F317993

General Info

Members Datasets Scaffolds Average Seq Length
208 157 416 298

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10010568|Ga0265760_100105682
Length 304
Sequence MTKQAKLGGAFMFSGTGMTVNRMGYGAMQLAGPGVWGPPRDREAAVSVLREAVAAGVNHIDTSDYYGPHVTNQIIKEALHPYADGLVIVTKVGARRGPDKSWLHARSRQDVIDAVHDNLRNLGVEAIDVVNLRVGGMMGPEEGSIEEPMTALAELKGKGLIRQLGLSNVNRKQLAEAQAITEIVCVQNFYNVAHREDDGFIDALAKQGIAYVPFFPLGGFTPLQSSVLDEAAATLGVTAMQVALAWLLQRSPNVLLIPGTSSVKHLRENLAAATLKIPEGILGELNSIGSAHGEGKHSPVAVAK

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.44
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0
Rhizoplane 3.37
Rhizosphere 75.96
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10010568 3300031090 Bacteria 2637
2 JGI25162J39368_1000255 3300002737 Bacteria 50867
3 JGI25157J39369_1000456 3300002741 Bacteria 25889
4 JGI25163J39215_1000635 3300002771 Bacteria 9555
5 JGI25164J39214_1000388 3300002772 Bacteria 25913
6 JGI25165J46597_1000144 3300003214 Bacteria 117624
7 Ga0055535_1000061 3300003761 Bacteria 117624
8 Ga0055542_1000099 3300003762 Bacteria 117624
9 Ga0055529_1000117 3300003763 Bacteria 117613
10 Ga0065165_1000383 3300005262 Bacteria 71804
11 Ga0070658_10215019 3300005327 Bacteria 1624
12 Ga0068869_100355625 3300005334 Bacteria 1195
13 Ga0068868_100016785 3300005338 Bacteria 5445
14 Ga0070689_100305301 3300005340 Bacteria 1325
15 Ga0070668_100012879 3300005347 Bacteria 6227
16 Ga0070675_100230815 3300005354 Bacteria 1614
17 Ga0070673_100181682 3300005364 Bacteria 1801
18 Ga0070709_10000004 3300005434 Bacteria 214262
19 Ga0070713_100596636 3300005436 Bacteria 1049
20 Ga0070708_100024226 3300005445 Bacteria 5173
21 Ga0070706_100003347 3300005467 Bacteria 15809
22 Ga0070707_100165498 3300005468 Bacteria 2155
23 Ga0070707_100348346 3300005468 Bacteria 1439
24 Ga0070698_100062534 3300005471 Bacteria 3756
25 Ga0070698_100121572 3300005471 Bacteria 2571
26 Ga0070699_100097717 3300005518 Bacteria 2572
27 Ga0070679_100005317 3300005530 Bacteria 11917
28 Ga0070697_100118102 3300005536 Bacteria 2216
29 Ga0068853_100000487 3300005539 Bacteria 27038
30 Ga0068853_100061359 3300005539 Bacteria 3252
31 Ga0070672_100002856 3300005543 Bacteria 11086
32 Ga0070686_100002262 3300005544 Bacteria 10618
33 Ga0070686_100136991 3300005544 Bacteria 1700
34 Ga0070665_100000024 3300005548 Bacteria 374559
35 Ga0070665_100357526 3300005548 Bacteria 1466
36 Ga0070704_100081590 3300005549 Bacteria 2382
37 Ga0068855_100017683 3300005563 Bacteria 8574
38 Ga0068855_100685868 3300005563 Bacteria 1097
39 Ga0070702_100204480 3300005615 Bacteria 1310
40 Ga0068859_100548158 3300005617 Bacteria 1251
41 Ga0068863_100625213 3300005841 Bacteria 1067
42 Ga0068860_100655640 3300005843 Bacteria 1058
43 Ga0081455_10005321 3300005937 Bacteria 14133
44 Ga0081539_10004666 3300005985 Bacteria 14895
45 Ga0070716_100348805 3300006173 Bacteria 1047
46 Ga0075366_10088342 3300006195 Bacteria 1856
47 Ga0097621_100049399 3300006237 Bacteria 3417
48 Ga0068871_100041771 3300006358 Unclassified 3679
49 Ga0068871_100414744 3300006358 Bacteria 1201
50 Ga0075428_100143143 3300006844 Bacteria 2599
51 Ga0075431_100120550 3300006847 Bacteria 2706
52 Ga0075431_100289157 3300006847 Bacteria 1658
53 Ga0075431_100360424 3300006847 Bacteria 1460
54 Ga0075433_10031635 3300006852 Bacteria 4524
55 Ga0075433_10309490 3300006852 Bacteria 1398
56 Ga0075434_100046141 3300006871 Bacteria 4324
57 Ga0075434_100087373 3300006871 Bacteria 3118
58 Ga0075434_100154116 3300006871 Bacteria 2318
59 Ga0075434_100215652 3300006871 Bacteria 1939
60 Ga0075436_100011307 3300006914 Bacteria 6123
61 Ga0075436_100359039 3300006914 Bacteria 1051
62 Ga0097620_100548229 3300006931 Bacteria 1251
63 Ga0075435_100071994 3300007076 Bacteria 2823
64 Ga0075435_100243207 3300007076 Bacteria 1531
65 Ga0075435_100478964 3300007076 Bacteria 1075
66 Ga0105240_10261040 3300009093 Bacteria 1998
67 Ga0111539_10459229 3300009094 Bacteria 1483
68 Ga0105245_10000977 3300009098 Bacteria 26118
69 Ga0105245_10060639 3300009098 Bacteria 3407
70 Ga0105242_10059416 3300009176 Bacteria 3137
71 Ga0105237_10000419 3300009545 Bacteria 60567
72 Ga0105238_10138608 3300009551 Bacteria 2410
73 Ga0105238_10261965 3300009551 Bacteria 1708
74 Ga0105238_10788926 3300009551 Bacteria 965
75 Ga0105249_10000245 3300009553 Bacteria 60260
76 Ga0105249_10245456 3300009553 Bacteria 1772
77 Ga0105249_10268608 3300009553 Bacteria 1698
78 Ga0105239_10357471 3300010375 Bacteria 1649
79 Ga0105246_10149752 3300011119 Bacteria 1765
80 Ga0157374_10000216 3300013296 Bacteria 53208
81 Ga0163162_10053098 3300013306 Bacteria 4072
82 Ga0163163_10324570 3300014325 Bacteria 1593
83 Ga0163163_10427611 3300014325 Bacteria 1383
84 Ga0157379_10066822 3300014968 Bacteria 3215
85 Ga0157379_10328020 3300014968 Bacteria 1398
86 Ga0157376_10000416 3300014969 Bacteria 27769
87 Ga0157376_10327390 3300014969 Bacteria 1459
88 Ga0183361_10002 3300016635 Bacteria 907642
89 Ga0213872_10019769 3300021361 Bacteria 3102
90 Ga0213876_10013284 3300021384 Bacteria 4376
91 Ga0213875_10019478 3300021388 Bacteria 3264
92 Ga0224712_10020525 3300022467 Bacteria 2245
93 Ga0209435_103176 3300025206 Bacteria 1884
94 Ga0209760_100503 3300025207 Bacteria 8243
95 Ga0209784_100043 3300025224 Bacteria 217823
96 Ga0209672_105974 3300025228 Bacteria 2031
97 Ga0207427_100087 3300025231 Bacteria 140098
98 Ga0209437_100173 3300025233 Bacteria 140098
99 Ga0209258_100092 3300025242 Bacteria 226544
100 Ga0209646_1000439 3300025246 Bacteria 22592
101 Ga0209026_1000112 3300025250 Bacteria 140098
102 Ga0209148_1000047 3300025254 Bacteria 434369
103 Ga0209759_1000597 3300025256 Bacteria 34955
104 Ga0209233_1000179 3300025261 Bacteria 140518
105 Ga0209455_1000056 3300025272 Bacteria 349821
106 Ga0209130_1004650 3300025284 Bacteria 5100
107 Ga0209050_1001860 3300025298 Bacteria 20346
108 Ga0207426_1000004 3300025302 Bacteria 1047900
109 Ga0207684_10000705 3300025910 Bacteria 39440
110 Ga0207684_10125067 3300025910 Bacteria 2206
111 Ga0207684_10431351 3300025910 Bacteria 1132
112 Ga0207654_10001730 3300025911 Bacteria 11358
113 Ga0207695_10000505 3300025913 Bacteria 82918
114 Ga0207695_10068870 3300025913 Bacteria 3624
115 Ga0207671_10000089 3300025914 Bacteria 140114
116 Ga0207663_10299947 3300025916 Bacteria 1200
117 Ga0207652_10029481 3300025921 Bacteria 4589
118 Ga0207646_10056740 3300025922 Bacteria 3500
119 Ga0207687_10001767 3300025927 Bacteria 14869
120 Ga0207669_10250297 3300025937 Bacteria 1319
121 Ga0207665_10075622 3300025939 Bacteria 2307
122 Ga0207691_10003645 3300025940 Bacteria 14936
123 Ga0207667_10003622 3300025949 Bacteria 19060
124 Ga0207667_10044098 3300025949 Bacteria 4728
125 Ga0207651_10373836 3300025960 Bacteria 1206
126 Ga0207712_10000086 3300025961 Bacteria 107484
127 Ga0207712_10248930 3300025961 Bacteria 1435
128 Ga0207668_10011180 3300025972 Bacteria 5448
129 Ga0207677_10009600 3300026023 Bacteria 5445
130 Ga0207639_10000357 3300026041 Bacteria 31603
131 Ga0207639_10175569 3300026041 Bacteria 1818
132 Ga0207678_10002107 3300026067 Bacteria 18018
133 Ga0207708_10227778 3300026075 Bacteria 1495
134 Ga0207641_10001826 3300026088 Bacteria 20485
135 Ga0207428_10056007 3300027907 Bacteria 3133
136 Ga0268266_10000019 3300028379 Bacteria 556465
137 Ga0268266_10309237 3300028379 Bacteria 1476
138 Ga0268264_10179120 3300028381 Bacteria 1923
139 Ga0265337_1000083 3300028556 Bacteria 45573
140 Ga0265326_10001797 3300028558 Bacteria 7396
141 Ga0265319_1034292 3300028563 Bacteria 1747
142 Ga0265318_10015058 3300028577 Bacteria 3228
143 Ga0265318_10043131 3300028577 Bacteria 1710
144 Ga0265336_10060744 3300028666 Bacteria 1134
145 Ga0265338_10006810 3300028800 Bacteria 14396
146 Ga0265338_10048853 3300028800 Bacteria 3844
147 Ga0265760_10002063 3300031090 Bacteria 5914
148 Ga0265320_10075598 3300031240 Bacteria 1580
149 Ga0265316_10007212 3300031344 Bacteria 10499
150 Ga0265316_10152083 3300031344 Bacteria 1733
151 Ga0265314_10016728 3300031711 Bacteria 5780
152 Ga0265342_10070339 3300031712 Bacteria 2042
153 Ga0373935_0057759 3300035692 Bacteria 2476
154 Ga0373947_0244610 3300035725 Bacteria 1185
155 Ga0373925_0068193 3300037068 Bacteria 2684
156 Ga0436364_0519106 3300037853 Bacteria 8345
157 Ga0436365_0098766 3300039437 Bacteria 9872
158 Ga0436365_0598358 3300039437 Bacteria 3949
159 Ga0436365_0722592 3300039437 Bacteria 22222
160 Ga0436365_1157171 3300039437 Bacteria 4814
161 Ga0436365_1893862 3300039437 Bacteria 1867
162 Ga0436361_0186542 3300039447 Bacteria 2019
163 Ga0436361_0957178 3300039447 Bacteria 3104
164 Ga0466969_0015191 3300044656 Bacteria 4036
165 Ga0466966_0013527 3300044684 Bacteria 5402
166 Ga0466961_0176588 3300044693 Bacteria 1327
167 Ga0466960_0016970 3300044901 Bacteria 3167
168 Ga0466959_0010752 3300045049 Bacteria 6557
169 Ga0466959_0046414 3300045049 Bacteria 3197
170 Ga0466958_0108122 3300045836 Bacteria 1735
171 Ga0496100_0000020 3300048903 Bacteria 147250
172 Ga0496101_0000045 3300048904 Bacteria 157340
173 Ga0496102_0000589 3300048905 Bacteria 38406
174 Ga0496103_0000264 3300048906 Bacteria 50288
175 Ga0496110_0218565 3300048913 Bacteria 1733
176 Ga0496112_0184830 3300048915 Bacteria 2048
177 Ga0496114_0029166 3300048917 Bacteria 4533
178 Ga0496116_0074789 3300048919 Bacteria 2129
179 Ga0496117_0000293 3300048920 Bacteria 89946
180 Ga0496118_0000411 3300048921 Bacteria 71545
181 Ga0496119_0013344 3300048922 Bacteria 6560
182 Ga0496121_0000765 3300048924 Bacteria 59004
183 Ga0496126_0060181 3300048929 Bacteria 3417
184 Ga0496126_0232551 3300048929 Bacteria 1544
185 Ga0501067_0029494 3300049583 Bacteria 3041
186 Ga0501067_0070872 3300049583 Bacteria 1930
187 Ga0501083_0139143 3300049744 Bacteria 1590
188 Ga0501035_0082184 3300049822 Bacteria 2843
189 Ga0501044_0300640 3300049823 Bacteria 1534
190 nmdc:mga05p37_125109_c1 3300050507 Bacteria 3157
191 nmdc:mga05p37_648607_c1 3300050507 Bacteria 1183
192 nmdc:mga09592_89188_c1 3300050508 Bacteria 2634
193 nmdc:mga06r32_126793_c1 3300050510 Bacteria 2522
194 nmdc:mga06r32_226118_c1 3300050510 Bacteria 1860
195 nmdc:mga06r32_4186_c1 3300050510 Bacteria 12924
196 nmdc:mga08y16_50671_c1 3300050511 Bacteria 4345
197 nmdc:mga0n895_10504_c1 3300050512 Bacteria 8189
198 nmdc:mga0n895_279583_c1 3300050512 Bacteria 1693
199 nmdc:mga0n895_344950_c1 3300050512 Bacteria 1508
200 nmdc:mga0n895_432099_c1 3300050512 Bacteria 1330
201 nmdc:mga0rr50_345592_c1 3300050513 Bacteria 1250
202 nmdc:mga08x19_56723_c1 3300050514 Bacteria 2529
203 nmdc:mga0a205_250044_c1 3300050515 Bacteria 1653
204 nmdc:mga0a205_67781_c1 3300050515 Bacteria 3447
205 Ga0500555_005419 3300053103 Bacteria 3618
206 Ga0501084_0073204 3300054114 Bacteria 2869
207 Ga0501084_0373874 3300054114 Bacteria 1204
208 2753459353 2751185821 Bacteria 6189929
209 Ga0265760_10010568
210 JGI25162J39368_1000255
211 JGI25157J39369_1000456
212 JGI25163J39215_1000635
213 JGI25164J39214_1000388
214 JGI25165J46597_1000144
215 Ga0055535_1000061
216 Ga0055542_1000099
217 Ga0055529_1000117
218 Ga0065165_1000383
219 Ga0070658_10215019
220 Ga0068869_100355625
221 Ga0068868_100016785
222 Ga0070689_100305301
223 Ga0070668_100012879
224 Ga0070675_100230815
225 Ga0070673_100181682
226 Ga0070709_10000004
227 Ga0070713_100596636
228 Ga0070708_100024226
229 Ga0070706_100003347
230 Ga0070707_100165498
231 Ga0070707_100348346
232 Ga0070698_100062534
233 Ga0070698_100121572
234 Ga0070699_100097717
235 Ga0070679_100005317
236 Ga0070697_100118102
237 Ga0068853_100000487
238 Ga0068853_100061359
239 Ga0070672_100002856
240 Ga0070686_100002262
241 Ga0070686_100136991
242 Ga0070665_100000024
243 Ga0070665_100357526
244 Ga0070704_100081590
245 Ga0068855_100017683
246 Ga0068855_100685868
247 Ga0070702_100204480
248 Ga0068859_100548158
249 Ga0068863_100625213
250 Ga0068860_100655640
251 Ga0081455_10005321
252 Ga0081539_10004666
253 Ga0070716_100348805
254 Ga0075366_10088342
255 Ga0097621_100049399
256 Ga0068871_100041771
257 Ga0068871_100414744
258 Ga0075428_100143143
259 Ga0075431_100120550
260 Ga0075431_100289157
261 Ga0075431_100360424
262 Ga0075433_10031635
263 Ga0075433_10309490
264 Ga0075434_100046141
265 Ga0075434_100087373
266 Ga0075434_100154116
267 Ga0075434_100215652
268 Ga0075436_100011307
269 Ga0075436_100359039
270 Ga0097620_100548229
271 Ga0075435_100071994
272 Ga0075435_100243207
273 Ga0075435_100478964
274 Ga0105240_10261040
275 Ga0111539_10459229
276 Ga0105245_10000977
277 Ga0105245_10060639
278 Ga0105242_10059416
279 Ga0105237_10000419
280 Ga0105238_10138608
281 Ga0105238_10261965
282 Ga0105238_10788926
283 Ga0105249_10000245
284 Ga0105249_10245456
285 Ga0105249_10268608
286 Ga0105239_10357471
287 Ga0105246_10149752
288 Ga0157374_10000216
289 Ga0163162_10053098
290 Ga0163163_10324570
291 Ga0163163_10427611
292 Ga0157379_10066822
293 Ga0157379_10328020
294 Ga0157376_10000416
295 Ga0157376_10327390
296 Ga0183361_10002
297 Ga0213872_10019769
298 Ga0213876_10013284
299 Ga0213875_10019478
300 Ga0224712_10020525
301 Ga0209435_103176
302 Ga0209760_100503
303 Ga0209784_100043
304 Ga0209672_105974
305 Ga0207427_100087
306 Ga0209437_100173
307 Ga0209258_100092
308 Ga0209646_1000439
309 Ga0209026_1000112
310 Ga0209148_1000047
311 Ga0209759_1000597
312 Ga0209233_1000179
313 Ga0209455_1000056
314 Ga0209130_1004650
315 Ga0209050_1001860
316 Ga0207426_1000004
317 Ga0207684_10000705
318 Ga0207684_10125067
319 Ga0207684_10431351
320 Ga0207654_10001730
321 Ga0207695_10000505
322 Ga0207695_10068870
323 Ga0207671_10000089
324 Ga0207663_10299947
325 Ga0207652_10029481
326 Ga0207646_10056740
327 Ga0207687_10001767
328 Ga0207669_10250297
329 Ga0207665_10075622
330 Ga0207691_10003645
331 Ga0207667_10003622
332 Ga0207667_10044098
333 Ga0207651_10373836
334 Ga0207712_10000086
335 Ga0207712_10248930
336 Ga0207668_10011180
337 Ga0207677_10009600
338 Ga0207639_10000357
339 Ga0207639_10175569
340 Ga0207678_10002107
341 Ga0207708_10227778
342 Ga0207641_10001826
343 Ga0207428_10056007
344 Ga0268266_10000019
345 Ga0268266_10309237
346 Ga0268264_10179120
347 Ga0265337_1000083
348 Ga0265326_10001797
349 Ga0265319_1034292
350 Ga0265318_10015058
351 Ga0265318_10043131
352 Ga0265336_10060744
353 Ga0265338_10006810
354 Ga0265338_10048853
355 Ga0265760_10002063
356 Ga0265320_10075598
357 Ga0265316_10007212
358 Ga0265316_10152083
359 Ga0265314_10016728
360 Ga0265342_10070339
361 Ga0373935_0057759
362 Ga0373947_0244610
363 Ga0373925_0068193
364 Ga0436364_0519106
365 Ga0436365_0098766
366 Ga0436365_0598358
367 Ga0436365_0722592
368 Ga0436365_1157171
369 Ga0436365_1893862
370 Ga0436361_0186542
371 Ga0436361_0957178
372 Ga0466969_0015191
373 Ga0466966_0013527
374 Ga0466961_0176588
375 Ga0466960_0016970
376 Ga0466959_0010752
377 Ga0466959_0046414
378 Ga0466958_0108122
379 Ga0496100_0000020
380 Ga0496101_0000045
381 Ga0496102_0000589
382 Ga0496103_0000264
383 Ga0496110_0218565
384 Ga0496112_0184830
385 Ga0496114_0029166
386 Ga0496116_0074789
387 Ga0496117_0000293
388 Ga0496118_0000411
389 Ga0496119_0013344
390 Ga0496121_0000765
391 Ga0496126_0060181
392 Ga0496126_0232551
393 Ga0501067_0029494
394 Ga0501067_0070872
395 Ga0501083_0139143
396 Ga0501035_0082184
397 Ga0501044_0300640
398 nmdc:mga05p37_125109_c1
399 nmdc:mga05p37_648607_c1
400 nmdc:mga09592_89188_c1
401 nmdc:mga06r32_126793_c1
402 nmdc:mga06r32_226118_c1
403 nmdc:mga06r32_4186_c1
404 nmdc:mga08y16_50671_c1
405 nmdc:mga0n895_10504_c1
406 nmdc:mga0n895_279583_c1
407 nmdc:mga0n895_344950_c1
408 nmdc:mga0n895_432099_c1
409 nmdc:mga0rr50_345592_c1
410 nmdc:mga08x19_56723_c1
411 nmdc:mga0a205_250044_c1
412 nmdc:mga0a205_67781_c1
413 Ga0500555_005419
414 Ga0501084_0073204
415 Ga0501084_0373874
416 2753459353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

22

289

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8972 2 281
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.876 2 281
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8604 1 283
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.8523 6 284
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8509 11 284
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9771 9 286 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9668 9 286 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8979 15 290 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8661 14 288 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8604 1 283 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4P1ALL5-F1-model_v4 deleted 0.9906 159 284
AF-A0A379LU18-F1-model_v4 Oxidoreductase YdbC (EC 1.-.-.-) 0.9904 45 283 GO:0005829
GO:0016491
AF-A0A3A8J7T9-F1-model_v4 Oxidoreductase 0.9878 63 190 GO:0005829
AF-A0A0K4T6T7-F1-model_v4 deleted 0.986 51 286
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9856 63 265

Map