F317628

General Info

Members Datasets Scaffolds Average Seq Length
208 116 417 228

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10063215|Ga0075366_100632152
Length 251
Sequence MQDKDDINQPSLPLQGAGRLELSFVITGDGSKTIYNPQVGENYHSRHGALQESTHVFLNSGLRYFLAGTDAQSVSVLEVGLGTGLNFLLSADFCTGKQIKLEYTGIEAYPLSTEMISQTGYQQYITPQLWDDFLSEYPSSINQLVSVNEFCRLKTAHCKLPEFESGELYDVIYFDAFAVAHQPEMWSEEAIGHTIQFLKPGGVFVTYAITGNLKRMLKALGLKVEKAPGAPGKREMLRATNPSQPSPKERA

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
105 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
108 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
109 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
110 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
111 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
112 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
113 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
114 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
115 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
116 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 0
Isolates 3.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.1
Nodule 0
Rhizoplane 0.96
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10063215 3300006195 Bacteria 2200
2 JGI24736J21556_1007467 3300001904 Bacteria 1836
3 JGI24737J22298_10006552 3300001990 Bacteria 3970
4 JGI24744J21845_10021567 3300002077 Bacteria 1266
5 JGI25162J39368_1000688 3300002737 Bacteria 23552
6 JGI25162J39368_1001792 3300002737 Bacteria 10135
7 JGI25164J39214_1001174 3300002772 Bacteria 7159
8 JGI25165J46597_1000846 3300003214 Bacteria 22324
9 rootH1_10056194 3300003316 Bacteria 5349
10 rootH2_10013235 3300003320 Bacteria 76391
11 rootH2_10052962 3300003320 Bacteria 4756
12 rootH2_10252920 3300003320 Bacteria 2205
13 rootH2_10318815 3300003320 Bacteria 1746
14 rootH1_10001276 3300003316 Bacteria 3262
15 rootH1_10001276 3300003323 Bacteria 38627
16 rootH1_10155752 3300003323 Bacteria 5434
17 rootH1_10161458 3300003323 Bacteria 4154
18 Ga0070658_10000028 3300005327 Bacteria 157278
19 Ga0070658_10027068 3300005327 Bacteria 4603
20 Ga0070676_10000004 3300005328 Bacteria 82919
21 Ga0068868_100047020 3300005338 Bacteria 3379
22 Ga0068868_100053575 3300005338 Bacteria 3178
23 Ga0070660_100022315 3300005339 Bacteria 4679
24 Ga0070660_100068248 3300005339 Bacteria 2771
25 Ga0070673_100104445 3300005364 Bacteria 2339
26 Ga0070659_100000824 3300005366 Bacteria 22594
27 Ga0070663_100063250 3300005455 Unclassified 2671
28 Ga0070678_100015947 3300005456 Bacteria 4789
29 Ga0070662_100000029 3300005457 Bacteria 82498
30 Ga0070662_100158577 3300005457 Unclassified 1768
31 Ga0070681_10012744 3300005458 Bacteria 8346
32 Ga0068867_100029272 3300005459 Bacteria 3968
33 Ga0070679_100006252 3300005530 Bacteria 11094
34 Ga0068853_100001654 3300005539 Bacteria 16310
35 Ga0068853_100010986 3300005539 Bacteria 7341
36 Ga0068853_100035720 3300005539 Bacteria 4222
37 Ga0068853_100138042 3300005539 Bacteria 2187
38 Ga0070672_100319867 3300005543 Bacteria 1319
39 Ga0070665_100000032 3300005548 Bacteria 333352
40 Ga0068855_100000041 3300005563 Bacteria 151653
41 Ga0068855_100000043 3300005563 Bacteria 149118
42 Ga0068855_100040990 3300005563 Bacteria 5490
43 Ga0068855_100275710 3300005563 Bacteria 1869
44 Ga0068857_100036650 3300005577 Bacteria 4346
45 Ga0068856_100000424 3300005614 Bacteria 46509
46 Ga0068856_100000632 3300005614 Bacteria 38363
47 Ga0068856_100009783 3300005614 Bacteria 9316
48 Ga0068856_100053709 3300005614 Bacteria 3973
49 Ga0068856_100403653 3300005614 Bacteria 1386
50 Ga0068856_100736004 3300005614 Bacteria 1006
51 Ga0068852_100000244 3300005616 Bacteria 37013
52 Ga0068866_10012102 3300005718 Bacteria 3754
53 Ga0097621_100001022 3300006237 Bacteria 19710
54 Ga0075370_10087033 3300006353 Bacteria 1800
55 Ga0068871_100000021 3300006358 Bacteria 83155
56 Ga0068865_100000045 3300006881 Bacteria 70227
57 Ga0105240_10000126 3300009093 Bacteria 157403
58 Ga0105240_10007920 3300009093 Bacteria 15325
59 Ga0105240_10022098 3300009093 Bacteria 8443
60 Ga0105240_10034819 3300009093 Bacteria 6493
61 Ga0105240_10273724 3300009093 Unclassified 1943
62 Ga0105240_10349541 3300009093 Bacteria 1678
63 Ga0105240_10515838 3300009093 Bacteria 1327
64 Ga0105241_10002344 3300009174 Bacteria 14232
65 Ga0105241_10005542 3300009174 Bacteria 9330
66 Ga0105241_10039568 3300009174 Bacteria 3557
67 Ga0105241_10081361 3300009174 Unclassified 2537
68 Ga0105242_10018244 3300009176 Bacteria 5484
69 Ga0105237_10001066 3300009545 Bacteria 36850
70 Ga0105237_10004075 3300009545 Bacteria 17038
71 Ga0105237_10005338 3300009545 Bacteria 14538
72 Ga0105237_10005461 3300009545 Bacteria 14336
73 Ga0105237_10018709 3300009545 Bacteria 7162
74 Ga0105237_10024081 3300009545 Bacteria 6228
75 Ga0105237_10191810 3300009545 Bacteria 2043
76 Ga0105238_10072577 3300009551 Bacteria 3437
77 Ga0105238_10256300 3300009551 Bacteria 1728
78 Ga0105239_10000017 3300010375 Bacteria 290760
79 Ga0105239_10000190 3300010375 Bacteria 89155
80 Ga0105239_10002606 3300010375 Bacteria 22829
81 Ga0105239_10003229 3300010375 Bacteria 20165
82 Ga0105239_10047505 3300010375 Bacteria 4704
83 Ga0105239_10049012 3300010375 Bacteria 4631
84 Ga0105239_10059156 3300010375 Bacteria 4206
85 Ga0105239_10616986 3300010375 Bacteria 1237
86 Ga0157373_10020402 3300013100 Bacteria 4816
87 Ga0157371_10000266 3300013102 Bacteria 71146
88 Ga0157371_10001789 3300013102 Bacteria 21728
89 Ga0157370_10098278 3300013104 Bacteria 2745
90 Ga0157369_10001323 3300013105 Bacteria 30703
91 Ga0157369_10072910 3300013105 Bacteria 3684
92 Ga0157374_10000700 3300013296 Bacteria 29512
93 Ga0157374_10000775 3300013296 Bacteria 27961
94 Ga0163162_10000010 3300013306 Bacteria 302032
95 Ga0163162_10007708 3300013306 Bacteria 10487
96 Ga0163162_10647167 3300013306 Bacteria 1181
97 Ga0157372_10000073 3300013307 Bacteria 107356
98 Ga0157372_10014858 3300013307 Bacteria 8336
99 Ga0157372_10150268 3300013307 Unclassified 2688
100 Ga0157372_10377275 3300013307 Unclassified 1652
101 Ga0157375_10043083 3300013308 Bacteria 4374
102 Ga0157375_10125967 3300013308 Bacteria 2676
103 Ga0213872_10011171 3300021361 Bacteria 4254
104 Ga0207427_100138 3300025231 Bacteria 86499
105 Ga0209437_100010 3300025233 Bacteria 838447
106 Ga0209437_100169 3300025233 Bacteria 142584
107 Ga0209026_1003989 3300025250 Bacteria 4599
108 Ga0209129_1006691 3300025258 Bacteria 3647
109 Ga0209233_1000017 3300025261 Bacteria 898076
110 Ga0209233_1026173 3300025261 Bacteria 1431
111 Ga0209455_1003033 3300025272 Bacteria 6149
112 Ga0207647_10000022 3300025904 Bacteria 118094
113 Ga0207647_10000211 3300025904 Bacteria 47375
114 Ga0207645_10000151 3300025907 Bacteria 54588
115 Ga0207705_10000045 3300025909 Bacteria 180625
116 Ga0207705_10021129 3300025909 Bacteria 4643
117 Ga0207654_10001597 3300025911 Bacteria 11896
118 Ga0207654_10004382 3300025911 Bacteria 7115
119 Ga0207707_10007483 3300025912 Bacteria 9515
120 Ga0207695_10000013 3300025913 Bacteria 821265
121 Ga0207695_10010313 3300025913 Bacteria 11440
122 Ga0207695_10015096 3300025913 Bacteria 9112
123 Ga0207695_10102638 3300025913 Bacteria 2852
124 Ga0207695_10282782 3300025913 Bacteria 1552
125 Ga0207695_10598675 3300025913 Unclassified 983
126 Ga0207671_10001212 3300025914 Bacteria 30643
127 Ga0207671_10005732 3300025914 Bacteria 11324
128 Ga0207671_10006644 3300025914 Bacteria 10252
129 Ga0207671_10013135 3300025914 Bacteria 6614
130 Ga0207671_10016173 3300025914 Bacteria 5809
131 Ga0207671_10062397 3300025914 Bacteria 2767
132 Ga0207657_10040214 3300025919 Bacteria 4145
133 Ga0207657_10058263 3300025919 Bacteria 3324
134 Ga0207657_10239889 3300025919 Bacteria 1447
135 Ga0207652_10042415 3300025921 Bacteria 3872
136 Ga0207694_10021426 3300025924 Bacteria 4898
137 Ga0207694_10210426 3300025924 Bacteria 1584
138 Ga0207690_10000351 3300025932 Bacteria 30727
139 Ga0207706_10000047 3300025933 Bacteria 119022
140 Ga0207706_10182750 3300025933 Unclassified 1842
141 Ga0207704_10000077 3300025938 Bacteria 60841
142 Ga0207691_10143224 3300025940 Bacteria 2105
143 Ga0207667_10000015 3300025949 Bacteria 417534
144 Ga0207667_10000404 3300025949 Bacteria 58450
145 Ga0207667_10009196 3300025949 Bacteria 11672
146 Ga0207667_10389454 3300025949 Unclassified 1419
147 Ga0207651_10078435 3300025960 Bacteria 2369
148 Ga0207640_10008525 3300025981 Bacteria 5694
149 Ga0207677_10054954 3300026023 Bacteria 2720
150 Ga0207703_10122792 3300026035 Bacteria 2232
151 Ga0207639_10001818 3300026041 Bacteria 14353
152 Ga0207639_10005896 3300026041 Bacteria 8302
153 Ga0207639_10086774 3300026041 Bacteria 2493
154 Ga0207639_10113199 3300026041 Bacteria 2216
155 Ga0207678_10109494 3300026067 Unclassified 2356
156 Ga0207702_10009859 3300026078 Bacteria 8006
157 Ga0207702_10041267 3300026078 Bacteria 3869
158 Ga0207702_10258151 3300026078 Bacteria 1639
159 Ga0207702_10400879 3300026078 Bacteria 1323
160 Ga0207702_10669310 3300026078 Bacteria 1022
161 Ga0207648_10002829 3300026089 Bacteria 18417
162 Ga0207674_10132117 3300026116 Bacteria 2459
163 Ga0207683_10304144 3300026121 Bacteria 1459
164 Ga0268266_10000030 3300028379 Bacteria 417120
165 Ga0307517_10005480 3300028786 Bacteria 19110
166 Ga0265338_10119316 3300028800 Bacteria 2106
167 Ga0307509_10029694 3300031507 Bacteria 6063
168 Ga0307510_10017033 3300033180 Bacteria 8573
169 Ga0395899_0000002 3300037312 Bacteria 1324310
170 Ga0395899_0000209 3300037312 Bacteria 85489
171 Ga0395899_0003347 3300037312 Bacteria 12704
172 Ga0395899_0204032 3300037312 Bacteria 1377
173 Ga0395900_0000460 3300037418 Bacteria 58482
174 Ga0395900_0000721 3300037418 Bacteria 43960
175 Ga0395898_0069048 3300037466 Unclassified 3420
176 Ga0395905_0000149 3300037471 Bacteria 115709
177 Ga0395905_0004607 3300037471 Bacteria 14267
178 Ga0395901_0000198 3300038443 Bacteria 76490
179 Ga0395901_0022472 3300038443 Bacteria 6465
180 Ga0395901_0152200 3300038443 Bacteria 2431
181 Ga0436361_0280573 3300039447 Bacteria 5233
182 Ga0451793_0189817 3300041452 Bacteria 934
183 Ga0439448_0019462 3300042005 Bacteria 2091
184 Ga0466966_0182941 3300044684 Bacteria 1271
185 Ga0466961_0061014 3300044693 Unclassified 2397
186 Ga0495606_0016334 3300046507 Bacteria 5667
187 Ga0495631_0006477 3300046518 Bacteria 6040
188 Ga0495644_0004694 3300046523 Bacteria 5371
189 Ga0495661_0003353 3300046665 Bacteria 11869
190 Ga0495649_0120474 3300046694 Bacteria 1388
191 Ga0495683_0095005 3300047323 Bacteria 1440
192 Ga0495687_001183 3300047443 Bacteria 25146
193 Ga0495686_0002147 3300047472 Bacteria 19284
194 Ga0495686_0116323 3300047472 Unclassified 1598
195 nmdc:mga0k408_192077_c1 3300050493 Bacteria 1218
196 nmdc:mga0k408_2692_c1 3300050493 Bacteria 9419
197 nmdc:mga07m45_45431_c2 3300050496 Bacteria 1757
198 Ga0500635_0000931 3300053080 Bacteria 7073
199 Ga0500635_0002994 3300053080 Bacteria 4208
200 Ga0500642_0076299 3300053130 Unclassified 1532
201 Ga0500564_076920 3300053138 Bacteria 1500
202 Ga0500622_0001455 3300053156 Bacteria 18927
203 2599478957 2599185184 Bacteria 6430550
204 2852624745 2852623160 Bacteria 4376875
205 2884936368 2884933994 Bacteria 4535041
206 2928082728 2928078545 Bacteria 6534839
207 2928153035 2928147474 Bacteria 6512076
208 2932086095 2932082852 Bacteria 6563563
209 2977236620 2977232053 Bacteria 5485925
210 Ga0075366_10063215
211 JGI24736J21556_1007467
212 JGI24737J22298_10006552
213 JGI24744J21845_10021567
214 JGI25162J39368_1000688
215 JGI25162J39368_1001792
216 JGI25164J39214_1001174
217 JGI25165J46597_1000846
218 rootH1_10056194
219 rootH2_10013235
220 rootH2_10052962
221 rootH2_10252920
222 rootH2_10318815
223 rootH1_10001276
224 rootH1_10155752
225 rootH1_10161458
226 Ga0070658_10000028
227 Ga0070658_10027068
228 Ga0070676_10000004
229 Ga0068868_100047020
230 Ga0068868_100053575
231 Ga0070660_100022315
232 Ga0070660_100068248
233 Ga0070673_100104445
234 Ga0070659_100000824
235 Ga0070663_100063250
236 Ga0070678_100015947
237 Ga0070662_100000029
238 Ga0070662_100158577
239 Ga0070681_10012744
240 Ga0068867_100029272
241 Ga0070679_100006252
242 Ga0068853_100001654
243 Ga0068853_100010986
244 Ga0068853_100035720
245 Ga0068853_100138042
246 Ga0070672_100319867
247 Ga0070665_100000032
248 Ga0068855_100000041
249 Ga0068855_100000043
250 Ga0068855_100040990
251 Ga0068855_100275710
252 Ga0068857_100036650
253 Ga0068856_100000424
254 Ga0068856_100000632
255 Ga0068856_100009783
256 Ga0068856_100053709
257 Ga0068856_100403653
258 Ga0068856_100736004
259 Ga0068852_100000244
260 Ga0068866_10012102
261 Ga0097621_100001022
262 Ga0075370_10087033
263 Ga0068871_100000021
264 Ga0068865_100000045
265 Ga0105240_10000126
266 Ga0105240_10007920
267 Ga0105240_10022098
268 Ga0105240_10034819
269 Ga0105240_10273724
270 Ga0105240_10349541
271 Ga0105240_10515838
272 Ga0105241_10002344
273 Ga0105241_10005542
274 Ga0105241_10039568
275 Ga0105241_10081361
276 Ga0105242_10018244
277 Ga0105237_10001066
278 Ga0105237_10004075
279 Ga0105237_10005338
280 Ga0105237_10005461
281 Ga0105237_10018709
282 Ga0105237_10024081
283 Ga0105237_10191810
284 Ga0105238_10072577
285 Ga0105238_10256300
286 Ga0105239_10000017
287 Ga0105239_10000190
288 Ga0105239_10002606
289 Ga0105239_10003229
290 Ga0105239_10047505
291 Ga0105239_10049012
292 Ga0105239_10059156
293 Ga0105239_10616986
294 Ga0157373_10020402
295 Ga0157371_10000266
296 Ga0157371_10001789
297 Ga0157370_10098278
298 Ga0157369_10001323
299 Ga0157369_10072910
300 Ga0157374_10000700
301 Ga0157374_10000775
302 Ga0163162_10000010
303 Ga0163162_10007708
304 Ga0163162_10647167
305 Ga0157372_10000073
306 Ga0157372_10014858
307 Ga0157372_10150268
308 Ga0157372_10377275
309 Ga0157375_10043083
310 Ga0157375_10125967
311 Ga0213872_10011171
312 Ga0207427_100138
313 Ga0209437_100010
314 Ga0209437_100169
315 Ga0209026_1003989
316 Ga0209129_1006691
317 Ga0209233_1000017
318 Ga0209233_1026173
319 Ga0209455_1003033
320 Ga0207647_10000022
321 Ga0207647_10000211
322 Ga0207645_10000151
323 Ga0207705_10000045
324 Ga0207705_10021129
325 Ga0207654_10001597
326 Ga0207654_10004382
327 Ga0207707_10007483
328 Ga0207695_10000013
329 Ga0207695_10010313
330 Ga0207695_10015096
331 Ga0207695_10102638
332 Ga0207695_10282782
333 Ga0207695_10598675
334 Ga0207671_10001212
335 Ga0207671_10005732
336 Ga0207671_10006644
337 Ga0207671_10013135
338 Ga0207671_10016173
339 Ga0207671_10062397
340 Ga0207657_10040214
341 Ga0207657_10058263
342 Ga0207657_10239889
343 Ga0207652_10042415
344 Ga0207694_10021426
345 Ga0207694_10210426
346 Ga0207690_10000351
347 Ga0207706_10000047
348 Ga0207706_10182750
349 Ga0207704_10000077
350 Ga0207691_10143224
351 Ga0207667_10000015
352 Ga0207667_10000404
353 Ga0207667_10009196
354 Ga0207667_10389454
355 Ga0207651_10078435
356 Ga0207640_10008525
357 Ga0207677_10054954
358 Ga0207703_10122792
359 Ga0207639_10001818
360 Ga0207639_10005896
361 Ga0207639_10086774
362 Ga0207639_10113199
363 Ga0207678_10109494
364 Ga0207702_10009859
365 Ga0207702_10041267
366 Ga0207702_10258151
367 Ga0207702_10400879
368 Ga0207702_10669310
369 Ga0207648_10002829
370 Ga0207674_10132117
371 Ga0207683_10304144
372 Ga0268266_10000030
373 Ga0307517_10005480
374 Ga0265338_10119316
375 Ga0307509_10029694
376 Ga0307510_10017033
377 Ga0395899_0000002
378 Ga0395899_0000209
379 Ga0395899_0003347
380 Ga0395899_0204032
381 Ga0395900_0000460
382 Ga0395900_0000721
383 Ga0395898_0069048
384 Ga0395905_0000149
385 Ga0395905_0004607
386 Ga0395901_0000198
387 Ga0395901_0022472
388 Ga0395901_0152200
389 Ga0436361_0280573
390 Ga0451793_0189817
391 Ga0439448_0019462
392 Ga0466966_0182941
393 Ga0466961_0061014
394 Ga0495606_0016334
395 Ga0495631_0006477
396 Ga0495644_0004694
397 Ga0495661_0003353
398 Ga0495649_0120474
399 Ga0495683_0095005
400 Ga0495687_001183
401 Ga0495686_0002147
402 Ga0495686_0116323
403 nmdc:mga0k408_192077_c1
404 nmdc:mga0k408_2692_c1
405 nmdc:mga07m45_45431_c2
406 Ga0500635_0000931
407 Ga0500635_0002994
408 Ga0500642_0076299
409 Ga0500564_076920
410 Ga0500622_0001455
411 2599478957
412 2852624745
413 2884936368
414 2928082728
415 2928153035
416 2932086095
417 2977236620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05430

Methyltransf_30

S-adenosyl-L-methionine-dependent methyltransferase

123

242

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vyw-assembly3.cif.gz_C crystal structure of mnmc2 from aquifex aeolicus 0.7995 4 225
3vyw-assembly1.cif.gz_A crystal structure of mnmc2 from aquifex aeolicus 0.7896 4 225
3ps9-assembly1.cif.gz_A crystal structure of mnmc from e. coli 0.7802 4 224
3vyw-assembly3.cif.gz_C crystal structure of mnmc2 from aquifex aeolicus 0.7675 4 225
3awi-assembly2.cif.gz_B bifunctional trna modification enzyme mnmc from escherichia coli 0.7668 35 225
ID Description Score Start End Superfamily
af_A0A1D6K4H3_75_167_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7953 146 223 3.40.50.150
2e58C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7885 3 225 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7622 4 225 3.40.50.150
2e58C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7606 3 225 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7499 4 225 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A841JKN1-F1-model_v4 tRNA U34 5-methylaminomethyl-2-thiouridine-forming methyltransferase MnmC 0.9378 3 225 GO:0004808
GO:0016645
GO:0032259
AF-A0A5B8V0K8-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD 0.9367 5 223 GO:0004808
GO:0016645
GO:0032259
AF-A0A3S3SV36-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9354 5 225 GO:0004808
GO:0016645
GO:0032259
AF-A0A2A2S839-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9353 3 225 GO:0004808
GO:0016645
GO:0032259
AF-A0A3N7J7V0-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9351 5 225 GO:0004808
GO:0016645
GO:0032259

Map