F316845

General Info

Members Datasets Scaffolds Average Seq Length
207 158 189 195

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0326913|Ga0451576_0326913_707_1405
Length 232
Sequence MPNVKKETLQFIYSPRLRGANISNCSPHILTFAHQKQKMKIEESVQKRSEGKCELCTSTNGMQVYEVQPQDNRYEENCIMLCNKCVAQIDKKEELDSNHWNVLTQAMWSEVPAVQVIAWRMLNRLRNESWAADALDMLYLDDENLAWAKATGDHEASASVDLHKDAYGAVLQNGDTVVLTKSLDVKGSTVNARLGTVIRNIRLVADNTEQIEGRIEGQLIVILTKYVRKQGS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
8 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
9 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
10 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
11 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
12 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
13 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
17 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
18 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
19 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
77 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
78 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
79 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
80 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
81 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
111 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
112 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
113 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
116 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
117 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
118 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
119 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
120 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
121 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
122 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
123 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
126 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
127 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
128 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
132 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
133 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
134 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
135 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
136 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
157 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
158 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.82
Metatranscriptomes 0
Isolates 9.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 1.93
Rhizoplane 1.45
Rhizosphere 68.12
Stem 0
Stem Tuber 0
Unclassified 12.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_538870 2162886007 Bacteria 44374
2 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
3 rootH1_10059264 3300003316 Bacteria 4094
4 rootH1_10059264 3300003323 Bacteria 2288
5 rootH2_10189437 3300003320 Bacteria 1435
6 rootL2_10028084 3300003322 Bacteria 1507
7 rootL2_10040595 3300003322 Bacteria 6527
8 rootH1_10352724 3300003323 Bacteria 1683
9 Ga0065714_10002466 3300005288 Bacteria 16730
10 Ga0065714_10196302 3300005288 Bacteria 910
11 Ga0065704_10000326 3300005289 Bacteria 76230
12 Ga0065704_10070133 3300005289 Bacteria 1266035
13 Ga0065704_10137229 3300005289 Bacteria 1557
14 Ga0065715_10365521 3300005293 Bacteria 929
15 Ga0070683_100984454 3300005329 Unclassified 809
16 Ga0070682_100000071 3300005337 Bacteria 94177
17 Ga0070688_100614549 3300005365 Bacteria 833
18 Ga0068853_100160481 3300005539 Bacteria 2029
19 Ga0068855_100043596 3300005563 Bacteria 5314
20 Ga0068857_100099901 3300005577 Bacteria 2603
21 Ga0068857_100340358 3300005577 Bacteria 1388
22 Ga0068863_101015556 3300005841 Bacteria 832
23 Ga0068862_100484772 3300005844 Unclassified 1171
24 Ga0097621_100394183 3300006237 Bacteria 1238
25 Ga0099824_1018108 3300006942 Bacteria 5878
26 Ga0099826_10009280 3300006948 Bacteria 7346
27 Ga0105240_10000749 3300009093 Bacteria 59267
28 Ga0105245_10411483 3300009098 Unclassified 1354
29 Ga0105241_10086383 3300009174 Unclassified 2467
30 Ga0105241_10116693 3300009174 Unclassified 2144
31 Ga0105237_10002069 3300009545 Bacteria 25437
32 Ga0105237_10007167 3300009545 Bacteria 12250
33 Ga0105237_10011408 3300009545 Bacteria 9401
34 Ga0105237_11101302 3300009545 Bacteria 801
35 Ga0105238_10003635 3300009551 Bacteria 15374
36 Ga0105239_10002749 3300010375 Bacteria 22104
37 Ga0105239_10302877 3300010375 Bacteria 1800
38 Ga0157373_10000378 3300013100 Bacteria 35689
39 Ga0157373_10365113 3300013100 Bacteria 1031
40 Ga0157371_10001012 3300013102 Bacteria 30988
41 Ga0157371_10134222 3300013102 Bacteria 1762
42 Ga0157371_10149383 3300013102 Bacteria 1666
43 Ga0157370_10000346 3300013104 Bacteria 58734
44 Ga0157370_10006129 3300013104 Bacteria 13343
45 Ga0157370_10008185 3300013104 Bacteria 11301
46 Ga0157370_10042973 3300013104 Bacteria 4352
47 Ga0157370_10047909 3300013104 Bacteria 4095
48 Ga0157374_10062258 3300013296 Bacteria 3497
49 Ga0157378_10005475 3300013297 Bacteria 11124
50 Ga0163162_10006177 3300013306 Bacteria 11607
51 Ga0163162_10419676 3300013306 Bacteria 1470
52 Ga0157372_10191267 3300013307 Bacteria 2370
53 Ga0157372_10380593 3300013307 Unclassified 1644
54 Ga0157372_10444167 3300013307 Bacteria 1512
55 Ga0157372_10569214 3300013307 Bacteria 1321
56 Ga0157375_10283201 3300013308 Bacteria 1821
57 Ga0182008_10000069 3300014497 Bacteria 82281
58 Ga0182008_10000980 3300014497 Bacteria 19812
59 Ga0157379_10124694 3300014968 Bacteria 2317
60 Ga0182006_1002675 3300015261 Bacteria 9595
61 Ga0182006_1005077 3300015261 Bacteria 6327
62 Ga0163161_10002196 3300017792 Bacteria 14085
63 Ga0163161_10011215 3300017792 Bacteria 6209
64 Ga0163161_10040981 3300017792 Bacteria 3327
65 Ga0163161_10306981 3300017792 Bacteria 1251
66 Ga0209436_100802 3300025208 Bacteria 12861
67 Ga0209258_100252 3300025242 Bacteria 97179
68 Ga0209646_1003135 3300025246 Bacteria 3348
69 Ga0209148_1000217 3300025254 Bacteria 98076
70 Ga0209130_1002251 3300025284 Bacteria 10019
71 Ga0207426_1000234 3300025302 Bacteria 126926
72 Ga0207654_10133769 3300025911 Viruses 1573
73 Ga0207695_10000631 3300025913 Bacteria 70572
74 Ga0207671_10007195 3300025914 Bacteria 9697
75 Ga0207671_10011635 3300025914 Bacteria 7141
76 Ga0207671_10031501 3300025914 Bacteria 3951
77 Ga0207671_10063709 3300025914 Unclassified 2740
78 Ga0207681_10500812 3300025923 Bacteria 994
79 Ga0207694_10107218 3300025924 Unclassified 2219
80 Ga0207667_10033242 3300025949 Bacteria 5548
81 Ga0207639_10683280 3300026041 Bacteria 951
82 Ga0207641_10089587 3300026088 Bacteria 2689
83 Ga0207674_10119500 3300026116 Bacteria 2604
84 Ga0207674_10152896 3300026116 Bacteria 2264
85 Ga0209489_119498 3300027361 Bacteria 2245
86 Ga0209282_1080073 3300027666 Bacteria 1748
87 Ga0268265_10362887 3300028380 Unclassified 1327
88 Ga0265324_10042518 3300029957 Bacteria 1570
89 Ga0307511_10001086 3300030521 Bacteria 28895
90 Ga0316177_1132099 3300030731 Bacteria 12379
91 Ga0316176_1130428 3300030732 Bacteria 18138
92 Ga0314311_1208232 3300030733 Bacteria 1004
93 Ga0316183_1151794 3300030742 Bacteria 80156
94 Ga0316181_1042593 3300030744 Bacteria 8867
95 Ga0316182_1161433 3300030745 Bacteria 1978
96 Ga0265327_10000111 3300031251 Bacteria 177959
97 Ga0265327_10117451 3300031251 Bacteria 1264
98 Ga0307513_10128219 3300031456 Bacteria 2487
99 Ga0307513_10677967 3300031456 Bacteria 737
100 Ga0307509_10051023 3300031507 Bacteria 4427
101 Ga0307406_10259963 3300031901 Bacteria 1313
102 Ga0307412_10000004 3300031911 Bacteria 544053
103 Ga0307414_10001573 3300032004 Bacteria 11860
104 Ga0307414_10030086 3300032004 Bacteria 3543
105 Ga0307414_10239401 3300032004 Bacteria 1501
106 Ga0307414_10756608 3300032004 Unclassified 883
107 Ga0307411_10742549 3300032005 Bacteria 859
108 Ga0451793_1024013 3300041452 Bacteria 802
109 Ga0451800_0145190 3300041459 Unclassified 1428
110 Ga0451807_1152766 3300041486 Unclassified 1314
111 Ga0451833_0676361 3300041491 Unclassified 958
112 Ga0451851_1306669 3300041507 Unclassified 768
113 Ga0451855_1933770 3300041511 Bacteria 940
114 Ga0439445_0013342 3300042004 Bacteria 1988
115 Ga0466964_0041318 3300044706 Unclassified 1865
116 Ga0466957_0127360 3300044842 Bacteria 1628
117 Ga0451576_0000022 3300045051 Bacteria 495037
118 Ga0451576_0326913 3300045051 Bacteria 1605
119 Ga0495627_039905 3300046453 Bacteria 1447
120 Ga0495607_0063966 3300046501 Bacteria 2079
121 Ga0495607_0143794 3300046501 Bacteria 1228
122 Ga0495610_0101741 3300046512 Bacteria 1286
123 Ga0495643_0034108 3300046522 Bacteria 2810
124 Ga0495633_0000450 3300046558 Bacteria 42356
125 Ga0495668_0000138 3300046616 Bacteria 109654
126 Ga0495668_0001819 3300046616 Bacteria 19357
127 Ga0495625_0012581 3300046660 Bacteria 6850
128 Ga0496121_0477431 3300048924 Bacteria 797
129 Ga0496122_0001909 3300048925 Bacteria 31508
130 Ga0496125_0001400 3300048928 Bacteria 35266
131 Ga0501034_0082836 3300049571 Bacteria 3210
132 Ga0501201_009716 3300049651 Bacteria 937
133 Ga0501202_006131 3300049652 Bacteria 2144
134 Ga0501207_033902 3300049654 Bacteria 868
135 Ga0501211_006145 3300049658 Bacteria 1192
136 Ga0501217_018527 3300049661 Bacteria 1617
137 Ga0501222_024408 3300049662 Bacteria 817
138 Ga0501223_042839 3300049663 Bacteria 878
139 Ga0501227_085719 3300049665 Bacteria 829
140 Ga0501230_075044 3300049667 Bacteria 701
141 Ga0501242_020021 3300049674 Bacteria 858
142 Ga0501243_025559 3300049675 Bacteria 991
143 Ga0501250_019826 3300049680 Unclassified 862
144 Ga0501251_000805 3300049681 Bacteria 2852
145 Ga0501253_047075 3300049683 Bacteria 891
146 Ga0501257_026582 3300049686 Bacteria 1382
147 Ga0501259_002163 3300049688 Bacteria 3223
148 Ga0501261_022527 3300049690 Bacteria 912
149 Ga0501219_000031 3300049703 Bacteria 22607
150 Ga0501221_003811 3300049704 Bacteria 2489
151 Ga0501225_0061495 3300049705 Bacteria 1057
152 Ga0501245_043927 3300049708 Bacteria 775
153 Ga0501241_001866 3300049758 Bacteria 4146
154 Ga0501241_015375 3300049758 Bacteria 1392
155 Ga0501266_001494 3300049763 Bacteria 2979
156 Ga0501268_023342 3300049765 Bacteria 1073
157 Ga0501269_001958 3300049766 Bacteria 2601
158 Ga0501271_005361 3300049768 Bacteria 1246
159 Ga0501284_00025 3300050005 Bacteria 76385
160 nmdc:mga05p37_27568_c1 3300050507 Bacteria 6916
161 Ga0500578_0021108 3300053086 Bacteria 4186
162 Ga0500644_0000163 3300053088 Bacteria 42053
163 Ga0500644_0006528 3300053088 Bacteria 2995
164 Ga0500646_0003320 3300053090 Bacteria 4133
165 Ga0500646_0089906 3300053090 Bacteria 949
166 Ga0500646_0159916 3300053090 Unclassified 751
167 Ga0500646_0223477 3300053090 Bacteria 654
168 Ga0500583_0000087 3300053092 Bacteria 51328
169 Ga0500583_0017186 3300053092 Unclassified 2907
170 Ga0500651_0000812 3300053093 Bacteria 15264
171 Ga0500651_0030202 3300053093 Bacteria 3409
172 Ga0500641_0000296 3300053096 Bacteria 18642
173 Ga0500562_000006 3300053108 Bacteria 249231
174 Ga0500652_044001 3300053131 Bacteria 1807
175 Ga0500658_0126665 3300053134 Bacteria 1136
176 Ga0500568_0058165 3300053139 Bacteria 1503
177 Ga0500573_0049059 3300053140 Bacteria 2430
178 Ga0500603_016719 3300053150 Bacteria 1745
179 Ga0500616_0003690 3300053153 Bacteria 11475
180 Ga0500616_0051817 3300053153 Bacteria 2161
181 Ga0500622_0005071 3300053156 Bacteria 8013
182 Ga0500622_0080011 3300053156 Bacteria 1637
183 Ga0500627_0026764 3300053158 Bacteria 2384
184 Ga0500633_0000132 3300053160 Bacteria 10060
185 Ga0500639_212601 3300053163 Unclassified 817
186 Ga0500636_0104803 3300053177 Bacteria 1604
187 Ga0500636_0143077 3300053177 Unclassified 1322
188 Ga0500637_0257371 3300053178 Unclassified 971
189 Ga0500661_014698 3300055283 Bacteria 1408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221600 2644011125 187
2 iso_pu_bacteria 2852627209 2852631945 187
3 iso_pu_bacteria 2881247448 2881247888 188
4 iso_pu_bacteria 2881955468 2881957425 188
5 iso_pu_bacteria 2896085136 2896088621 188
6 iso_pu_bacteria 2958512119 2958515941 188
7 iso_pu_bacteria 2738541278 2738728496 189
8 iso_pu_bacteria 2738541283 2738756378 189
9 iso_pu_bacteria 2775506987 2776614576 189
10 iso_pu_bacteria 2818991460 2819680011 189
11 iso_pu_bacteria 2895498888 2895503045 189
12 iso_pu_bacteria 2929177148 2929179881 189
13 iso_pu_bacteria 8036736890 8036738127 189
14 iso_pu_bacteria 2896109856 2896115430 190
15 iso_pu_bacteria 2929239360 2929242724 190
16 3300005293 Ga0065715_10365521 Ga0065715_103655211 191
17 3300005841 Ga0068863_101015556 Ga0068863_1010155562 191
18 3300006942 Ga0099824_1018108 Ga0099824_10181086 191
19 3300006948 Ga0099826_10009280 Ga0099826_100092805 191
20 3300009098 Ga0105245_10411483 Ga0105245_104114831 191
21 3300013104 Ga0157370_10000346 Ga0157370_1000034638 191
22 3300013306 Ga0163162_10419676 Ga0163162_104196762 191
23 3300017792 Ga0163161_10040981 Ga0163161_100409815 191
24 3300017792 Ga0163161_10306981 Ga0163161_103069812 191
25 3300026088 Ga0207641_10089587 Ga0207641_100895872 191
26 3300027361 Ga0209489_119498 Ga0209489_1194985 191
27 3300027666 Ga0209282_1080073 Ga0209282_10800732 191
28 3300030731 Ga0316177_1132099 Ga0316177_113209913 191
29 3300030732 Ga0316176_1130428 Ga0316176_113042812 191
30 3300030742 Ga0316183_1151794 Ga0316183_115179423 191
31 3300030744 Ga0316181_1042593 Ga0316181_10425933 191
32 3300049571 Ga0501034_0082836 Ga0501034_0082836_2152_2730 191
33 3300053096 Ga0500641_0000296 Ga0500641_0000296_5654_6232 191
34 iso_pu_bacteria 2738541284 2738762969 191
35 3300003323 rootH1_10352724 rootH1_103527242 192
36 3300005288 Ga0065714_10196302 Ga0065714_101963022 192
37 3300009093 Ga0105240_10000749 Ga0105240_1000074919 192
38 3300009174 Ga0105241_10086383 Ga0105241_100863831 192
39 3300009545 Ga0105237_10002069 Ga0105237_1000206921 192
40 3300009551 Ga0105238_10003635 Ga0105238_100036356 192
41 3300013307 Ga0157372_10380593 Ga0157372_103805932 192
42 3300025911 Ga0207654_10133769 Ga0207654_101337693 192
43 3300025913 Ga0207695_10000631 Ga0207695_1000063139 192
44 3300025914 Ga0207671_10011635 Ga0207671_100116354 192
45 3300025914 Ga0207671_10063709 Ga0207671_100637093 192
46 3300025924 Ga0207694_10107218 Ga0207694_101072182 192
47 3300029957 Ga0265324_10042518 Ga0265324_100425181 192
48 3300031251 Ga0265327_10000111 Ga0265327_1000011149 192
49 3300032004 Ga0307414_10030086 Ga0307414_100300864 192
50 3300046501 Ga0495607_0063966 Ga0495607_0063966_648_1229 192
51 3300046501 Ga0495607_0143794 Ga0495607_0143794_354_935 192
52 3300046522 Ga0495643_0034108 Ga0495643_0034108_833_1414 192
53 3300046660 Ga0495625_0012581 Ga0495625_0012581_1343_1924 192
54 3300048928 Ga0496125_0001400 Ga0496125_0001400_11467_12048 192
55 3300053090 Ga0500646_0003320 Ga0500646_0003320_3271_3852 192
56 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00001000 193
57 3300003316 rootH1_10059264 rootH1_100592646 193
58 3300003320 rootH2_10189437 rootH2_101894372 193
59 3300003322 rootL2_10028084 rootL2_100280841 193
60 3300003322 rootL2_10040595 rootL2_100405952 193
61 3300005289 Ga0065704_10070133 Ga0065704_10070133392 193
62 3300005289 Ga0065704_10137229 Ga0065704_101372292 193
63 3300005329 Ga0070683_100984454 Ga0070683_1009844541 193
64 3300005337 Ga0070682_100000071 Ga0070682_10000007164 193
65 3300005365 Ga0070688_100614549 Ga0070688_1006145492 193
66 3300005539 Ga0068853_100160481 Ga0068853_1001604813 193
67 3300005563 Ga0068855_100043596 Ga0068855_1000435964 193
68 3300005577 Ga0068857_100099901 Ga0068857_1000999013 193
69 3300005577 Ga0068857_100340358 Ga0068857_1003403582 193
70 3300005844 Ga0068862_100484772 Ga0068862_1004847722 193
71 3300006237 Ga0097621_100394183 Ga0097621_1003941832 193
72 3300009174 Ga0105241_10116693 Ga0105241_101166933 193
73 3300009545 Ga0105237_10007167 Ga0105237_100071677 193
74 3300009545 Ga0105237_10011408 Ga0105237_100114084 193
75 3300009545 Ga0105237_11101302 Ga0105237_111013022 193
76 3300010375 Ga0105239_10002749 Ga0105239_100027493 193
77 3300010375 Ga0105239_10302877 Ga0105239_103028773 193
78 3300013100 Ga0157373_10365113 Ga0157373_103651132 193
79 3300013102 Ga0157371_10001012 Ga0157371_1000101214 193
80 3300013102 Ga0157371_10134222 Ga0157371_101342223 193
81 3300013102 Ga0157371_10149383 Ga0157371_101493832 193
82 3300013104 Ga0157370_10006129 Ga0157370_1000612913 193
83 3300013104 Ga0157370_10008185 Ga0157370_100081853 193
84 3300013104 Ga0157370_10042973 Ga0157370_100429732 193
85 3300013296 Ga0157374_10062258 Ga0157374_100622582 193
86 3300013297 Ga0157378_10005475 Ga0157378_100054752 193
87 3300013306 Ga0163162_10006177 Ga0163162_100061772 193
88 3300013307 Ga0157372_10191267 Ga0157372_101912672 193
89 3300013307 Ga0157372_10569214 Ga0157372_105692142 193
90 3300013308 Ga0157375_10283201 Ga0157375_102832012 193
91 3300014497 Ga0182008_10000069 Ga0182008_1000006935 193
92 3300014497 Ga0182008_10000980 Ga0182008_1000098012 193
93 3300014968 Ga0157379_10124694 Ga0157379_101246942 193
94 3300015261 Ga0182006_1005077 Ga0182006_10050773 193
95 3300017792 Ga0163161_10002196 Ga0163161_100021962 193
96 3300017792 Ga0163161_10011215 Ga0163161_100112153 193
97 3300025208 Ga0209436_100802 Ga0209436_1008023 193
98 3300025242 Ga0209258_100252 Ga0209258_10025216 193
99 3300025246 Ga0209646_1003135 Ga0209646_10031352 193
100 3300025254 Ga0209148_1000217 Ga0209148_100021716 193
101 3300025284 Ga0209130_1002251 Ga0209130_10022519 193
102 3300025302 Ga0207426_1000234 Ga0207426_100023498 193
103 3300025914 Ga0207671_10007195 Ga0207671_100071956 193
104 3300025914 Ga0207671_10031501 Ga0207671_100315013 193
105 3300025949 Ga0207667_10033242 Ga0207667_100332422 193
106 3300026041 Ga0207639_10683280 Ga0207639_106832802 193
107 3300026116 Ga0207674_10119500 Ga0207674_101195003 193
108 3300026116 Ga0207674_10152896 Ga0207674_101528962 193
109 3300028380 Ga0268265_10362887 Ga0268265_103628871 193
110 3300030521 Ga0307511_10001086 Ga0307511_1000108615 193
111 3300031251 Ga0265327_10117451 Ga0265327_101174512 193
112 3300031456 Ga0307513_10128219 Ga0307513_101282194 193
113 3300031456 Ga0307513_10677967 Ga0307513_106779671 193
114 3300031507 Ga0307509_10051023 Ga0307509_100510232 193
115 3300031901 Ga0307406_10259963 Ga0307406_102599631 193
116 3300032004 Ga0307414_10239401 Ga0307414_102394012 193
117 3300032004 Ga0307414_10756608 Ga0307414_107566082 193
118 3300032005 Ga0307411_10742549 Ga0307411_107425491 193
119 3300041452 Ga0451793_1024013 Ga0451793_1024013_35_616 193
120 3300041459 Ga0451800_0145190 Ga0451800_0145190_731_1315 193
121 3300041486 Ga0451807_1152766 Ga0451807_1152766_691_1275 193
122 3300041491 Ga0451833_0676361 Ga0451833_0676361_179_763 193
123 3300041507 Ga0451851_1306669 Ga0451851_1306669_164_748 193
124 3300041511 Ga0451855_1933770 Ga0451855_1933770_255_836 193
125 3300042004 Ga0439445_0013342 Ga0439445_0013342_358_942 193
126 3300044706 Ga0466964_0041318 Ga0466964_0041318_994_1578 193
127 3300044842 Ga0466957_0127360 Ga0466957_0127360_456_1040 193
128 3300046512 Ga0495610_0101741 Ga0495610_0101741_166_747 193
129 3300046616 Ga0495668_0000138 Ga0495668_0000138_108353_108937 193
130 3300046616 Ga0495668_0001819 Ga0495668_0001819_5648_6244 193
131 3300048924 Ga0496121_0477431 Ga0496121_0477431_178_759 193
132 3300048925 Ga0496122_0001909 Ga0496122_0001909_26291_26875 193
133 3300049651 Ga0501201_009716 Ga0501201_009716_68_652 193
134 3300049652 Ga0501202_006131 Ga0501202_006131_582_1166 193
135 3300049654 Ga0501207_033902 Ga0501207_033902_157_741 193
136 3300049658 Ga0501211_006145 Ga0501211_006145_587_1171 193
137 3300049661 Ga0501217_018527 Ga0501217_018527_365_949 193
138 3300049662 Ga0501222_024408 Ga0501222_024408_196_780 193
139 3300049663 Ga0501223_042839 Ga0501223_042839_33_617 193
140 3300049665 Ga0501227_085719 Ga0501227_085719_99_683 193
141 3300049667 Ga0501230_075044 Ga0501230_075044_50_634 193
142 3300049674 Ga0501242_020021 Ga0501242_020021_209_793 193
143 3300049675 Ga0501243_025559 Ga0501243_025559_259_843 193
144 3300049680 Ga0501250_019826 Ga0501250_019826_151_735 193
145 3300049681 Ga0501251_000805 Ga0501251_000805_526_1110 193
146 3300049683 Ga0501253_047075 Ga0501253_047075_275_859 193
147 3300049686 Ga0501257_026582 Ga0501257_026582_673_1257 193
148 3300049688 Ga0501259_002163 Ga0501259_002163_67_651 193
149 3300049690 Ga0501261_022527 Ga0501261_022527_134_718 193
150 3300049703 Ga0501219_000031 Ga0501219_000031_11086_11670 193
151 3300049704 Ga0501221_003811 Ga0501221_003811_1795_2379 193
152 3300049705 Ga0501225_0061495 Ga0501225_0061495_458_1042 193
153 3300049708 Ga0501245_043927 Ga0501245_043927_86_670 193
154 3300049758 Ga0501241_001866 Ga0501241_001866_3367_3951 193
155 3300049758 Ga0501241_015375 Ga0501241_015375_476_1057 193
156 3300049763 Ga0501266_001494 Ga0501266_001494_1931_2515 193
157 3300049765 Ga0501268_023342 Ga0501268_023342_321_905 193
158 3300049766 Ga0501269_001958 Ga0501269_001958_1258_1842 193
159 3300049768 Ga0501271_005361 Ga0501271_005361_152_736 193
160 3300050005 Ga0501284_00025 Ga0501284_00025_58168_58752 193
161 3300053086 Ga0500578_0021108 Ga0500578_0021108_2741_3325 193
162 3300053088 Ga0500644_0000163 Ga0500644_0000163_15651_16232 193
163 3300053088 Ga0500644_0006528 Ga0500644_0006528_521_1102 193
164 3300053090 Ga0500646_0089906 Ga0500646_0089906_293_883 193
165 3300053090 Ga0500646_0159916 Ga0500646_0159916_15_599 193
166 3300053090 Ga0500646_0223477 Ga0500646_0223477_14_595 193
167 3300053092 Ga0500583_0000087 Ga0500583_0000087_24014_24598 193
168 3300053092 Ga0500583_0017186 Ga0500583_0017186_84_668 193
169 3300053093 Ga0500651_0000812 Ga0500651_0000812_6674_7255 193
170 3300053108 Ga0500562_000006 Ga0500562_000006_71838_72419 193
171 3300053131 Ga0500652_044001 Ga0500652_044001_186_770 193
172 3300053134 Ga0500658_0126665 Ga0500658_0126665_101_691 193
173 3300053139 Ga0500568_0058165 Ga0500568_0058165_811_1392 193
174 3300053140 Ga0500573_0049059 Ga0500573_0049059_337_921 193
175 3300053150 Ga0500603_016719 Ga0500603_016719_710_1294 193
176 3300053153 Ga0500616_0003690 Ga0500616_0003690_7139_7723 193
177 3300053153 Ga0500616_0051817 Ga0500616_0051817_979_1560 193
178 3300053156 Ga0500622_0005071 Ga0500622_0005071_6321_6905 193
179 3300053156 Ga0500622_0080011 Ga0500622_0080011_111_695 193
180 3300053158 Ga0500627_0026764 Ga0500627_0026764_169_753 193
181 3300053160 Ga0500633_0000132 Ga0500633_0000132_3488_4069 193
182 3300053163 Ga0500639_212601 Ga0500639_212601_158_742 193
183 3300053177 Ga0500636_0104803 Ga0500636_0104803_279_863 193
184 3300053177 Ga0500636_0143077 Ga0500636_0143077_689_1273 193
185 3300053178 Ga0500637_0257371 Ga0500637_0257371_211_795 193
186 3300055283 Ga0500661_014698 Ga0500661_014698_162_743 193
187 iso_pu_bacteria 2919186247 2919187080 193
188 iso_pu_bacteria 2939664404 2939665651 193
189 3300025923 Ga0207681_10500812 Ga0207681_105008122 194
190 3300045051 Ga0451576_0000022 Ga0451576_0000022_331205_331903 194
191 3300046558 Ga0495633_0000450 Ga0495633_0000450_17517_18104 194
192 3300053093 Ga0500651_0030202 Ga0500651_0030202_477_1064 194
193 3300005288 Ga0065714_10002466 Ga0065714_100024668 195
194 3300030733 Ga0314311_1208232 Ga0314311_12082321 198
195 3300050507 nmdc:mga05p37_27568_c1 nmdc:mga05p37_27568_c1_2036_2671 198
196 iso_pu_bacteria 2946013367 2946018310 198
197 3300046453 Ga0495627_039905 Ga0495627_039905_657_1283 202
198 3300013307 Ga0157372_10444167 Ga0157372_104441672 206
199 3300045051 Ga0451576_0326913 Ga0451576_0326913_707_1405 206
200 2162886007 SwRhRL2b_contig_538870 SwRhRL2b_0660.00002270 210
201 3300005289 Ga0065704_10000326 Ga0065704_1000032659 210
202 3300013100 Ga0157373_10000378 Ga0157373_1000037816 210
203 3300013104 Ga0157370_10047909 Ga0157370_100479092 210
204 3300015261 Ga0182006_1002675 Ga0182006_10026758 210
205 3300030745 Ga0316182_1161433 Ga0316182_11614331 210
206 3300031911 Ga0307412_10000004 Ga0307412_10000004342 210
207 3300032004 Ga0307414_10001573 Ga0307414_100015739 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03831

YjdM

PhnA domain

163

230

0.96

PF10621

FpoO

F420H2 dehydrogenase subunit FpoO

12

98

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2akk-assembly1.cif.gz_A solution structure of phna-like protein rp4479 from rhodopseudomonas palustris 0.8345 138 210
4wci-assembly3.cif.gz_E crystal structure of the 1st sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 378-393) from human rin3 0.8293 155 210
4wci-assembly1.cif.gz_A crystal structure of the 1st sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 378-393) from human rin3 0.8268 155 210
2mcn-assembly1.cif.gz_A distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications 0.8249 155 210
1wyx-assembly1.cif.gz_A the crystal structure of the p130cas sh3 domain at 1.1 a resolution 0.8244 153 209
ID Description Score Start End Superfamily
af_P0AFJ1_42_111_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9007 141 209 2.30.30.40
af_P0AFJ1_42_111_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.877 141 209 2.30.30.40
af_X2JDY8_960_1024_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8538 153 210 2.30.30.40
af_Q1JPR9_696_764_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8351 154 209 2.30.30.40
2akkA00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8345 138 210 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A3B8QL77-F1-model_v4 deleted 0.998 140 210
AF-A0A496MNF1-F1-model_v4 deleted 0.9977 141 210
AF-A0A2H0P6G0-F1-model_v4 PhnA domain protein 0.9937 140 209
AF-A0A4Q5WHF4-F1-model_v4 PhnA protein 0.9922 20 119
AF-A0A661EM60-F1-model_v4 PhnA protein 0.9857 141 210

Feature Viewer

pLDDT pTM Quality
88.26 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map