F317028

General Info

Members Datasets Scaffolds Average Seq Length
207 155 414 358

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0001253|Ga0501047_0001253_11520_12755
Length 411
Sequence MRSIELGTQEPTARGPWVPDRPAGIAVELLAQLHCLSRDTGAGVRNDEVFEPAMTETTTPQADFTGTKPVEERHRLDEASLTRWLEANVDGFKGPLTLNQFKGGQSNPTYQLVTPTKKYVLRKKPSGKLLPSAHAVDREYRVISALYPTGFPVARPYALCEDDSIVGAMFYVMDMVEGRILWNGALPDSDPAERRAIYENKIATLAKLHMTDYAAIGLSDYGKAGNYFARQIDRWSKQYKLSETENIDEMNRLIEWLPQTIPAGERTSIVHGDYRLDNMVLHATEPRVLAVLDWELSTLGDPLGDFTYYLMSWVMPHDGRANLDGLDLKALGIPTIEETVALYCAQTRRDGIPDLDWYFAYNAFRLAGILQGIAGRVRDGTAASAHAAQMIQRIRPLAQAAYSFAQKAGLK

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
101 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
154 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
155 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.48
Rhizoplane 7.73
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0001253 3300049581 Bacteria 25138
2 JGI24736J21556_1000291 3300001904 Bacteria 9171
3 JGI24737J22298_10000085 3300001990 Bacteria 27466
4 JGI24737J22298_10001421 3300001990 Bacteria 8518
5 JGI24735J21928_10001487 3300002067 Bacteria 8297
6 JGI24751J29686_10000084 3300002459 Bacteria 52362
7 Ga0055530_10019404 3300003791 Bacteria 2061
8 Ga0070658_10100507 3300005327 Bacteria 2391
9 Ga0070670_100070546 3300005331 Bacteria 2999
10 Ga0070670_100239326 3300005331 Bacteria 1580
11 Ga0070666_10026816 3300005335 Bacteria 3768
12 Ga0070668_100000378 3300005347 Bacteria 29470
13 Ga0070675_100153766 3300005354 Bacteria 1974
14 Ga0070671_100000063 3300005355 Bacteria 72834
15 Ga0070667_100000145 3300005367 Bacteria 89528
16 Ga0070663_100008274 3300005455 Bacteria 6390
17 Ga0070662_100185939 3300005457 Bacteria 1640
18 Ga0070665_100331651 3300005548 Bacteria 1526
19 Ga0070664_100005210 3300005564 Bacteria 10423
20 Ga0068854_100016467 3300005578 Bacteria 4930
21 Ga0068854_100266155 3300005578 Bacteria 1374
22 Ga0068856_100281766 3300005614 Bacteria 1679
23 Ga0068864_100098141 3300005618 Unclassified 2594
24 Ga0068863_100000723 3300005841 Bacteria 33109
25 Ga0068863_100001090 3300005841 Bacteria 27124
26 Ga0068863_100068537 3300005841 Bacteria 3356
27 Ga0068860_100000942 3300005843 Bacteria 32259
28 Ga0068860_100010487 3300005843 Bacteria 9158
29 Ga0068860_100028005 3300005843 Bacteria 5425
30 Ga0068862_100089437 3300005844 Bacteria 2680
31 Ga0070717_10001949 3300006028 Bacteria 14418
32 Ga0075363_100004491 3300006048 Bacteria 6114
33 Ga0070716_100007159 3300006173 Bacteria 5483
34 Ga0070712_100125256 3300006175 Bacteria 1939
35 Ga0075367_10038269 3300006178 Bacteria 2792
36 Ga0075366_10000662 3300006195 Bacteria 16222
37 Ga0105251_10015458 3300009011 Bacteria 4171
38 Ga0105240_10033689 3300009093 Bacteria 6614
39 Ga0105240_10061364 3300009093 Bacteria 4685
40 Ga0105240_10272106 3300009093 Bacteria 1949
41 Ga0105240_10499188 3300009093 Bacteria 1353
42 Ga0105243_10219997 3300009148 Bacteria 1678
43 Ga0105241_10000932 3300009174 Bacteria 22159
44 Ga0105248_10095267 3300009177 Bacteria 3351
45 Ga0105237_10005047 3300009545 Bacteria 15017
46 Ga0105237_10384407 3300009545 Bacteria 1408
47 Ga0105238_10010486 3300009551 Bacteria 9301
48 Ga0105238_10019952 3300009551 Bacteria 6824
49 Ga0105238_10033761 3300009551 Bacteria 5206
50 Ga0105249_10305702 3300009553 Bacteria 1597
51 Ga0157373_10026331 3300013100 Bacteria 4202
52 Ga0157370_10103525 3300013104 Bacteria 2665
53 Ga0157369_10219999 3300013105 Bacteria 1988
54 Ga0157378_10239935 3300013297 Bacteria 1731
55 Ga0163162_10120536 3300013306 Bacteria 2727
56 Ga0163162_10284665 3300013306 Bacteria 1785
57 Ga0157379_10000433 3300014968 Bacteria 33887
58 Ga0163161_10014911 3300017792 Bacteria 5413
59 Ga0209050_1000253 3300025298 Bacteria 114525
60 Ga0207688_10083150 3300025901 Bacteria 1831
61 Ga0207680_10038294 3300025903 Bacteria 2775
62 Ga0207680_10128955 3300025903 Bacteria 1664
63 Ga0207647_10008832 3300025904 Bacteria 7191
64 Ga0207705_10057586 3300025909 Bacteria 2803
65 Ga0207705_10105330 3300025909 Bacteria 2079
66 Ga0207654_10005706 3300025911 Bacteria 6290
67 Ga0207695_10023828 3300025913 Bacteria 6909
68 Ga0207695_10126168 3300025913 Bacteria 2521
69 Ga0207695_10171694 3300025913 Bacteria 2094
70 Ga0207671_10128159 3300025914 Bacteria 1946
71 Ga0207693_10031643 3300025915 Bacteria 4180
72 Ga0207662_10045220 3300025918 Bacteria 2602
73 Ga0207657_10007386 3300025919 Bacteria 11272
74 Ga0207657_10120397 3300025919 Bacteria 2160
75 Ga0207652_10054467 3300025921 Bacteria 3439
76 Ga0207694_10033911 3300025924 Bacteria 3912
77 Ga0207694_10052089 3300025924 Bacteria 3173
78 Ga0207694_10182932 3300025924 Bacteria 1700
79 Ga0207650_10170613 3300025925 Bacteria 1729
80 Ga0207700_10003874 3300025928 Bacteria 8743
81 Ga0207644_10000075 3300025931 Bacteria 72848
82 Ga0207706_10051149 3300025933 Bacteria 3649
83 Ga0207665_10001038 3300025939 Bacteria 18711
84 Ga0207691_10033780 3300025940 Bacteria 4762
85 Ga0207691_10105850 3300025940 Bacteria 2506
86 Ga0207689_10033166 3300025942 Bacteria 4291
87 Ga0207689_10243850 3300025942 Bacteria 1485
88 Ga0207679_10069071 3300025945 Bacteria 2657
89 Ga0207651_10114271 3300025960 Bacteria 2033
90 Ga0207668_10000022 3300025972 Bacteria 135782
91 Ga0207668_10051493 3300025972 Bacteria 2844
92 Ga0207640_10031924 3300025981 Bacteria 3261
93 Ga0207640_10079122 3300025981 Bacteria 2240
94 Ga0207640_10088075 3300025981 Bacteria 2142
95 Ga0207658_10000021 3300025986 Bacteria 201456
96 Ga0207658_10000103 3300025986 Bacteria 93261
97 Ga0207703_10075482 3300026035 Bacteria 2794
98 Ga0207639_10000687 3300026041 Bacteria 23359
99 Ga0207678_10001199 3300026067 Bacteria 23772
100 Ga0207702_10013765 3300026078 Bacteria 6719
101 Ga0207702_10254232 3300026078 Bacteria 1651
102 Ga0207641_10000040 3300026088 Bacteria 192446
103 Ga0207641_10000344 3300026088 Bacteria 55824
104 Ga0207641_10026916 3300026088 Bacteria 4749
105 Ga0207641_10086856 3300026088 Bacteria 2728
106 Ga0207683_10009299 3300026121 Bacteria 8373
107 Ga0207683_10010727 3300026121 Bacteria 7812
108 Ga0207698_10009743 3300026142 Bacteria 6135
109 Ga0268266_10000005 3300028379 Bacteria 1448194
110 Ga0268266_10292549 3300028379 Bacteria 1517
111 Ga0268265_10019494 3300028380 Bacteria 4716
112 Ga0268265_10042193 3300028380 Bacteria 3383
113 Ga0268265_10097468 3300028380 Bacteria 2366
114 Ga0268264_10000351 3300028381 Bacteria 69834
115 Ga0268264_10003821 3300028381 Bacteria 12915
116 Ga0268264_10126275 3300028381 Bacteria 2261
117 Ga0265337_1008991 3300028556 Bacteria 3595
118 Ga0265338_10023474 3300028800 Bacteria 6339
119 Ga0265325_10000496 3300031241 Bacteria 28512
120 Ga0265325_10024633 3300031241 Bacteria 3272
121 Ga0265339_10069991 3300031249 Bacteria 1872
122 Ga0265331_10008155 3300031250 Bacteria 5979
123 Ga0265327_10000076 3300031251 Bacteria 212272
124 Ga0265316_10079378 3300031344 Bacteria 2518
125 Ga0307408_100025348 3300031548 Bacteria 4061
126 Ga0265313_10048905 3300031595 Bacteria 2038
127 Ga0316575_10037831 3300031665 Bacteria 1902
128 Ga0265314_10089904 3300031711 Bacteria 2002
129 Ga0265342_10036816 3300031712 Bacteria 2987
130 Ga0307413_10051012 3300031824 Bacteria 2490
131 Ga0307414_10042692 3300032004 Bacteria 3083
132 Ga0373927_0034683 3300035695 Bacteria 3281
133 Ga0395899_0025506 3300037312 Bacteria 4462
134 Ga0395900_0001141 3300037418 Bacteria 33489
135 Ga0395900_0341718 3300037418 Bacteria 1472
136 Ga0395898_0005037 3300037466 Bacteria 14324
137 Ga0395898_0087113 3300037466 Bacteria 3009
138 Ga0436364_0947217 3300037853 Bacteria 1470
139 Ga0395901_0027827 3300038443 Bacteria 5813
140 Ga0439441_025029 3300042001 Bacteria 1125
141 Ga0439435_0011738 3300042436 Bacteria 2106
142 Ga0466966_0055094 3300044684 Bacteria 2518
143 Ga0466963_0121116 3300044694 Bacteria 1801
144 Ga0466963_0373522 3300044694 Bacteria 1005
145 Ga0466970_0006016 3300044765 Bacteria 6049
146 Ga0466959_0120150 3300045049 Bacteria 1869
147 Ga0451576_0088662 3300045051 Bacteria 3218
148 Ga0466967_0000764 3300045976 Bacteria 16636
149 Ga0495629_0052268 3300046459 Bacteria 2859
150 Ga0495629_0058534 3300046459 Bacteria 2694
151 Ga0495638_0007551 3300046460 Bacteria 7778
152 Ga0495605_0046575 3300046474 Bacteria 2131
153 Ga0495664_0017340 3300046477 Bacteria 4114
154 Ga0495618_0000794 3300046514 Bacteria 22048
155 Ga0495586_0003466 3300046535 Bacteria 8457
156 Ga0495657_0033084 3300046675 Bacteria 3603
157 Ga0495658_0011944 3300046683 Bacteria 4383
158 Ga0495604_0006987 3300047317 Bacteria 8942
159 Ga0495672_0077550 3300047320 Bacteria 1862
160 Ga0495687_001030 3300047443 Bacteria 27749
161 Ga0495684_0105600 3300047471 Bacteria 2128
162 Ga0496101_0021178 3300048904 Bacteria 4463
163 Ga0496102_0020863 3300048905 Bacteria 5792
164 Ga0496103_0064531 3300048906 Bacteria 2283
165 Ga0496104_0011718 3300048907 Bacteria 7865
166 Ga0496106_0001852 3300048909 Bacteria 15826
167 Ga0496106_0153428 3300048909 Bacteria 1817
168 Ga0496107_0037517 3300048910 Bacteria 3477
169 Ga0496107_0049852 3300048910 Bacteria 3017
170 Ga0496109_0040805 3300048912 Bacteria 4204
171 Ga0496110_0062211 3300048913 Bacteria 3296
172 Ga0496111_0005620 3300048914 Bacteria 8065
173 Ga0496112_0000224 3300048915 Bacteria 36869
174 Ga0496112_0083365 3300048915 Bacteria 3161
175 Ga0496113_0000456 3300048916 Bacteria 19887
176 Ga0496113_0017102 3300048916 Bacteria 5027
177 Ga0496115_0002686 3300048918 Bacteria 12757
178 Ga0496116_0025567 3300048919 Bacteria 4339
179 Ga0496118_0018903 3300048921 Bacteria 6182
180 Ga0496121_0097857 3300048924 Bacteria 2272
181 Ga0496122_0012340 3300048925 Bacteria 8528
182 Ga0496122_0036889 3300048925 Bacteria 3944
183 Ga0496123_0003508 3300048926 Bacteria 17471
184 Ga0496123_0063859 3300048926 Bacteria 2349
185 Ga0496124_0010025 3300048927 Bacteria 9668
186 Ga0496124_0016334 3300048927 Bacteria 7063
187 Ga0501072_0023767 3300049588 Bacteria 4760
188 Ga0501235_006266 3300049669 Bacteria 2591
189 Ga0501080_0015732 3300049742 Bacteria 6977
190 Ga0501080_0252081 3300049742 Bacteria 1609
191 Ga0501083_0003480 3300049744 Bacteria 11013
192 Ga0501083_0034702 3300049744 Bacteria 3449
193 nmdc:mga03683_10473_c1 3300050489 Bacteria 3326
194 nmdc:mga03n38_33073_c1 3300050490 Bacteria 2197
195 nmdc:mga06z11_4408_c1 3300050494 Bacteria 5542
196 nmdc:mga08x19_157366_c1 3300050514 Bacteria 1541
197 Ga0495601_0001229 3300053077 Bacteria 14066
198 Ga0495619_0000924 3300053085 Bacteria 19309
199 Ga0495619_0001250 3300053085 Bacteria 16655
200 Ga0500566_0055376 3300053094 Bacteria 2259
201 Ga0500641_0076595 3300053096 Bacteria 1415
202 Ga0500595_008093 3300053119 Bacteria 4312
203 Ga0500652_000014 3300053131 Bacteria 147740
204 Ga0501082_0000016 3300060353 Bacteria 115081
205 2643755120 2643221547 Bacteria 4740017
206 2778125346 2775507255 Bacteria 3945731
207 2841980665 2841974524 Bacteria 8931498
208 Ga0501047_0001253
209 JGI24736J21556_1000291
210 JGI24737J22298_10000085
211 JGI24737J22298_10001421
212 JGI24735J21928_10001487
213 JGI24751J29686_10000084
214 Ga0055530_10019404
215 Ga0070658_10100507
216 Ga0070670_100070546
217 Ga0070670_100239326
218 Ga0070666_10026816
219 Ga0070668_100000378
220 Ga0070675_100153766
221 Ga0070671_100000063
222 Ga0070667_100000145
223 Ga0070663_100008274
224 Ga0070662_100185939
225 Ga0070665_100331651
226 Ga0070664_100005210
227 Ga0068854_100016467
228 Ga0068854_100266155
229 Ga0068856_100281766
230 Ga0068864_100098141
231 Ga0068863_100000723
232 Ga0068863_100001090
233 Ga0068863_100068537
234 Ga0068860_100000942
235 Ga0068860_100010487
236 Ga0068860_100028005
237 Ga0068862_100089437
238 Ga0070717_10001949
239 Ga0075363_100004491
240 Ga0070716_100007159
241 Ga0070712_100125256
242 Ga0075367_10038269
243 Ga0075366_10000662
244 Ga0105251_10015458
245 Ga0105240_10033689
246 Ga0105240_10061364
247 Ga0105240_10272106
248 Ga0105240_10499188
249 Ga0105243_10219997
250 Ga0105241_10000932
251 Ga0105248_10095267
252 Ga0105237_10005047
253 Ga0105237_10384407
254 Ga0105238_10010486
255 Ga0105238_10019952
256 Ga0105238_10033761
257 Ga0105249_10305702
258 Ga0157373_10026331
259 Ga0157370_10103525
260 Ga0157369_10219999
261 Ga0157378_10239935
262 Ga0163162_10120536
263 Ga0163162_10284665
264 Ga0157379_10000433
265 Ga0163161_10014911
266 Ga0209050_1000253
267 Ga0207688_10083150
268 Ga0207680_10038294
269 Ga0207680_10128955
270 Ga0207647_10008832
271 Ga0207705_10057586
272 Ga0207705_10105330
273 Ga0207654_10005706
274 Ga0207695_10023828
275 Ga0207695_10126168
276 Ga0207695_10171694
277 Ga0207671_10128159
278 Ga0207693_10031643
279 Ga0207662_10045220
280 Ga0207657_10007386
281 Ga0207657_10120397
282 Ga0207652_10054467
283 Ga0207694_10033911
284 Ga0207694_10052089
285 Ga0207694_10182932
286 Ga0207650_10170613
287 Ga0207700_10003874
288 Ga0207644_10000075
289 Ga0207706_10051149
290 Ga0207665_10001038
291 Ga0207691_10033780
292 Ga0207691_10105850
293 Ga0207689_10033166
294 Ga0207689_10243850
295 Ga0207679_10069071
296 Ga0207651_10114271
297 Ga0207668_10000022
298 Ga0207668_10051493
299 Ga0207640_10031924
300 Ga0207640_10079122
301 Ga0207640_10088075
302 Ga0207658_10000021
303 Ga0207658_10000103
304 Ga0207703_10075482
305 Ga0207639_10000687
306 Ga0207678_10001199
307 Ga0207702_10013765
308 Ga0207702_10254232
309 Ga0207641_10000040
310 Ga0207641_10000344
311 Ga0207641_10026916
312 Ga0207641_10086856
313 Ga0207683_10009299
314 Ga0207683_10010727
315 Ga0207698_10009743
316 Ga0268266_10000005
317 Ga0268266_10292549
318 Ga0268265_10019494
319 Ga0268265_10042193
320 Ga0268265_10097468
321 Ga0268264_10000351
322 Ga0268264_10003821
323 Ga0268264_10126275
324 Ga0265337_1008991
325 Ga0265338_10023474
326 Ga0265325_10000496
327 Ga0265325_10024633
328 Ga0265339_10069991
329 Ga0265331_10008155
330 Ga0265327_10000076
331 Ga0265316_10079378
332 Ga0307408_100025348
333 Ga0265313_10048905
334 Ga0316575_10037831
335 Ga0265314_10089904
336 Ga0265342_10036816
337 Ga0307413_10051012
338 Ga0307414_10042692
339 Ga0373927_0034683
340 Ga0395899_0025506
341 Ga0395900_0001141
342 Ga0395900_0341718
343 Ga0395898_0005037
344 Ga0395898_0087113
345 Ga0436364_0947217
346 Ga0395901_0027827
347 Ga0439441_025029
348 Ga0439435_0011738
349 Ga0466966_0055094
350 Ga0466963_0121116
351 Ga0466963_0373522
352 Ga0466970_0006016
353 Ga0466959_0120150
354 Ga0451576_0088662
355 Ga0466967_0000764
356 Ga0495629_0052268
357 Ga0495629_0058534
358 Ga0495638_0007551
359 Ga0495605_0046575
360 Ga0495664_0017340
361 Ga0495618_0000794
362 Ga0495586_0003466
363 Ga0495657_0033084
364 Ga0495658_0011944
365 Ga0495604_0006987
366 Ga0495672_0077550
367 Ga0495687_001030
368 Ga0495684_0105600
369 Ga0496101_0021178
370 Ga0496102_0020863
371 Ga0496103_0064531
372 Ga0496104_0011718
373 Ga0496106_0001852
374 Ga0496106_0153428
375 Ga0496107_0037517
376 Ga0496107_0049852
377 Ga0496109_0040805
378 Ga0496110_0062211
379 Ga0496111_0005620
380 Ga0496112_0000224
381 Ga0496112_0083365
382 Ga0496113_0000456
383 Ga0496113_0017102
384 Ga0496115_0002686
385 Ga0496116_0025567
386 Ga0496118_0018903
387 Ga0496121_0097857
388 Ga0496122_0012340
389 Ga0496122_0036889
390 Ga0496123_0003508
391 Ga0496123_0063859
392 Ga0496124_0010025
393 Ga0496124_0016334
394 Ga0501072_0023767
395 Ga0501235_006266
396 Ga0501080_0015732
397 Ga0501080_0252081
398 Ga0501083_0003480
399 Ga0501083_0034702
400 nmdc:mga03683_10473_c1
401 nmdc:mga03n38_33073_c1
402 nmdc:mga06z11_4408_c1
403 nmdc:mga08x19_157366_c1
404 Ga0495601_0001229
405 Ga0495619_0000924
406 Ga0495619_0001250
407 Ga0500566_0055376
408 Ga0500641_0076595
409 Ga0500595_008093
410 Ga0500652_000014
411 Ga0501082_0000016
412 2643755120
413 2778125346
414 2841980665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

97

339

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9212 21 356
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9106 21 356
6fdn-assembly1.cif.gz_B rio2 structure 0.7302 28 241
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7263 27 349
3att-assembly1.cif.gz_A crystal structure of rv3168 with atp 0.7253 24 351
ID Description Score Start End Superfamily
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9542 126 356 3.90.1200.10
af_B3DMA2_17_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9522 21 122 3.30.200.20
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9384 126 356 3.90.1200.10
af_Q10333_13_233_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.9372 302 358 1.20.1420.10
af_Q8K370_265_366_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9349 25 122 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2H6MXG5-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9768 86 255
AF-A0A7D9KCW7-F1-model_v4 Acyl- dehydrogenase family member 10-like 0.9758 89 259
AF-A0A3D3AAL0-F1-model_v4 Phosphotransferase family protein 0.9753 10 254 GO:0016740
AF-A0A7C1Y298-F1-model_v4 Phosphotransferase family protein 0.9712 21 292
AF-A0A2H6MXG5-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9712 86 255

Map