0016504 3300047315 Bacteria 4291
149 Ga0495636_0036257 3300047318 Bacteria 2033
150 Ga0495674_0000899 3300047319 Bacteria 28421
151 Ga0495676_0025323 3300047321 Bacteria 5125
152 Ga0495676_0133049 3300047321 Bacteria 1792
153 Ga0495684_0002131 3300047471 Bacteria 15891
154 Ga0495684_0003351 3300047471 Bacteria 12580
155 Ga0495684_0005336 3300047471 Bacteria 10006
156 Ga0495593_0055533 3300047673 Bacteria 2084
157 Ga0495602_0099686 3300048088 Bacteria 2388
158 Ga0496102_0227017 3300048905 Bacteria 1761
159 Ga0496112_0133424 3300048915 Bacteria 2454
160 Ga0501031_0204657 3300049568 Unclassified 1287
161 Ga0501036_0060331 3300049572 Bacteria 3213
162 Ga0501036_0115110 3300049572 Bacteria 2272
163 Ga0501037_0173818 3300049573 Bacteria 1530
164 Ga0501039_0033687 3300049575 Bacteria 3951
165 Ga0501039_0092880 3300049575 Bacteria 2352
166 Ga0501039_0110819 3300049575 Bacteria 2145
167 Ga0501039_0140795 3300049575 Bacteria 1895
168 Ga0501041_0023056 3300049577 Bacteria 3731
169 Ga0501041_0086335 3300049577 Unclassified 1936
170 Ga0501046_0089843 3300049580 Unclassified 2364
171 Ga0501046_0161852 3300049580 Unclassified 1683
172 Ga0501047_0171627 3300049581 Bacteria 2037
173 Ga0501048_0067029 3300049582 Unclassified 2538
174 Ga0501068_0129973 3300049584 Unclassified 1575
175 Ga0501072_0003089 3300049588 Bacteria 12553
176 Ga0501072_0093686 3300049588 Bacteria 2386
177 Ga0501074_0193640 3300049590 Bacteria 1449
178 Ga0501075_0013718 3300049591 Bacteria 5791
179 Ga0501075_0099597 3300049591 Bacteria 2207
180 Ga0501076_0026870 3300049592 Bacteria 4461
181 Ga0501076_0104785 3300049592 Bacteria 2282
182 Ga0501077_0018200 3300049593 Bacteria 4443
183 Ga0501079_0010357 3300049741 Bacteria 7086
184 Ga0501081_0001526 3300049743 Bacteria 14211
185 Ga0501081_0031851 3300049743 Bacteria 3574
186 Ga0501083_0022405 3300049744 Bacteria 4385
187 Ga0501044_0220168 3300049823 Bacteria 1849
188 Ga0501045_0061918 3300049824 Bacteria 2746
189 nmdc:mga05p37_12241_c1 3300050507 Bacteria 10243
190 nmdc:mga05p37_262413_c1 3300050507 Unclassified 2067
191 nmdc:mga08x19_42795_c1 3300050514 Bacteria 2888
192 nmdc:mga0a205_213820_c1 3300050515 Bacteria 1815
193 Ga0495601_0001757 3300053077 Bacteria 11999
194 Ga0495601_0080726 3300053077 Unclassified 2087
195 Ga0495601_0221847 3300053077 Bacteria 1235
196 Ga0495612_0001985 3300053078 Bacteria 8424
197 Ga0495595_0035338 3300053084 Unclassified 2264
198 Ga0495619_0000587 3300053085 Bacteria 24241
199 Ga0500568_0021837 3300053139 Bacteria 2748
200 Ga0500616_0030190 3300053153 Bacteria 2978
201 Ga0501084_0012661 3300054114 Bacteria 6990
202 Ga0501082_0013058 3300060353 Bacteria 7138
203 Ga0530510_0000436 3300061734 Bacteria 26911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0220168 Ga0501044_0220168_905_1831 306
2 3300031344 Ga0265316_10063029 Ga0265316_100630293 328
3 3300053077 Ga0495601_0080726 Ga0495601_0080726_925_2016 335
4 3300029957 Ga0265324_10054510 Ga0265324_100545101 340
5 3300005467 Ga0070706_100016923 Ga0070706_1000169238 342
6 3300025910 Ga0207684_10070472 Ga0207684_100704721 342
7 3300028800 Ga0265338_10128783 Ga0265338_101287832 344
8 3300005468 Ga0070707_100005748 Ga0070707_10000574812 348
9 3300025922 Ga0207646_10026579 Ga0207646_100265793 348
10 3300031712 Ga0265342_10084756 Ga0265342_100847562 349
11 3300028017 Ga0265356_1003502 Ga0265356_10035022 350
12 3300031090 Ga0265760_10000263 Ga0265760_1000026316 350
13 3300009147 Ga0114129_10370723 Ga0114129_103707233 356
14 3300005347 Ga0070668_100164880 Ga0070668_1001648802 357
15 3300005441 Ga0070700_100042973 Ga0070700_1000429732 357
16 3300005455 Ga0070663_100141830 Ga0070663_1001418301 357
17 3300005545 Ga0070695_100000447 Ga0070695_10000044710 357
18 3300005719 Ga0068861_100071990 Ga0068861_1000719902 357
19 3300026067 Ga0207678_10233007 Ga0207678_102330071 357
20 3300026075 Ga0207708_10022740 Ga0207708_100227405 357
21 3300035115 Ga0373941_0006271 Ga0373941_0006271_164_1315 357
22 3300035691 Ga0373931_0011077 Ga0373931_0011077_2211_3362 357
23 3300005468 Ga0070707_100052710 Ga0070707_1000527106 359
24 3300005518 Ga0070699_100007996 Ga0070699_1000079966 359
25 3300005536 Ga0070697_100058548 Ga0070697_1000585485 359
26 3300005546 Ga0070696_100013015 Ga0070696_1000130154 359
27 3300017792 Ga0163161_10055905 Ga0163161_100559053 360
28 3300009147 Ga0114129_10004595 Ga0114129_100045955 361
29 3300046689 Ga0495613_0139079 Ga0495613_0139079_176_1381 361
30 3300050507 nmdc:mga05p37_12241_c1 nmdc:mga05p37_12241_c1_7495_8634 361
31 3300050514 nmdc:mga08x19_42795_c1 nmdc:mga08x19_42795_c1_925_2064 361
32 3300013307 Ga0157372_10232089 Ga0157372_102320892 363
33 3300049581 Ga0501047_0171627 Ga0501047_0171627_160_1335 365
34 3300031249 Ga0265339_10013281 Ga0265339_100132813 367
35 3300046473 Ga0495582_0008469 Ga0495582_0008469_17_1126 367
36 3300028017 Ga0265356_1007098 Ga0265356_10070981 370
37 3300009147 Ga0114129_10089602 Ga0114129_100896023 371
38 3300031241 Ga0265325_10012352 Ga0265325_100123522 372
39 3300005336 Ga0070680_100094757 Ga0070680_1000947572 373
40 3300005458 Ga0070681_10016732 Ga0070681_100167325 373
41 3300005530 Ga0070679_100026756 Ga0070679_1000267565 373
42 3300013104 Ga0157370_10017939 Ga0157370_100179395 373
43 3300025912 Ga0207707_10078542 Ga0207707_100785421 373
44 3300025917 Ga0207660_10062877 Ga0207660_100628771 373
45 3300025921 Ga0207652_10014609 Ga0207652_100146093 373
46 3300028558 Ga0265326_10004896 Ga0265326_100048965 373
47 3300028573 Ga0265334_10014345 Ga0265334_100143452 373
48 3300028577 Ga0265318_10024659 Ga0265318_100246592 373
49 3300031241 Ga0265325_10038898 Ga0265325_100388982 373
50 3300031247 Ga0265340_10075920 Ga0265340_100759201 373
51 3300031344 Ga0265316_10022858 Ga0265316_100228582 373
52 3300031595 Ga0265313_10039744 Ga0265313_100397442 373
53 3300031711 Ga0265314_10015842 Ga0265314_100158424 373
54 3300031712 Ga0265342_10026788 Ga0265342_100267882 373
55 3300035691 Ga0373931_0080493 Ga0373931_0080493_425_1588 373
56 iso_pu_bacteria 2923556063 2923561604 375
57 3300021388 Ga0213875_10004683 Ga0213875_100046834 377
58 3300037853 Ga0436364_0533917 Ga0436364_0533917_5092_6261 377
59 3300046683 Ga0495658_0027653 Ga0495658_0027653_864_2039 377
60 3300031235 Ga0265330_10044097 Ga0265330_100440973 379
61 3300031548 Ga0307408_100046999 Ga0307408_1000469992 379
62 3300007265 Ga0099794_10018590 Ga0099794_100185903 380
63 3300049572 Ga0501036_0060331 Ga0501036_0060331_1109_2302 380
64 3300049577 Ga0501041_0023056 Ga0501041_0023056_1826_3019 380
65 3300049588 Ga0501072_0003089 Ga0501072_0003089_2373_3566 380
66 3300049591 Ga0501075_0013718 Ga0501075_0013718_1302_2495 380
67 3300049592 Ga0501076_0026870 Ga0501076_0026870_2616_3809 380
68 3300049593 Ga0501077_0018200 Ga0501077_0018200_1014_2207 380
69 3300049741 Ga0501079_0010357 Ga0501079_0010357_2917_4110 380
70 3300049743 Ga0501081_0001526 Ga0501081_0001526_393_1586 380
71 3300049824 Ga0501045_0061918 Ga0501045_0061918_353_1546 380
72 3300060353 Ga0501082_0013058 Ga0501082_0013058_983_2176 380
73 3300061734 Ga0530510_0000436 Ga0530510_0000436_16113_17306 380
74 3300047318 Ga0495636_0036257 Ga0495636_0036257_534_1700 381
75 3300053139 Ga0500568_0021837 Ga0500568_0021837_387_1553 381
76 3300053153 Ga0500616_0030190 Ga0500616_0030190_1252_2418 381
77 iso_pu_bacteria 2852387548 2852394601 381
78 3300042436 Ga0439435_0001859 Ga0439435_0001859_1895_3085 382
79 3300042461 Ga0439460_0000736 Ga0439460_0000736_4204_5394 382
80 iso_pu_bacteria 2881161766 2881163486 382
81 3300005343 Ga0070687_100112678 Ga0070687_1001126782 383
82 3300005367 Ga0070667_100023595 Ga0070667_1000235953 383
83 3300005445 Ga0070708_100024360 Ga0070708_1000243603 384
84 3300005467 Ga0070706_100002218 Ga0070706_1000022185 384
85 3300005467 Ga0070706_100009864 Ga0070706_1000098644 384
86 3300005468 Ga0070707_100176359 Ga0070707_1001763592 384
87 3300005471 Ga0070698_100008508 Ga0070698_10000850814 384
88 3300005518 Ga0070699_100025817 Ga0070699_1000258174 384
89 3300005518 Ga0070699_100160765 Ga0070699_1001607651 384
90 3300005536 Ga0070697_100001766 Ga0070697_1000017667 384
91 3300005536 Ga0070697_100043212 Ga0070697_1000432122 384
92 3300025910 Ga0207684_10000810 Ga0207684_1000081018 384
93 3300025910 Ga0207684_10003735 Ga0207684_1000373521 384
94 3300025922 Ga0207646_10000699 Ga0207646_1000069930 384
95 3300046533 Ga0495640_0077604 Ga0495640_0077604_73_1272 384
96 3300009763 Ga0123340_1000026 Ga0123340_100002633 386
97 3300009765 Ga0123341_1000042 Ga0123341_100004223 386
98 3300031344 Ga0265316_10052269 Ga0265316_100522693 386
99 3300046515 Ga0495620_0001040 Ga0495620_0001040_3658_4824 386
100 3300050515 nmdc:mga0a205_213820_c1 nmdc:mga0a205_213820_c1_550_1713 386
101 3300005435 Ga0070714_100117529 Ga0070714_1001175292 387
102 3300039447 Ga0436361_0909022 Ga0436361_0909022_871_2145 387
103 3300046472 Ga0495580_0112541 Ga0495580_0112541_659_1855 387
104 3300046683 Ga0495658_0066823 Ga0495658_0066823_859_2055 387
105 3300047321 Ga0495676_0133049 Ga0495676_0133049_19_1215 387
106 3300005445 Ga0070708_100054909 Ga0070708_1000549094 388
107 3300005467 Ga0070706_100197359 Ga0070706_1001973591 388
108 3300005468 Ga0070707_100132179 Ga0070707_1001321792 388
109 3300025910 Ga0207684_10081302 Ga0207684_100813023 388
110 3300025922 Ga0207646_10179466 Ga0207646_101794663 388
111 3300035725 Ga0373947_0057350 Ga0373947_0057350_964_2157 389
112 3300037068 Ga0373925_0089695 Ga0373925_0089695_164_1357 389
113 3300039450 Ga0436363_0194616 Ga0436363_0194616_231_1403 389
114 3300046459 Ga0495629_0002804 Ga0495629_0002804_3070_4263 389
115 3300046473 Ga0495582_0000987 Ga0495582_0000987_13064_14257 389
116 3300046475 Ga0495639_0012844 Ga0495639_0012844_1143_2336 389
117 3300046512 Ga0495610_0000749 Ga0495610_0000749_9108_10298 389
118 3300046531 Ga0495665_0022800 Ga0495665_0022800_579_1772 389
119 3300046683 Ga0495658_0002002 Ga0495658_0002002_7842_9035 389
120 3300046689 Ga0495613_0004124 Ga0495613_0004124_3123_4316 389
121 3300047315 Ga0495581_0009267 Ga0495581_0009267_1472_2665 389
122 3300047321 Ga0495676_0025323 Ga0495676_0025323_1798_2991 389
123 3300047673 Ga0495593_0055533 Ga0495593_0055533_473_1666 389
124 3300005471 Ga0070698_100208012 Ga0070698_1002080121 390
125 3300035172 Ga0373955_0140905 Ga0373955_0140905_92_1270 390
126 3300035724 Ga0373933_0184844 Ga0373933_0184844_69_1247 390
127 3300036401 Ga0373937_0017306 Ga0373937_0017306_5222_6400 390
128 3300053077 Ga0495601_0221847 Ga0495601_0221847_22_1200 390
129 3300006844 Ga0075428_100106575 Ga0075428_1001065752 391
130 3300006852 Ga0075433_10196548 Ga0075433_101965481 391
131 3300006871 Ga0075434_100184637 Ga0075434_1001846372 391
132 3300009094 Ga0111539_10161723 Ga0111539_101617231 391
133 3300009147 Ga0114129_10208777 Ga0114129_102087774 391
134 3300046531 Ga0495665_0006053 Ga0495665_0006053_4642_5880 391
135 3300046559 Ga0495667_0191420 Ga0495667_0191420_50_1252 391
136 3300046642 Ga0495634_0004110 Ga0495634_0004110_3772_5010 391
137 3300047471 Ga0495684_0005336 Ga0495684_0005336_4163_5401 391
138 3300048088 Ga0495602_0099686 Ga0495602_0099686_372_1574 391
139 3300048905 Ga0496102_0227017 Ga0496102_0227017_326_1507 391
140 3300048915 Ga0496112_0133424 Ga0496112_0133424_1052_2233 391
141 3300050507 nmdc:mga05p37_262413_c1 nmdc:mga05p37_262413_c1_434_1615 391
142 3300039447 Ga0436361_0091512 Ga0436361_0091512_57_1241 392
143 3300031344 Ga0265316_10006776 Ga0265316_100067761 393
144 3300049575 Ga0501039_0140795 Ga0501039_0140795_153_1355 393
145 3300035724 Ga0373933_0035870 Ga0373933_0035870_184_1380 394
146 3300036401 Ga0373937_0028323 Ga0373937_0028323_1299_2495 394
147 3300049575 Ga0501039_0092880 Ga0501039_0092880_838_2028 394
148 3300031239 Ga0265328_10012538 Ga0265328_100125383 395
149 3300028653 Ga0265323_10005987 Ga0265323_100059875 397
150 3300031250 Ga0265331_10042170 Ga0265331_100421701 398
151 3300049573 Ga0501037_0173818 Ga0501037_0173818_16_1215 399
152 3300049575 Ga0501039_0110819 Ga0501039_0110819_762_1961 399
153 3300049577 Ga0501041_0086335 Ga0501041_0086335_139_1338 399
154 3300049580 Ga0501046_0089843 Ga0501046_0089843_834_2033 399
155 3300049582 Ga0501048_0067029 Ga0501048_0067029_1261_2460 399
156 3300005458 Ga0070681_10021126 Ga0070681_100211263 400
157 3300006175 Ga0070712_100046483 Ga0070712_1000464834 400
158 3300028653 Ga0265323_10002139 Ga0265323_100021393 400
159 3300028654 Ga0265322_10003218 Ga0265322_100032182 400
160 3300028800 Ga0265338_10000033 Ga0265338_10000033159 400
161 3300035089 Ga0373944_0003692 Ga0373944_0003692_1435_2670 400
162 3300035111 Ga0373923_0018409 Ga0373923_0018409_1300_2541 400
163 3300035170 Ga0373943_0001580 Ga0373943_0001580_104_1339 400
164 3300035170 Ga0373943_0020346 Ga0373943_0020346_370_1614 400
165 3300035692 Ga0373935_0057045 Ga0373935_0057045_975_2219 400
166 3300035695 Ga0373927_0008950 Ga0373927_0008950_3640_4875 400
167 3300035695 Ga0373927_0011450 Ga0373927_0011450_2957_4201 400
168 3300035725 Ga0373947_0000372 Ga0373947_0000372_14421_15656 400
169 3300037068 Ga0373925_0002858 Ga0373925_0002858_9595_10830 400
170 3300046459 Ga0495629_0006077 Ga0495629_0006077_243_1487 400
171 3300046476 Ga0495662_0006986 Ga0495662_0006986_3877_5121 400
172 3300046477 Ga0495664_0000144 Ga0495664_0000144_28184_29428 400
173 3300046514 Ga0495618_0003392 Ga0495618_0003392_2350_3594 400
174 3300046517 Ga0495630_0009233 Ga0495630_0009233_758_1993 400
175 3300046517 Ga0495630_0049600 Ga0495630_0049600_975_2219 400
176 3300046529 Ga0495652_0028917 Ga0495652_0028917_2381_3625 400
177 3300046533 Ga0495640_0027521 Ga0495640_0027521_1236_2471 400
178 3300046543 Ga0495645_0002881 Ga0495645_0002881_10324_11568 400
179 3300046642 Ga0495634_0002694 Ga0495634_0002694_10886_12130 400
180 3300046642 Ga0495634_0050255 Ga0495634_0050255_371_1606 400
181 3300046663 Ga0495635_0001658 Ga0495635_0001658_10037_11281 400
182 3300046663 Ga0495635_0021489 Ga0495635_0021489_1913_3148 400
183 3300046690 Ga0495624_0004176 Ga0495624_0004176_9143_10378 400
184 3300046690 Ga0495624_0018362 Ga0495624_0018362_2867_4108 400
185 3300047315 Ga0495581_0016504 Ga0495581_0016504_1521_2756 400
186 3300047319 Ga0495674_0000899 Ga0495674_0000899_18514_19758 400
187 3300047471 Ga0495684_0002131 Ga0495684_0002131_6292_7527 400
188 3300047471 Ga0495684_0003351 Ga0495684_0003351_3673_4917 400
189 3300049568 Ga0501031_0204657 Ga0501031_0204657_47_1249 400
190 3300049572 Ga0501036_0115110 Ga0501036_0115110_791_1993 400
191 3300049575 Ga0501039_0033687 Ga0501039_0033687_915_2117 400
192 3300049580 Ga0501046_0161852 Ga0501046_0161852_103_1305 400
193 3300049584 Ga0501068_0129973 Ga0501068_0129973_305_1507 400
194 3300049588 Ga0501072_0093686 Ga0501072_0093686_166_1368 400
195 3300049590 Ga0501074_0193640 Ga0501074_0193640_146_1348 400
196 3300049591 Ga0501075_0099597 Ga0501075_0099597_67_1269 400
197 3300049592 Ga0501076_0104785 Ga0501076_0104785_900_2102 400
198 3300049743 Ga0501081_0031851 Ga0501081_0031851_248_1450 400
199 3300049744 Ga0501083_0022405 Ga0501083_0022405_1183_2385 400
200 3300053077 Ga0495601_0001757 Ga0495601_0001757_2776_4020 400
201 3300053078 Ga0495612_0001985 Ga0495612_0001985_1397_2641 400
202 3300053084 Ga0495595_0035338 Ga0495595_0035338_342_1586 400
203 3300053085 Ga0495619_0000587 Ga0495619_0000587_11206_12450 400
204 3300054114 Ga0501084_0012661 Ga0501084_0012661_174_1376 400
205 3300003371 JGI26145J50221_1000275 JGI26145J50221_10002755 401
206 3300005468 Ga0070707_100061402 Ga0070707_1000614024 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

30

386

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.8045 1 379
8hya-assembly1.cif.gz_A cryo-em structure of arabidopsis thaliana sos1 in an occluded state, with expanded tmd 0.801 7 371
8jd9-assembly1.cif.gz_A cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class1 0.7989 7 381
8pd3-assembly1.cif.gz_A ligand-free spslc9c1 in lipid nanodiscs, protomer state 2 0.7888 1 372
8pd5-assembly1.cif.gz_A ligand-free spslc9c1 in lipid nanodiscs, protomer state 3 0.7877 2 372
ID Description Score Start End Superfamily
af_Q9P7I1_23_428_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8742 5 372 1.20.1530.20
af_Q54GC7_13_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.874 5 372 1.20.1530.20
af_Q9SA37_20_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8598 5 371 1.20.1530.20
af_I1LYU2_28_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8556 5 371 1.20.1530.20
af_Q58671_3_387_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8525 5 381 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A7C1IE06-F1-model_v4 Cation:proton antiporter 0.9912 1 384 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A7V0YGG6-F1-model_v4 Cation:proton antiporter 0.9906 1 384 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A1G3QLS2-F1-model_v4 Potassium transporter Kef 0.9887 1 379 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A430R2V0-F1-model_v4 Potassium transporter Kef 0.9882 4 381 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A7V3RY27-F1-model_v4 Cation:proton antiporter 0.987 1 349 GO:0006814
GO:0015297
GO:0016020
GO:1902600

Feature Viewer

pLDDT pTM Quality
86.65 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map