F317009

General Info

Members Datasets Scaffolds Average Seq Length
207 145 207 251

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0328033|Ga0501034_0328033_70_822
Length 250
Sequence MNRRSFVAALGGIAGLPAWAQKYVPKQSDRPQPLSGEEPGFRSIFDGKSLSGWEGDPKYWSVADGCMVGVITPETVIRSNTFIIWRGGTPADFELKVTYRITKNGNSGINYRSVVVPDKVTPANQFAMRGYQCDLDGQNRYTGNNYEEKGRLFLAVRGQMTRITGAAPPTILSTFGESQELGSKIHVEDWNDVHIVARGNTLLHMINGQLMVGVIDDDPAGRTASGLLGVQVHVGPPMKVEYKNWRIKTA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
137 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 1.93
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10002529 3300005290 Bacteria 4692
2 Ga0065712_10085433 3300005290 Unclassified 2698
3 Ga0065712_10114005 3300005290 Unclassified 1762
4 Ga0065712_10115654 3300005290 Unclassified 1748
5 Ga0065715_10002871 3300005293 Bacteria 5068
6 Ga0065715_10161416 3300005293 Unclassified 1626
7 Ga0070676_10052720 3300005328 Bacteria 2393
8 Ga0070676_10396397 3300005328 Bacteria 959
9 Ga0070683_100126876 3300005329 Bacteria 2412
10 Ga0070670_100011995 3300005331 Bacteria 7412
11 Ga0070666_10095834 3300005335 Unclassified 2042
12 Ga0068868_100093103 3300005338 Unclassified 2430
13 Ga0070691_10006239 3300005341 Bacteria 5442
14 Ga0070692_10167787 3300005345 Bacteria 1263
15 Ga0070668_100141263 3300005347 Bacteria 1940
16 Ga0070668_100159202 3300005347 Bacteria 1831
17 Ga0070669_100006933 3300005353 Bacteria 8142
18 Ga0070669_100148135 3300005353 Unclassified 1815
19 Ga0070671_100038531 3300005355 Bacteria 3968
20 Ga0070674_100017454 3300005356 Bacteria 4515
21 Ga0070667_100074291 3300005367 Bacteria 2900
22 Ga0070667_100134884 3300005367 Unclassified 2158
23 Ga0070667_100310212 3300005367 Bacteria 1422
24 Ga0070714_100037759 3300005435 Bacteria 4060
25 Ga0070705_100040330 3300005440 Bacteria 2655
26 Ga0070694_100065379 3300005444 Bacteria 2491
27 Ga0070662_100306644 3300005457 Bacteria 1291
28 Ga0068867_100021688 3300005459 Bacteria 4584
29 Ga0070707_100015715 3300005468 Bacteria 7107
30 Ga0070699_100060395 3300005518 Bacteria 3285
31 Ga0070699_100309167 3300005518 Bacteria 1419
32 Ga0070684_100202298 3300005535 Unclassified 1809
33 Ga0070684_100232833 3300005535 Bacteria 1682
34 Ga0070695_100047360 3300005545 Bacteria 2745
35 Ga0070696_100015671 3300005546 Bacteria 5092
36 Ga0070704_100012390 3300005549 Bacteria 5267
37 Ga0070704_100044236 3300005549 Bacteria 3093
38 Ga0068855_100056926 3300005563 Bacteria 4584
39 Ga0070664_100018928 3300005564 Bacteria 5662
40 Ga0068854_100017503 3300005578 Bacteria 4795
41 Ga0068852_100026287 3300005616 Unclassified 4730
42 Ga0068859_100012288 3300005617 Bacteria 8614
43 Ga0068864_100262470 3300005618 Unclassified 1607
44 Ga0068864_100782200 3300005618 Unclassified 937
45 Ga0068861_100010682 3300005719 Bacteria 6378
46 Ga0068861_100068936 3300005719 Bacteria 2735
47 Ga0068861_100560634 3300005719 Unclassified 1042
48 Ga0068863_100068211 3300005841 Unclassified 3364
49 Ga0068862_100036244 3300005844 Bacteria 4181
50 Ga0068862_100276322 3300005844 Bacteria 1538
51 Ga0081539_10062025 3300005985 Bacteria 2045
52 Ga0075368_10004053 3300006042 Bacteria 4930
53 Ga0075364_10037202 3300006051 Bacteria 3150
54 Ga0075364_10081153 3300006051 Bacteria 2144
55 Ga0075367_10104283 3300006178 Unclassified 1736
56 Ga0075366_10003094 3300006195 Bacteria 8692
57 Ga0068871_100488179 3300006358 Viruses 1109
58 Ga0068871_100529735 3300006358 Unclassified 1065
59 Ga0075428_100000021 3300006844 Bacteria 133628
60 Ga0075430_100060152 3300006846 Bacteria 3193
61 Ga0075430_100250684 3300006846 Bacteria 1467
62 Ga0075430_100384962 3300006846 Bacteria 1157
63 Ga0075431_100417836 3300006847 Bacteria 1340
64 Ga0075433_10018649 3300006852 Bacteria 5771
65 Ga0075433_10390560 3300006852 Bacteria 1228
66 Ga0075434_100733775 3300006871 Bacteria 1005
67 Ga0097620_100012288 3300006931 Bacteria 8614
68 Ga0075435_100449233 3300007076 Bacteria 1111
69 Ga0105240_10001777 3300009093 Bacteria 36386
70 Ga0105240_10265670 3300009093 Unclassified 1978
71 Ga0105240_10362655 3300009093 Unclassified 1641
72 Ga0111539_10000002 3300009094 Bacteria 983359
73 Ga0111539_10442083 3300009094 Bacteria 1514
74 Ga0105245_10074018 3300009098 Unclassified 3099
75 Ga0114129_10065102 3300009147 Bacteria 5088
76 Ga0114129_10098902 3300009147 Bacteria 4038
77 Ga0114129_10474164 3300009147 Bacteria 1638
78 Ga0105243_10041453 3300009148 Unclassified 3600
79 Ga0105241_10150817 3300009174 Bacteria 1901
80 Ga0105242_10055504 3300009176 Bacteria 3240
81 Ga0105237_10100693 3300009545 Unclassified 2881
82 Ga0105249_10025526 3300009553 Bacteria 5320
83 Ga0105249_10429050 3300009553 Bacteria 1357
84 Ga0105239_10068058 3300010375 Bacteria 3913
85 Ga0105239_10624491 3300010375 Unclassified 1230
86 Ga0157370_10013865 3300013104 Bacteria 8277
87 Ga0157369_10022057 3300013105 Bacteria 7115
88 Ga0157369_10181024 3300013105 Bacteria 2217
89 Ga0157372_10221976 3300013307 Bacteria 2190
90 Ga0163163_10113679 3300014325 Unclassified 2738
91 Ga0163163_10879007 3300014325 Bacteria 960
92 Ga0157380_10010925 3300014326 Bacteria 6548
93 Ga0157380_10075269 3300014326 Bacteria 2743
94 Ga0207697_10001082 3300025315 Bacteria 15051
95 Ga0207688_10000582 3300025901 Bacteria 17953
96 Ga0207654_10124311 3300025911 Bacteria 1624
97 Ga0207695_10019030 3300025913 Bacteria 7920
98 Ga0207660_10099611 3300025917 Bacteria 2169
99 Ga0207646_10015900 3300025922 Bacteria 7077
100 Ga0207650_10025186 3300025925 Bacteria 4237
101 Ga0207664_10025059 3300025929 Bacteria 4487
102 Ga0207644_10101414 3300025931 Unclassified 2163
103 Ga0207706_10343068 3300025933 Bacteria 1299
104 Ga0207686_10055370 3300025934 Unclassified 2488
105 Ga0207709_10037504 3300025935 Bacteria 2881
106 Ga0207669_10152402 3300025937 Unclassified 1621
107 Ga0207669_10449917 3300025937 Bacteria 1020
108 Ga0207691_10132055 3300025940 Unclassified 2205
109 Ga0207691_10359276 3300025940 Bacteria 1245
110 Ga0207661_10093082 3300025944 Bacteria 2514
111 Ga0207679_10308046 3300025945 Unclassified 1367
112 Ga0207667_10018734 3300025949 Bacteria 7753
113 Ga0207712_10198003 3300025961 Bacteria 1591
114 Ga0207668_10386594 3300025972 Bacteria 1179
115 Ga0207658_10139826 3300025986 Unclassified 1958
116 Ga0207658_10283394 3300025986 Bacteria 1421
117 Ga0207708_10135553 3300026075 Bacteria 1928
118 Ga0207641_10115007 3300026088 Bacteria 2391
119 Ga0207676_10294268 3300026095 Unclassified 1480
120 Ga0207675_100100336 3300026118 Bacteria 2727
121 Ga0207675_100234865 3300026118 Bacteria 1770
122 Ga0207698_10017216 3300026142 Unclassified 4897
123 Ga0207428_10000026 3300027907 Bacteria 255539
124 Ga0207428_10013297 3300027907 Bacteria 7195
125 Ga0268265_10249522 3300028380 Bacteria 1571
126 Ga0307408_100088254 3300031548 Bacteria 2335
127 Ga0307408_100318548 3300031548 Unclassified 1309
128 Ga0307410_10232913 3300031852 Bacteria 1423
129 Ga0307409_100174579 3300031995 Bacteria 1895
130 Ga0307416_100075767 3300032002 Unclassified 2817
131 Ga0307416_100636949 3300032002 Bacteria 1149
132 Ga0436364_0534248 3300037853 Bacteria 1265
133 Ga0450923_022299 3300042125 Bacteria 1240
134 Ga0439435_0027570 3300042436 Unclassified 1521
135 Ga0451576_0517311 3300045051 Bacteria 1254
136 Ga0466958_0133690 3300045836 Unclassified 1559
137 Ga0495603_0065285 3300046455 Unclassified 2145
138 Ga0495638_0047565 3300046460 Bacteria 2689
139 Ga0496102_0102536 3300048905 Bacteria 2660
140 Ga0496106_0083840 3300048909 Bacteria 2452
141 Ga0496110_0020507 3300048913 Bacteria 5581
142 Ga0496112_0034809 3300048915 Bacteria 4902
143 Ga0501032_0234491 3300049569 Bacteria 1193
144 Ga0501034_0328033 3300049571 Unclassified 1462
145 Ga0501036_0130499 3300049572 Bacteria 2122
146 Ga0501038_0089609 3300049574 Bacteria 2580
147 Ga0501039_0356360 3300049575 Unclassified 1149
148 Ga0501040_0097287 3300049576 Bacteria 2050
149 Ga0501040_0749141 3300049576 Bacteria 707
150 Ga0501041_0157370 3300049577 Bacteria 1420
151 Ga0501041_0350685 3300049577 Bacteria 933
152 Ga0501042_0228191 3300049578 Unclassified 1343
153 Ga0501042_0342775 3300049578 Unclassified 1080
154 Ga0501046_0040460 3300049580 Bacteria 3725
155 Ga0501048_0281674 3300049582 Unclassified 1182
156 Ga0501071_0064668 3300049587 Bacteria 2654
157 Ga0501071_0075591 3300049587 Bacteria 2459
158 Ga0501071_0327423 3300049587 Bacteria 1164
159 Ga0501071_0423925 3300049587 Bacteria 1017
160 Ga0501072_0022684 3300049588 Bacteria 4870
161 Ga0501072_0051680 3300049588 Bacteria 3236
162 Ga0501072_0405317 3300049588 Unclassified 1081
163 Ga0501072_0423692 3300049588 Unclassified 1055
164 Ga0501073_0055098 3300049589 Bacteria 2783
165 Ga0501074_0065154 3300049590 Bacteria 2623
166 Ga0501075_0039753 3300049591 Bacteria 3520
167 Ga0501075_0046264 3300049591 Bacteria 3269
168 Ga0501075_0271300 3300049591 Bacteria 1293
169 Ga0501076_0002357 3300049592 Bacteria 12930
170 Ga0501076_0145436 3300049592 Bacteria 1927
171 Ga0501076_0418493 3300049592 Unclassified 1102
172 Ga0501077_0269467 3300049593 Unclassified 1083
173 Ga0501079_0083375 3300049741 Bacteria 2473
174 Ga0501079_0330883 3300049741 Bacteria 1193
175 Ga0501080_0116491 3300049742 Bacteria 2477
176 Ga0501081_0119315 3300049743 Bacteria 1877
177 Ga0501081_0232148 3300049743 Bacteria 1344
178 Ga0501083_0067543 3300049744 Bacteria 2380
179 Ga0501045_0173283 3300049824 Unclassified 1607
180 nmdc:mga0k408_171333_c1 3300050493 Unclassified 1294
181 nmdc:mga0k408_271666_c1 3300050493 Bacteria 1012
182 nmdc:mga06z11_256168_c1 3300050494 Bacteria 1031
183 nmdc:mga05p37_792948_c1 3300050507 Unclassified 1038
184 nmdc:mga0qj67_174352_c1 3300050509 Unclassified 956
185 nmdc:mga0qj67_285353_c1 3300050509 Bacteria 1338
186 nmdc:mga0qj67_43890_c1 3300050509 Unclassified 3521
187 nmdc:mga0qj67_49889_c1 3300050509 Bacteria 3308
188 nmdc:mga06r32_394675_c1 3300050510 Unclassified 1366
189 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
190 nmdc:mga08y16_5963_c1 3300050511 Bacteria 12779
191 nmdc:mga0rr50_413597_c1 3300050513 Bacteria 1140
192 nmdc:mga0a205_390044_c1 3300050515 Bacteria 1257
193 nmdc:mga0a205_476468_c1 3300050515 Bacteria 1107
194 Ga0500651_0039085 3300053093 Bacteria 2989
195 Ga0500555_000434 3300053103 Bacteria 17306
196 Ga0500556_0005145 3300053104 Bacteria 3699
197 Ga0500568_0004631 3300053139 Bacteria 7313
198 Ga0500645_000271 3300053730 Bacteria 37062
199 Ga0501084_0107646 3300054114 Bacteria 2342
200 Ga0501084_0490292 3300054114 Unclassified 1038
201 Ga0590071_000135 3300059421 Bacteria 20700
202 Ga0590074_002078 3300059423 Bacteria 3275
203 Ga0590075_000575 3300059424 Bacteria 9951
204 Ga0590075_006000 3300059424 Viruses 2875
205 Ga0590077_000564 3300059426 Bacteria 10240
206 Ga0501082_0043267 3300060353 Bacteria 3883
207 Ga0501082_0322650 3300060353 Bacteria 1346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0047565 Ga0495638_0047565_1297_1974 216
2 3300049742 Ga0501080_0116491 Ga0501080_0116491_223_993 216
3 3300006844 Ga0075428_100000021 Ga0075428_1000000217 217
4 3300006846 Ga0075430_100250684 Ga0075430_1002506842 217
5 3300009094 Ga0111539_10000002 Ga0111539_10000002746 217
6 3300027907 Ga0207428_10000026 Ga0207428_1000002693 217
7 3300050509 nmdc:mga0qj67_285353_c1 nmdc:mga0qj67_285353_c1_381_1124 217
8 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_126604_127347 217
9 3300050509 nmdc:mga0qj67_43890_c1 nmdc:mga0qj67_43890_c1_35_691 218
10 3300006871 Ga0075434_100733775 Ga0075434_1007337751 224
11 3300049576 Ga0501040_0749141 Ga0501040_0749141_12_692 226
12 3300005518 Ga0070699_100060395 Ga0070699_1000603953 228
13 3300049588 Ga0501072_0022684 Ga0501072_0022684_132_989 228
14 3300049591 Ga0501075_0039753 Ga0501075_0039753_2136_2993 228
15 3300049592 Ga0501076_0002357 Ga0501076_0002357_11863_12720 228
16 3300049741 Ga0501079_0330883 Ga0501079_0330883_209_1066 228
17 3300009147 Ga0114129_10065102 Ga0114129_100651023 233
18 3300013105 Ga0157369_10181024 Ga0157369_101810242 233
19 3300049575 Ga0501039_0356360 Ga0501039_0356360_179_1003 233
20 3300049578 Ga0501042_0342775 Ga0501042_0342775_23_847 233
21 3300049582 Ga0501048_0281674 Ga0501048_0281674_230_1054 233
22 3300049587 Ga0501071_0064668 Ga0501071_0064668_1756_2580 233
23 3300049588 Ga0501072_0405317 Ga0501072_0405317_219_1043 233
24 3300049591 Ga0501075_0271300 Ga0501075_0271300_150_974 233
25 3300049592 Ga0501076_0418493 Ga0501076_0418493_190_1014 233
26 3300049593 Ga0501077_0269467 Ga0501077_0269467_118_942 233
27 3300049824 Ga0501045_0173283 Ga0501045_0173283_162_986 233
28 3300054114 Ga0501084_0490292 Ga0501084_0490292_39_863 233
29 3300005328 Ga0070676_10052720 Ga0070676_100527203 234
30 3300005341 Ga0070691_10006239 Ga0070691_100062394 234
31 3300005444 Ga0070694_100065379 Ga0070694_1000653791 234
32 3300005459 Ga0068867_100021688 Ga0068867_1000216883 234
33 3300005578 Ga0068854_100017503 Ga0068854_1000175034 234
34 3300005719 Ga0068861_100010682 Ga0068861_1000106825 234
35 3300049588 Ga0501072_0423692 Ga0501072_0423692_10_717 235
36 3300005329 Ga0070683_100126876 Ga0070683_1001268762 237
37 3300009093 Ga0105240_10001777 Ga0105240_1000177717 237
38 3300025913 Ga0207695_10019030 Ga0207695_100190303 237
39 3300025944 Ga0207661_10093082 Ga0207661_100930823 237
40 3300005535 Ga0070684_100232833 Ga0070684_1002328332 238
41 3300005618 Ga0068864_100782200 Ga0068864_1007822001 238
42 3300005367 Ga0070667_100134884 Ga0070667_1001348842 239
43 3300005841 Ga0068863_100068211 Ga0068863_1000682112 239
44 3300006042 Ga0075368_10004053 Ga0075368_100040533 239
45 3300006195 Ga0075366_10003094 Ga0075366_100030942 239
46 3300026088 Ga0207641_10115007 Ga0207641_101150072 239
47 3300050493 nmdc:mga0k408_171333_c1 nmdc:mga0k408_171333_c1_521_1264 239
48 3300025934 Ga0207686_10055370 Ga0207686_100553701 240
49 3300049571 Ga0501034_0328033 Ga0501034_0328033_70_822 240
50 3300053093 Ga0500651_0039085 Ga0500651_0039085_1947_2678 240
51 3300005367 Ga0070667_100310212 Ga0070667_1003102122 241
52 3300006051 Ga0075364_10037202 Ga0075364_100372022 241
53 3300025986 Ga0207658_10283394 Ga0207658_102833942 241
54 3300050509 nmdc:mga0qj67_174352_c1 nmdc:mga0qj67_174352_c1_112_873 241
55 3300005293 Ga0065715_10002871 Ga0065715_100028713 242
56 3300005345 Ga0070692_10167787 Ga0070692_101677871 242
57 3300005347 Ga0070668_100141263 Ga0070668_1001412632 242
58 3300005353 Ga0070669_100006933 Ga0070669_1000069334 242
59 3300005353 Ga0070669_100148135 Ga0070669_1001481352 242
60 3300005356 Ga0070674_100017454 Ga0070674_1000174542 242
61 3300005440 Ga0070705_100040330 Ga0070705_1000403301 242
62 3300005457 Ga0070662_100306644 Ga0070662_1003066442 242
63 3300005468 Ga0070707_100015715 Ga0070707_1000157154 242
64 3300005518 Ga0070699_100309167 Ga0070699_1003091672 242
65 3300005546 Ga0070696_100015671 Ga0070696_1000156712 242
66 3300005549 Ga0070704_100012390 Ga0070704_1000123902 242
67 3300005549 Ga0070704_100044236 Ga0070704_1000442362 242
68 3300005617 Ga0068859_100012288 Ga0068859_1000122884 242
69 3300005719 Ga0068861_100068936 Ga0068861_1000689362 242
70 3300005719 Ga0068861_100560634 Ga0068861_1005606341 242
71 3300005844 Ga0068862_100036244 Ga0068862_1000362443 242
72 3300005844 Ga0068862_100276322 Ga0068862_1002763221 242
73 3300006051 Ga0075364_10081153 Ga0075364_100811532 242
74 3300006178 Ga0075367_10104283 Ga0075367_101042831 242
75 3300006852 Ga0075433_10390560 Ga0075433_103905601 242
76 3300006931 Ga0097620_100012288 Ga0097620_1000122884 242
77 3300009094 Ga0111539_10442083 Ga0111539_104420832 242
78 3300009147 Ga0114129_10474164 Ga0114129_104741642 242
79 3300009148 Ga0105243_10041453 Ga0105243_100414532 242
80 3300009176 Ga0105242_10055504 Ga0105242_100555042 242
81 3300009553 Ga0105249_10025526 Ga0105249_100255262 242
82 3300009553 Ga0105249_10429050 Ga0105249_104290501 242
83 3300014325 Ga0163163_10113679 Ga0163163_101136792 242
84 3300014326 Ga0157380_10010925 Ga0157380_100109253 242
85 3300014326 Ga0157380_10075269 Ga0157380_100752692 242
86 3300025922 Ga0207646_10015900 Ga0207646_100159004 242
87 3300025933 Ga0207706_10343068 Ga0207706_103430682 242
88 3300025935 Ga0207709_10037504 Ga0207709_100375042 242
89 3300025937 Ga0207669_10449917 Ga0207669_104499171 242
90 3300025940 Ga0207691_10359276 Ga0207691_103592762 242
91 3300025945 Ga0207679_10308046 Ga0207679_103080462 242
92 3300025961 Ga0207712_10198003 Ga0207712_101980032 242
93 3300026075 Ga0207708_10135553 Ga0207708_101355532 242
94 3300026118 Ga0207675_100100336 Ga0207675_1001003362 242
95 3300026118 Ga0207675_100234865 Ga0207675_1002348652 242
96 3300028380 Ga0268265_10249522 Ga0268265_102495222 242
97 3300031548 Ga0307408_100318548 Ga0307408_1003185482 242
98 3300032002 Ga0307416_100075767 Ga0307416_1000757672 242
99 3300048913 Ga0496110_0020507 Ga0496110_0020507_3714_4472 242
100 3300049569 Ga0501032_0234491 Ga0501032_0234491_387_1130 242
101 3300049578 Ga0501042_0228191 Ga0501042_0228191_521_1264 242
102 3300050507 nmdc:mga05p37_792948_c1 nmdc:mga05p37_792948_c1_85_822 242
103 3300050510 nmdc:mga06r32_394675_c1 nmdc:mga06r32_394675_c1_405_1142 242
104 3300050515 nmdc:mga0a205_390044_c1 nmdc:mga0a205_390044_c1_403_1146 242
105 3300060353 Ga0501082_0322650 Ga0501082_0322650_504_1247 242
106 3300005545 Ga0070695_100047360 Ga0070695_1000473602 243
107 3300009093 Ga0105240_10265670 Ga0105240_102656702 243
108 3300009098 Ga0105245_10074018 Ga0105245_100740182 243
109 3300009147 Ga0114129_10098902 Ga0114129_100989024 243
110 3300050511 nmdc:mga08y16_5963_c1 nmdc:mga08y16_5963_c1_7529_8293 243
111 3300050515 nmdc:mga0a205_476468_c1 nmdc:mga0a205_476468_c1_32_781 243
112 3300005290 Ga0065712_10085433 Ga0065712_100854331 244
113 3300005331 Ga0070670_100011995 Ga0070670_1000119953 244
114 3300005335 Ga0070666_10095834 Ga0070666_100958342 244
115 3300005338 Ga0068868_100093103 Ga0068868_1000931033 244
116 3300005347 Ga0070668_100159202 Ga0070668_1001592021 244
117 3300005355 Ga0070671_100038531 Ga0070671_1000385314 244
118 3300005367 Ga0070667_100074291 Ga0070667_1000742914 244
119 3300005535 Ga0070684_100202298 Ga0070684_1002022981 244
120 3300005564 Ga0070664_100018928 Ga0070664_1000189284 244
121 3300005618 Ga0068864_100262470 Ga0068864_1002624702 244
122 3300006358 Ga0068871_100529735 Ga0068871_1005297351 244
123 3300010375 Ga0105239_10624491 Ga0105239_106244912 244
124 3300025315 Ga0207697_10001082 Ga0207697_100010827 244
125 3300025901 Ga0207688_10000582 Ga0207688_100005827 244
126 3300025925 Ga0207650_10025186 Ga0207650_100251861 244
127 3300025931 Ga0207644_10101414 Ga0207644_101014142 244
128 3300025937 Ga0207669_10152402 Ga0207669_101524023 244
129 3300025940 Ga0207691_10132055 Ga0207691_101320552 244
130 3300025972 Ga0207668_10386594 Ga0207668_103865941 244
131 3300025986 Ga0207658_10139826 Ga0207658_101398261 244
132 3300026095 Ga0207676_10294268 Ga0207676_102942681 244
133 3300037853 Ga0436364_0534248 Ga0436364_0534248_477_1250 244
134 3300046455 Ga0495603_0065285 Ga0495603_0065285_337_1113 244
135 3300048905 Ga0496102_0102536 Ga0496102_0102536_1239_2015 244
136 3300048909 Ga0496106_0083840 Ga0496106_0083840_857_1633 244
137 3300048915 Ga0496112_0034809 Ga0496112_0034809_1466_2242 244
138 3300053103 Ga0500555_000434 Ga0500555_000434_10401_11195 244
139 3300006846 Ga0075430_100060152 Ga0075430_1000601522 245
140 3300006852 Ga0075433_10018649 Ga0075433_100186494 245
141 3300053104 Ga0500556_0005145 Ga0500556_0005145_2246_3019 245
142 3300059421 Ga0590071_000135 Ga0590071_000135_467_1240 245
143 3300059423 Ga0590074_002078 Ga0590074_002078_671_1444 245
144 3300059424 Ga0590075_000575 Ga0590075_000575_7532_8305 245
145 3300059426 Ga0590077_000564 Ga0590077_000564_7586_8359 245
146 3300006358 Ga0068871_100488179 Ga0068871_1004881792 246
147 3300006846 Ga0075430_100384962 Ga0075430_1003849622 246
148 3300006847 Ga0075431_100417836 Ga0075431_1004178362 246
149 3300007076 Ga0075435_100449233 Ga0075435_1004492331 246
150 3300009093 Ga0105240_10362655 Ga0105240_103626553 246
151 3300009174 Ga0105241_10150817 Ga0105241_101508172 246
152 3300009545 Ga0105237_10100693 Ga0105237_101006932 246
153 3300010375 Ga0105239_10068058 Ga0105239_100680584 246
154 3300025911 Ga0207654_10124311 Ga0207654_101243112 246
155 3300027907 Ga0207428_10013297 Ga0207428_100132979 246
156 3300031548 Ga0307408_100088254 Ga0307408_1000882542 246
157 3300031852 Ga0307410_10232913 Ga0307410_102329132 246
158 3300031995 Ga0307409_100174579 Ga0307409_1001745792 246
159 3300032002 Ga0307416_100636949 Ga0307416_1006369492 246
160 3300045051 Ga0451576_0517311 Ga0451576_0517311_343_1119 246
161 3300045836 Ga0466958_0133690 Ga0466958_0133690_641_1417 246
162 3300049574 Ga0501038_0089609 Ga0501038_0089609_1711_2481 246
163 3300049576 Ga0501040_0097287 Ga0501040_0097287_182_952 246
164 3300049577 Ga0501041_0350685 Ga0501041_0350685_26_796 246
165 3300049580 Ga0501046_0040460 Ga0501046_0040460_2475_3245 246
166 3300049591 Ga0501075_0046264 Ga0501075_0046264_1901_2671 246
167 3300049592 Ga0501076_0145436 Ga0501076_0145436_751_1521 246
168 3300049741 Ga0501079_0083375 Ga0501079_0083375_1032_1802 246
169 3300050509 nmdc:mga0qj67_49889_c1 nmdc:mga0qj67_49889_c1_2209_2991 246
170 3300050513 nmdc:mga0rr50_413597_c1 nmdc:mga0rr50_413597_c1_162_938 246
171 3300053730 Ga0500645_000271 Ga0500645_000271_4218_5012 246
172 3300059424 Ga0590075_006000 Ga0590075_006000_410_1399 246
173 3300060353 Ga0501082_0043267 Ga0501082_0043267_790_1560 246
174 3300049572 Ga0501036_0130499 Ga0501036_0130499_18_788 247
175 3300049577 Ga0501041_0157370 Ga0501041_0157370_561_1331 247
176 3300049587 Ga0501071_0075591 Ga0501071_0075591_1426_2196 247
177 3300049588 Ga0501072_0051680 Ga0501072_0051680_1498_2268 247
178 3300049743 Ga0501081_0119315 Ga0501081_0119315_173_943 247
179 3300053139 Ga0500568_0004631 Ga0500568_0004631_5320_6099 247
180 3300005290 Ga0065712_10002529 Ga0065712_100025292 248
181 3300005290 Ga0065712_10114005 Ga0065712_101140052 248
182 3300005290 Ga0065712_10115654 Ga0065712_101156542 248
183 3300005293 Ga0065715_10161416 Ga0065715_101614162 248
184 3300005328 Ga0070676_10396397 Ga0070676_103963971 248
185 3300005435 Ga0070714_100037759 Ga0070714_1000377592 248
186 3300005563 Ga0068855_100056926 Ga0068855_1000569261 248
187 3300005616 Ga0068852_100026287 Ga0068852_1000262874 248
188 3300005985 Ga0081539_10062025 Ga0081539_100620252 248
189 3300013104 Ga0157370_10013865 Ga0157370_100138656 248
190 3300013105 Ga0157369_10022057 Ga0157369_100220572 248
191 3300013307 Ga0157372_10221976 Ga0157372_102219762 248
192 3300014325 Ga0163163_10879007 Ga0163163_108790072 248
193 3300025917 Ga0207660_10099611 Ga0207660_100996112 248
194 3300025929 Ga0207664_10025059 Ga0207664_100250591 248
195 3300025949 Ga0207667_10018734 Ga0207667_100187345 248
196 3300026142 Ga0207698_10017216 Ga0207698_100172163 248
197 3300042125 Ga0450923_022299 Ga0450923_022299_373_1146 248
198 3300042436 Ga0439435_0027570 Ga0439435_0027570_349_1122 248
199 3300049587 Ga0501071_0327423 Ga0501071_0327423_391_1146 248
200 3300049587 Ga0501071_0423925 Ga0501071_0423925_194_994 248
201 3300049589 Ga0501073_0055098 Ga0501073_0055098_1216_1971 248
202 3300049590 Ga0501074_0065154 Ga0501074_0065154_14_769 248
203 3300049743 Ga0501081_0232148 Ga0501081_0232148_578_1333 248
204 3300049744 Ga0501083_0067543 Ga0501083_0067543_158_913 248
205 3300050493 nmdc:mga0k408_271666_c1 nmdc:mga0k408_271666_c1_249_1001 248
206 3300050494 nmdc:mga06z11_256168_c1 nmdc:mga06z11_256168_c1_178_930 248
207 3300054114 Ga0501084_0107646 Ga0501084_0107646_572_1327 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

40

248

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8569 40 246
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.6924 39 247
4uw5-assembly6.cif.gz_F human galectin-7 in complex with a galactose based dendron d2-2. 0.6683 90 245
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.6677 40 248
5nxb-assembly1.cif.gz_B mouse galactocerebrosidase in complex with saposin a 0.6676 65 248
ID Description Score Start End Superfamily
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8511 40 246 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7862 40 246 2.60.120.560
af_Q8IK83_1050_1219_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7004 62 243 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6998 47 243 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6931 47 243 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A290Q1I5-F1-model_v4 Glycosyl hydrolase 0.9902 16 248 GO:0016787
AF-A0A2N9N386-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9882 16 248 GO:0016787
AF-A0A2V8IZN3-F1-model_v4 DUF1080 domain-containing protein 0.9804 25 248 GO:0016787
AF-W6U2D1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9757 37 248 GO:0016787
AF-A0A7Y4UAK2-F1-model_v4 DUF1080 domain-containing protein 0.9685 32 248 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map