F317536

General Info

Members Datasets Scaffolds Average Seq Length
208 128 416 213

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100033379|Ga0070665_1000333797
Length 232
Sequence MKRLITILSRHGRFYIALACGLATVLAARLMGFDAPVLAGGVMFYLVFLLLCLVMIGGQKTADLKKRAKNQDEGITIVLLITLATMAFFCDAVFTALHDKHGIEVAPLALAGIGAVSGWLVLHTVMAFHYANVHYFDDPDCATDDKDLDFPGRGDPGPWDFLYYSFVVGMTAQVSDVQVRTTVMRRLTLLHGVVSFFFNTVFIAMAVNAADFGVLTYLLAGGQGTKALTRRL

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
126 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 0
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100033379 3300005548 Bacteria 5178
2 JGI25165J46597_1000003 3300003214 Bacteria 694080
3 JGI25153J46596_10002828 3300003215 Bacteria 9864
4 Ga0070658_10150475 3300005327 Bacteria 1948
5 Ga0070658_10442778 3300005327 Bacteria 1119
6 Ga0070683_100136313 3300005329 Bacteria 2325
7 Ga0068869_100205747 3300005334 Bacteria 1554
8 Ga0070680_100073739 3300005336 Bacteria 2808
9 Ga0070680_100664426 3300005336 Bacteria 896
10 Ga0068868_100017139 3300005338 Bacteria 5391
11 Ga0068868_100340822 3300005338 Bacteria 1282
12 Ga0070660_100149341 3300005339 Bacteria 1878
13 Ga0070661_100139093 3300005344 Bacteria 1829
14 Ga0070661_100524327 3300005344 Bacteria 951
15 Ga0070675_100029664 3300005354 Bacteria 4413
16 Ga0070675_100034096 3300005354 Bacteria 4130
17 Ga0070674_100470900 3300005356 Bacteria 1041
18 Ga0070673_100034845 3300005364 Bacteria 3814
19 Ga0070659_100479535 3300005366 Bacteria 1058
20 Ga0070659_100912109 3300005366 Unclassified 768
21 Ga0070667_100073281 3300005367 Bacteria 2919
22 Ga0070711_100318355 3300005439 Bacteria 1242
23 Ga0070678_100233282 3300005456 Bacteria 1535
24 Ga0070678_100558568 3300005456 Bacteria 1017
25 Ga0070678_100833564 3300005456 Unclassified 839
26 Ga0068867_100007198 3300005459 Bacteria 7864
27 Ga0070679_100016459 3300005530 Bacteria 7133
28 Ga0070679_100072040 3300005530 Bacteria 3447
29 Ga0070684_100360614 3300005535 Bacteria 1338
30 Ga0068853_100227846 3300005539 Bacteria 1704
31 Ga0068853_100316653 3300005539 Bacteria 1445
32 Ga0070672_100854846 3300005543 Unclassified 802
33 Ga0070693_100505277 3300005547 Bacteria 858
34 Ga0070665_100001163 3300005548 Bacteria 32337
35 Ga0068855_100218359 3300005563 Bacteria 2139
36 Ga0068855_100588144 3300005563 Unclassified 1201
37 Ga0068855_100880209 3300005563 Bacteria 947
38 Ga0068855_101371513 3300005563 Bacteria 729
39 Ga0068857_100040495 3300005577 Bacteria 4131
40 Ga0068857_100145587 3300005577 Bacteria 2144
41 Ga0068857_100398221 3300005577 Bacteria 1281
42 Ga0068852_100721488 3300005616 Bacteria 1008
43 Ga0068852_100951474 3300005616 Bacteria 877
44 Ga0068859_100814717 3300005617 Bacteria 1021
45 Ga0068864_100568643 3300005618 Bacteria 1097
46 Ga0068870_10025015 3300005840 Bacteria 2961
47 Ga0068870_10132909 3300005840 Bacteria 1448
48 Ga0068863_100672258 3300005841 Bacteria 1028
49 Ga0068860_100226950 3300005843 Bacteria 1814
50 Ga0070717_10582925 3300006028 Unclassified 1014
51 Ga0097621_100000295 3300006237 Bacteria 33699
52 Ga0097621_100011768 3300006237 Bacteria 6461
53 Ga0097621_100437142 3300006237 Bacteria 1177
54 Ga0097621_100441630 3300006237 Bacteria 1171
55 Ga0097621_100560821 3300006237 Unclassified 1040
56 Ga0068871_100000019 3300006358 Bacteria 86487
57 Ga0068871_100011954 3300006358 Bacteria 6390
58 Ga0068871_100057582 3300006358 Bacteria 3162
59 Ga0068871_100067691 3300006358 Bacteria 2931
60 Ga0068871_100103301 3300006358 Bacteria 2389
61 Ga0068871_100905949 3300006358 Bacteria 817
62 Ga0097620_100814688 3300006931 Bacteria 1021
63 Ga0105240_10079098 3300009093 Bacteria 4047
64 Ga0105240_10128041 3300009093 Bacteria 3048
65 Ga0105240_10215617 3300009093 Bacteria 2240
66 Ga0105240_10550006 3300009093 Bacteria 1277
67 Ga0105245_10101327 3300009098 Bacteria 2665
68 Ga0105245_10141526 3300009098 Bacteria 2266
69 Ga0105243_10003401 3300009148 Bacteria 12905
70 Ga0105243_10688072 3300009148 Unclassified 995
71 Ga0105241_10020640 3300009174 Bacteria 4867
72 Ga0105241_10110371 3300009174 Bacteria 2200
73 Ga0105242_10065737 3300009176 Bacteria 2992
74 Ga0105242_10367082 3300009176 Bacteria 1334
75 Ga0105248_10633361 3300009177 Bacteria 1206
76 Ga0105237_10084403 3300009545 Bacteria 3166
77 Ga0105237_10410778 3300009545 Bacteria 1359
78 Ga0105238_10033816 3300009551 Bacteria 5202
79 Ga0105238_10073323 3300009551 Bacteria 3418
80 Ga0105238_10198039 3300009551 Bacteria 1984
81 Ga0105239_10137783 3300010375 Bacteria 2717
82 Ga0105239_10292578 3300010375 Bacteria 1834
83 Ga0105246_10265280 3300011119 Bacteria 1370
84 Ga0157373_10405277 3300013100 Unclassified 978
85 Ga0157371_10789768 3300013102 Bacteria 715
86 Ga0157370_10246801 3300013104 Bacteria 1651
87 Ga0157370_10407266 3300013104 Bacteria 1251
88 Ga0157369_10158359 3300013105 Bacteria 2391
89 Ga0157369_10552109 3300013105 Bacteria 1191
90 Ga0157374_10609982 3300013296 Unclassified 1102
91 Ga0157378_10066632 3300013297 Bacteria 3225
92 Ga0163162_10926414 3300013306 Unclassified 983
93 Ga0157375_10557608 3300013308 Bacteria 1307
94 Ga0157375_10750636 3300013308 Bacteria 1127
95 Ga0163163_10000002 3300014325 Bacteria 609846
96 Ga0163163_10042824 3300014325 Bacteria 4436
97 Ga0157377_10181422 3300014745 Unclassified 1324
98 Ga0157379_10103447 3300014968 Bacteria 2556
99 Ga0157376_10517239 3300014969 Unclassified 1176
100 Ga0209233_1000015 3300025261 Bacteria 980563
101 Ga0209233_1019711 3300025261 Bacteria 1786
102 Ga0209233_1033754 3300025261 Bacteria 1172
103 Ga0209455_1010399 3300025272 Bacteria 2367
104 Ga0209758_1000013 3300025297 Bacteria 873003
105 Ga0207642_10471346 3300025899 Unclassified 764
106 Ga0207705_10012253 3300025909 Bacteria 6196
107 Ga0207654_10098858 3300025911 Bacteria 1794
108 Ga0207695_10148331 3300025913 Bacteria 2287
109 Ga0207695_10369727 3300025913 Bacteria 1320
110 Ga0207695_10685544 3300025913 Unclassified 905
111 Ga0207660_10044018 3300025917 Bacteria 3139
112 Ga0207657_10006998 3300025919 Bacteria 11612
113 Ga0207657_10026171 3300025919 Bacteria 5366
114 Ga0207649_10440628 3300025920 Bacteria 981
115 Ga0207652_10010820 3300025921 Bacteria 7350
116 Ga0207652_10223388 3300025921 Bacteria 1697
117 Ga0207694_10084950 3300025924 Bacteria 2490
118 Ga0207694_10127434 3300025924 Bacteria 2038
119 Ga0207694_10239989 3300025924 Bacteria 1481
120 Ga0207659_10117885 3300025926 Bacteria 2030
121 Ga0207659_10522474 3300025926 Bacteria 1007
122 Ga0207687_10040843 3300025927 Bacteria 3182
123 Ga0207687_10375194 3300025927 Bacteria 1164
124 Ga0207687_10545236 3300025927 Bacteria 972
125 Ga0207686_10094913 3300025934 Bacteria 1978
126 Ga0207686_10379521 3300025934 Bacteria 1071
127 Ga0207686_10465304 3300025934 Bacteria 975
128 Ga0207709_10410404 3300025935 Bacteria 1038
129 Ga0207669_10355009 3300025937 Bacteria 1134
130 Ga0207704_10092807 3300025938 Bacteria 1988
131 Ga0207691_11040384 3300025940 Unclassified 682
132 Ga0207689_10015230 3300025942 Bacteria 6510
133 Ga0207689_10646001 3300025942 Bacteria 891
134 Ga0207667_10248074 3300025949 Bacteria 1821
135 Ga0207651_10310139 3300025960 Bacteria 1315
136 Ga0207712_10278089 3300025961 Bacteria 1365
137 Ga0207658_10473911 3300025986 Bacteria 1111
138 Ga0207677_10016350 3300026023 Bacteria 4391
139 Ga0207677_10563391 3300026023 Unclassified 995
140 Ga0207702_10559821 3300026078 Unclassified 1119
141 Ga0207641_10901056 3300026088 Bacteria 878
142 Ga0207648_10005978 3300026089 Bacteria 12168
143 Ga0207676_10208724 3300026095 Bacteria 1731
144 Ga0207674_10061324 3300026116 Bacteria 3800
145 Ga0207683_10238969 3300026121 Bacteria 1657
146 Ga0268266_10009463 3300028379 Bacteria 8577
147 Ga0265318_10009540 3300028577 Bacteria 4261
148 Ga0265338_10042184 3300028800 Bacteria 4254
149 Ga0265330_10219374 3300031235 Unclassified 803
150 Ga0265325_10036781 3300031241 Bacteria 2592
151 Ga0265329_10052578 3300031242 Bacteria 1296
152 Ga0265331_10076204 3300031250 Unclassified 1563
153 Ga0307513_10126427 3300031456 Bacteria 2511
154 Ga0265313_10008669 3300031595 Bacteria 6724
155 Ga0265313_10013367 3300031595 Bacteria 4931
156 Ga0265314_10078560 3300031711 Bacteria 2185
157 Ga0265314_10142056 3300031711 Bacteria 1483
158 Ga0265314_10203741 3300031711 Bacteria 1167
159 Ga0373953_0148741 3300035117 Bacteria 1003
160 Ga0373933_0121044 3300035724 Bacteria 1639
161 Ga0373937_0090749 3300036401 Bacteria 2830
162 Ga0373937_0164194 3300036401 Bacteria 2082
163 Ga0395900_0066882 3300037418 Bacteria 3693
164 Ga0395901_0137258 3300038443 Bacteria 2570
165 Ga0436365_0862915 3300039437 Bacteria 5399
166 Ga0466963_0199964 3300044694 Bacteria 1398
167 Ga0495622_0006576 3300046557 Bacteria 5389
168 Ga0495657_0268937 3300046675 Bacteria 1022
169 Ga0496121_0002872 3300048924 Bacteria 25387
170 Ga0501033_0061149 3300049570 Bacteria 2776
171 Ga0501033_0066319 3300049570 Bacteria 2654
172 Ga0501033_0069193 3300049570 Bacteria 2595
173 Ga0501033_0150640 3300049570 Bacteria 1678
174 Ga0501033_0258342 3300049570 Bacteria 1233
175 Ga0501034_0850719 3300049571 Bacteria 802
176 Ga0501038_0076462 3300049574 Bacteria 2828
177 Ga0501038_0263874 3300049574 Bacteria 1360
178 Ga0501043_0072655 3300049579 Bacteria 2702
179 Ga0501043_0442735 3300049579 Bacteria 977
180 Ga0501046_0010212 3300049580 Bacteria 8079
181 Ga0501046_0207816 3300049580 Bacteria 1454
182 Ga0501047_0009386 3300049581 Bacteria 9240
183 Ga0501047_0106747 3300049581 Bacteria 2681
184 Ga0501047_0226812 3300049581 Bacteria 1723
185 Ga0501047_0473560 3300049581 Bacteria 1080
186 Ga0501073_0051163 3300049589 Bacteria 2894
187 Ga0501080_0172272 3300049742 Bacteria 1996
188 Ga0501080_0517113 3300049742 Bacteria 1065
189 Ga0501080_0871574 3300049742 Unclassified 786
190 Ga0501083_0028256 3300049744 Bacteria 3867
191 Ga0501035_0014499 3300049822 Bacteria 7275
192 Ga0501035_0068322 3300049822 Bacteria 3151
193 Ga0501035_0100897 3300049822 Bacteria 2533
194 Ga0501044_0003917 3300049823 Bacteria 16687
195 Ga0501044_0096071 3300049823 Bacteria 2986
196 Ga0501044_0147439 3300049823 Bacteria 2337
197 Ga0501044_0382970 3300049823 Bacteria 1321
198 Ga0501044_0704639 3300049823 Bacteria 895
199 Ga0495595_0097532 3300053084 Bacteria 1416
200 Ga0500643_000003 3300053087 Bacteria 876659
201 Ga0500646_0027021 3300053090 Bacteria 1559
202 Ga0500595_000259 3300053119 Bacteria 35037
203 Ga0500595_012451 3300053119 Bacteria 3291
204 Ga0500573_0000002 3300053140 Bacteria 407088
205 Ga0500639_122424 3300053163 Bacteria 1247
206 Ga0500611_043450 3300053727 Bacteria 998
207 Ga0500645_019741 3300053730 Bacteria 2094
208 Ga0501082_0375615 3300060353 Bacteria 1240
209 Ga0070665_100033379
210 JGI25165J46597_1000003
211 JGI25153J46596_10002828
212 Ga0070658_10150475
213 Ga0070658_10442778
214 Ga0070683_100136313
215 Ga0068869_100205747
216 Ga0070680_100073739
217 Ga0070680_100664426
218 Ga0068868_100017139
219 Ga0068868_100340822
220 Ga0070660_100149341
221 Ga0070661_100139093
222 Ga0070661_100524327
223 Ga0070675_100029664
224 Ga0070675_100034096
225 Ga0070674_100470900
226 Ga0070673_100034845
227 Ga0070659_100479535
228 Ga0070659_100912109
229 Ga0070667_100073281
230 Ga0070711_100318355
231 Ga0070678_100233282
232 Ga0070678_100558568
233 Ga0070678_100833564
234 Ga0068867_100007198
235 Ga0070679_100016459
236 Ga0070679_100072040
237 Ga0070684_100360614
238 Ga0068853_100227846
239 Ga0068853_100316653
240 Ga0070672_100854846
241 Ga0070693_100505277
242 Ga0070665_100001163
243 Ga0068855_100218359
244 Ga0068855_100588144
245 Ga0068855_100880209
246 Ga0068855_101371513
247 Ga0068857_100040495
248 Ga0068857_100145587
249 Ga0068857_100398221
250 Ga0068852_100721488
251 Ga0068852_100951474
252 Ga0068859_100814717
253 Ga0068864_100568643
254 Ga0068870_10025015
255 Ga0068870_10132909
256 Ga0068863_100672258
257 Ga0068860_100226950
258 Ga0070717_10582925
259 Ga0097621_100000295
260 Ga0097621_100011768
261 Ga0097621_100437142
262 Ga0097621_100441630
263 Ga0097621_100560821
264 Ga0068871_100000019
265 Ga0068871_100011954
266 Ga0068871_100057582
267 Ga0068871_100067691
268 Ga0068871_100103301
269 Ga0068871_100905949
270 Ga0097620_100814688
271 Ga0105240_10079098
272 Ga0105240_10128041
273 Ga0105240_10215617
274 Ga0105240_10550006
275 Ga0105245_10101327
276 Ga0105245_10141526
277 Ga0105243_10003401
278 Ga0105243_10688072
279 Ga0105241_10020640
280 Ga0105241_10110371
281 Ga0105242_10065737
282 Ga0105242_10367082
283 Ga0105248_10633361
284 Ga0105237_10084403
285 Ga0105237_10410778
286 Ga0105238_10033816
287 Ga0105238_10073323
288 Ga0105238_10198039
289 Ga0105239_10137783
290 Ga0105239_10292578
291 Ga0105246_10265280
292 Ga0157373_10405277
293 Ga0157371_10789768
294 Ga0157370_10246801
295 Ga0157370_10407266
296 Ga0157369_10158359
297 Ga0157369_10552109
298 Ga0157374_10609982
299 Ga0157378_10066632
300 Ga0163162_10926414
301 Ga0157375_10557608
302 Ga0157375_10750636
303 Ga0163163_10000002
304 Ga0163163_10042824
305 Ga0157377_10181422
306 Ga0157379_10103447
307 Ga0157376_10517239
308 Ga0209233_1000015
309 Ga0209233_1019711
310 Ga0209233_1033754
311 Ga0209455_1010399
312 Ga0209758_1000013
313 Ga0207642_10471346
314 Ga0207705_10012253
315 Ga0207654_10098858
316 Ga0207695_10148331
317 Ga0207695_10369727
318 Ga0207695_10685544
319 Ga0207660_10044018
320 Ga0207657_10006998
321 Ga0207657_10026171
322 Ga0207649_10440628
323 Ga0207652_10010820
324 Ga0207652_10223388
325 Ga0207694_10084950
326 Ga0207694_10127434
327 Ga0207694_10239989
328 Ga0207659_10117885
329 Ga0207659_10522474
330 Ga0207687_10040843
331 Ga0207687_10375194
332 Ga0207687_10545236
333 Ga0207686_10094913
334 Ga0207686_10379521
335 Ga0207686_10465304
336 Ga0207709_10410404
337 Ga0207669_10355009
338 Ga0207704_10092807
339 Ga0207691_11040384
340 Ga0207689_10015230
341 Ga0207689_10646001
342 Ga0207667_10248074
343 Ga0207651_10310139
344 Ga0207712_10278089
345 Ga0207658_10473911
346 Ga0207677_10016350
347 Ga0207677_10563391
348 Ga0207702_10559821
349 Ga0207641_10901056
350 Ga0207648_10005978
351 Ga0207676_10208724
352 Ga0207674_10061324
353 Ga0207683_10238969
354 Ga0268266_10009463
355 Ga0265318_10009540
356 Ga0265338_10042184
357 Ga0265330_10219374
358 Ga0265325_10036781
359 Ga0265329_10052578
360 Ga0265331_10076204
361 Ga0307513_10126427
362 Ga0265313_10008669
363 Ga0265313_10013367
364 Ga0265314_10078560
365 Ga0265314_10142056
366 Ga0265314_10203741
367 Ga0373953_0148741
368 Ga0373933_0121044
369 Ga0373937_0090749
370 Ga0373937_0164194
371 Ga0395900_0066882
372 Ga0395901_0137258
373 Ga0436365_0862915
374 Ga0466963_0199964
375 Ga0495622_0006576
376 Ga0495657_0268937
377 Ga0496121_0002872
378 Ga0501033_0061149
379 Ga0501033_0066319
380 Ga0501033_0069193
381 Ga0501033_0150640
382 Ga0501033_0258342
383 Ga0501034_0850719
384 Ga0501038_0076462
385 Ga0501038_0263874
386 Ga0501043_0072655
387 Ga0501043_0442735
388 Ga0501046_0010212
389 Ga0501046_0207816
390 Ga0501047_0009386
391 Ga0501047_0106747
392 Ga0501047_0226812
393 Ga0501047_0473560
394 Ga0501073_0051163
395 Ga0501080_0172272
396 Ga0501080_0517113
397 Ga0501080_0871574
398 Ga0501083_0028256
399 Ga0501035_0014499
400 Ga0501035_0068322
401 Ga0501035_0100897
402 Ga0501044_0003917
403 Ga0501044_0096071
404 Ga0501044_0147439
405 Ga0501044_0382970
406 Ga0501044_0704639
407 Ga0495595_0097532
408 Ga0500643_000003
409 Ga0500646_0027021
410 Ga0500595_000259
411 Ga0500595_012451
412 Ga0500573_0000002
413 Ga0500639_122424
414 Ga0500611_043450
415 Ga0500645_019741
416 Ga0501082_0375615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

34

205

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vou-assembly1.cif.gz_A-2 the crystal structure of nak-navsulp chimera channel 0.8142 155 207
7n9k-assembly1.cif.gz_A kirbac3.1 l124m mutant 0.7374 89 209
6o9t-assembly1.cif.gz_A kirbac3.1 mutant at a resolution of 4.1 angstroms 0.7305 89 209
6o9u-assembly1.cif.gz_A kirbac3.1 at a resolution of 2 angstroms 0.7208 89 209
7n9l-assembly1.cif.gz_A kirbac3.1 c71s c262s 0.7182 89 206
ID Description Score Start End Superfamily
3vouA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8142 155 207 1.10.287.70
2wlkA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7706 108 205 1.10.287.70
af_I1JJJ2_64_158_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7534 106 211 1.10.287.70
af_Q8LIN5_63_157_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7533 116 211 1.10.287.70
af_C4J1B8_73_187_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7405 111 211 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7V9S8D8-F1-model_v4 DUF1345 domain-containing protein 0.9224 1 215 GO:0016020
AF-A0A554UAZ8-F1-model_v4 deleted 0.9211 3 215
AF-A0A258VIM1-F1-model_v4 deleted 0.9108 8 215
AF-A0A554UAZ8-F1-model_v4 deleted 0.9089 3 215
AF-A0A5C5T9T6-F1-model_v4 DUF1345 domain-containing protein 0.9013 10 215 GO:0016020

Map