F318136

General Info

Members Datasets Scaffolds Average Seq Length
208 132 118 307

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0236386|Ga0451841_0236386_1372_2472
Length 366
Sequence MDFGALKPLLGRVYPAKGVCSRFGLEWNIPMNPESHLNFGWTVQDLSPIDGVMKSSLDHIPLRKQREIGRVLEILHEEFEDALKDGTAEFKKRGRILKIILFGSYAKGGWVDEPFTMKGYRSDFDLLIIVNNRKLCEFAEYWHKAADRLIHDKSIETPVSFIVHSRREVNTYLKKGQYFFSDIRKEGIVLYELDAEPLAEPEPLSSEDRLRIAKEHYEDRLTLSRSFLKIAISCVSEKELRVAAFQLHQALEQAYSCVLLTLTNYGPPSHNIRFLRSLAEEQDRRLAEAFPRDQHRERAWFNTLNEAYVKARYSKHFEISEEALGWLAEQTALLLELVKMVCEGHLETLRGIVGSDKIKRDSLSCG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
5 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
6 2519899620 Rhizobium sp. Pop5 Isolate Nodule
7 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
8 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
9 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
10 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
11 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
12 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
13 2791355261 Rhizobium sp. J15 Isolate Nodule
14 2791355262 Rhizobium sp. M1 Isolate Nodule
15 2791355264 Rhizobium sp. S9 Isolate Nodule
16 2791355265 Rhizobium sp. H4 Isolate Nodule
17 2802429633 Rhizobium anhuiense J3 Isolate Nodule
18 2802429634 Rhizobium anhuiense S10 Isolate Nodule
19 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
20 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
21 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
22 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
23 2838061910 Rhizobium phaseoli L15 Isolate Nodule
24 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
25 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
26 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
27 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
28 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
29 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
30 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
31 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
32 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
33 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
34 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
35 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
36 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
37 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
38 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
39 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
40 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
41 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
42 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
43 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
44 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
45 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
46 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
47 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
48 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
49 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
50 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
51 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
52 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
53 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
71 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
72 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
86 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
89 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
90 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
91 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
119 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
120 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
121 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
127 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
128 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
129 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
130 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
131 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
132 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.77
Metatranscriptomes 0.96
Isolates 43.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.21
Nodule 41.35
Rhizoplane 0
Rhizosphere 8.65
Stem 0
Stem Tuber 0
Unclassified 17.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000044 3300002704 Bacteria 86149
2 JGI25156J39149_1000058 3300002705 Bacteria 86233
3 JGI25154J39366_1000174 3300002738 Bacteria 49957
4 JGI25157J39369_1000078 3300002741 Bacteria 86233
5 JGI25151J46595_10056348 3300003187 Bacteria 1289
6 JGI25153J46596_10002963 3300003215 Bacteria 9618
7 JGI25153J46596_10006905 3300003215 Bacteria 5666
8 JGI25160J50197_1001659 3300003354 Bacteria 10882
9 JGI25160J50197_1024063 3300003354 Bacteria 1737
10 Ga0055526_1006886 3300003771 Bacteria 6056
11 Ga0055524_1004921 3300003775 Bacteria 6058
12 Ga0055528_1004882 3300003790 Bacteria 6347
13 Ga0055528_1016917 3300003790 Bacteria 2552
14 Ga0055543_1000625 3300004625 Bacteria 19011
15 Ga0065165_1004851 3300005262 Bacteria 7993
16 Ga0075365_10007081 3300006038 Bacteria 6250
17 Ga0075364_10185243 3300006051 Bacteria 1409
18 Ga0075362_10048319 3300006177 Bacteria 1898
19 Ga0075370_10051325 3300006353 Bacteria 2339
20 Ga0123341_1002262 3300009765 Bacteria 15665
21 Ga0123342_1031914 3300009766 Bacteria 2510
22 Ga0209435_100054 3300025206 Bacteria 86285
23 Ga0207425_1002013 3300025245 Bacteria 7573
24 Ga0209646_1000170 3300025246 Bacteria 86285
25 Ga0209026_1000193 3300025250 Bacteria 86285
26 Ga0209759_1000222 3300025256 Bacteria 86285
27 Ga0209129_1004336 3300025258 Bacteria 5596
28 Ga0209129_1005748 3300025258 Bacteria 4257
29 Ga0209673_1000967 3300025273 Bacteria 35634
30 Ga0209673_1001681 3300025273 Bacteria 18889
31 Ga0209673_1019779 3300025273 Bacteria 2406
32 Ga0209025_1000260 3300025294 Bacteria 124240
33 Ga0209025_1073820 3300025294 Bacteria 1194
34 Ga0209564_1003630 3300025295 Bacteria 10254
35 Ga0209564_1007614 3300025295 Bacteria 5549
36 Ga0209758_1000076 3300025297 Bacteria 270615
37 Ga0209758_1001982 3300025297 Bacteria 22133
38 Ga0209758_1002450 3300025297 Bacteria 18942
39 Ga0209758_1005092 3300025297 Bacteria 10406
40 Ga0209758_1049124 3300025297 Bacteria 1492
41 Ga0209256_1006484 3300025299 Bacteria 6162
42 Ga0209256_1013010 3300025299 Bacteria 3122
43 Ga0209256_1015150 3300025299 Bacteria 2717
44 Ga0209256_1015308 3300025299 Bacteria 2691
45 Ga0209256_1041390 3300025299 Bacteria 1171
46 Ga0207426_1000298 3300025302 Bacteria 97889
47 Ga0207426_1001199 3300025302 Bacteria 23041
48 Ga0209051_1009268 3300025303 Bacteria 5089
49 Ga0209051_1015378 3300025303 Bacteria 3521
50 Ga0209051_1018758 3300025303 Bacteria 3047
51 Ga0451833_0090118 3300041491 Bacteria 1525
52 Ga0451833_0865740 3300041491 Bacteria 1706
53 Ga0451835_0381003 3300041492 Bacteria 6374
54 Ga0451837_0677695 3300041494 Bacteria 3868
55 Ga0451839_0105420 3300041496 Bacteria 2309
56 Ga0451841_0236386 3300041498 Bacteria 2537
57 Ga0451845_0431471 3300041501 Bacteria 13909
58 Ga0451845_0499825 3300041501 Bacteria 2112
59 Ga0451851_0389277 3300041507 Bacteria 2665
60 Ga0451851_1093736 3300041507 Bacteria 2182
61 Ga0451843_1760447 3300041509 Bacteria 2257
62 Ga0451853_1034206 3300041512 Bacteria 3134
63 Ga0451853_2098215 3300041512 Bacteria 1797
64 Ga0452268_15625 3300041907 Bacteria 1641
65 Ga0452268_35953 3300041907 Bacteria 1005
66 Ga0466970_0000568 3300044765 Bacteria 18086
67 Ga0495638_0000175 3300046460 Bacteria 100036
68 Ga0495638_0000634 3300046460 Bacteria 38683
69 Ga0495606_0042867 3300046507 Bacteria 3023
70 Ga0495610_0011616 3300046512 Bacteria 5368
71 Ga0495610_0056821 3300046512 Bacteria 1880
72 Ga0495620_0027206 3300046515 Bacteria 2679
73 Ga0495620_0028111 3300046515 Bacteria 2620
74 Ga0495643_0005332 3300046522 Bacteria 8713
75 Ga0495643_0020313 3300046522 Bacteria 3830
76 Ga0495643_0028074 3300046522 Bacteria 3158
77 Ga0495654_0000140 3300046530 Bacteria 75508
78 Ga0495597_0103573 3300046542 Bacteria 1198
79 Ga0495649_0153994 3300046694 Bacteria 1207
80 Ga0495660_0059566 3300046810 Bacteria 2053
81 Ga0495660_0072116 3300046810 Bacteria 1830
82 Ga0495686_0103734 3300047472 Bacteria 1713
83 Ga0496118_0004743 3300048921 Bacteria 15912
84 Ga0496121_0000235 3300048924 Bacteria 118983
85 Ga0496122_0000870 3300048925 Bacteria 56865
86 Ga0496123_0000664 3300048926 Bacteria 56865
87 Ga0496124_0026531 3300048927 Bacteria 5220
88 Ga0496125_0000417 3300048928 Bacteria 79282
89 Ga0496125_0192443 3300048928 Bacteria 1345
90 Ga0496126_0117181 3300048929 Bacteria 2314
91 Ga0496126_0254630 3300048929 Bacteria 1462
92 nmdc:mga03683_121443_c1 3300050489 Bacteria 1162
93 nmdc:mga00v17_47789_c1 3300050491 Bacteria 2592
94 nmdc:mga0yw44_1339_c1 3300050492 Bacteria 7783
95 nmdc:mga0k408_19439_c1 3300050493 Bacteria 3797
96 nmdc:mga0k408_49983_c1 3300050493 Bacteria 1997
97 nmdc:mga07m45_82503_c1 3300050496 Bacteria 1836
98 Ga0500578_0018598 3300053086 Bacteria 4463
99 Ga0500578_0026058 3300053086 Bacteria 3752
100 Ga0500578_0030624 3300053086 Bacteria 3458
101 Ga0500578_0052486 3300053086 Bacteria 2611
102 Ga0500557_000395 3300053105 Bacteria 5706
103 Ga0500569_002468 3300053109 Bacteria 3647
104 Ga0500569_039446 3300053109 Bacteria 1375
105 Ga0500658_0000065 3300053134 Bacteria 49371
106 Ga0500658_0000534 3300053134 Bacteria 16049
107 Ga0500658_0000629 3300053134 Bacteria 14603
108 Ga0500658_0006571 3300053134 Bacteria 4313
109 Ga0500568_0000092 3300053139 Bacteria 84471
110 Ga0500616_0001138 3300053153 Bacteria 27357
111 Ga0500616_0001531 3300053153 Bacteria 21753
112 Ga0500616_0015937 3300053153 Bacteria 4288
113 Ga0500616_0048256 3300053153 Bacteria 2257
114 Ga0500616_0050136 3300053153 Bacteria 2205
115 Ga0500616_0077490 3300053153 Bacteria 1678
116 Ga0500616_0112116 3300053153 Unclassified 1316
117 Ga0500622_0138230 3300053156 Bacteria 1165
118 Ga0500636_0022829 3300053177 Bacteria 3697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041507 Ga0451851_1093736 Ga0451851_1093736_407_1402 291
2 iso_pu_bacteria 2585427634 2586004174 293
3 3300003215 JGI25153J46596_10006905 JGI25153J46596_100069055 295
4 3300003790 Ga0055528_1004882 Ga0055528_10048822 295
5 3300025294 Ga0209025_1073820 Ga0209025_10738201 295
6 3300025302 Ga0207426_1001199 Ga0207426_10011992 295
7 3300041509 Ga0451843_1760447 Ga0451843_1760447_345_1268 295
8 3300046512 Ga0495610_0056821 Ga0495610_0056821_354_1241 295
9 3300046694 Ga0495649_0153994 Ga0495649_0153994_305_1192 295
10 3300053086 Ga0500578_0030624 Ga0500578_0030624_1350_2237 295
11 3300053134 Ga0500658_0006571 Ga0500658_0006571_1452_2339 295
12 iso_pu_bacteria 2791355261 2793328638 295
13 iso_pu_bacteria 2791355262 2793334222 295
14 iso_pu_bacteria 2842192696 2842192889 295
15 iso_pu_bacteria 2842285085 2842286841 295
16 iso_pu_bacteria 2842311132 2842312616 295
17 iso_pu_bacteria 2842317721 2842322517 295
18 iso_pu_bacteria 2842402390 2842403606 295
19 iso_pu_bacteria 2842409023 2842410692 295
20 iso_pu_bacteria 2842415677 2842417338 295
21 iso_pu_bacteria 2791355259 2793315428 296
22 iso_pu_bacteria 2615840624 2616297124 297
23 iso_pu_bacteria 2841851746 2841856139 297
24 iso_pu_bacteria 2842229732 2842235297 297
25 iso_pu_bacteria 2842304105 2842306498 297
26 3300044765 Ga0466970_0000568 Ga0466970_0000568_14503_15414 298
27 3300053177 Ga0500636_0022829 Ga0500636_0022829_1846_2769 298
28 iso_pu_bacteria 2509276033 2509441449 298
29 iso_pu_bacteria 2509276033 2509443981 298
30 iso_pu_bacteria 2510917026 2511175146 298
31 iso_pu_bacteria 2516653085 2517079892 298
32 iso_pu_bacteria 2516653085 2517080991 298
33 iso_pu_bacteria 2615840624 2616294129 298
34 iso_pu_bacteria 2718218233 2720618569 298
35 iso_pu_bacteria 2738541333 2739034441 298
36 iso_pu_bacteria 2791355264 2793345209 298
37 iso_pu_bacteria 2791355265 2793354084 298
38 iso_pu_bacteria 2802429634 2806051193 298
39 iso_pu_bacteria 2802429635 2806057635 298
40 iso_pu_bacteria 2802429636 2806065647 298
41 iso_pu_bacteria 2818991461 2819688935 298
42 iso_pu_bacteria 2838061910 2838068433 298
43 iso_pu_bacteria 2838668709 2838669207 298
44 iso_pu_bacteria 2838668709 2838672390 298
45 iso_pu_bacteria 2838686498 2838687752 298
46 iso_pu_bacteria 2838686498 2838691579 298
47 iso_pu_bacteria 2838701080 2838701132 298
48 iso_pu_bacteria 2838701080 2838703868 298
49 iso_pu_bacteria 2838729681 2838735639 298
50 iso_pu_bacteria 2838742623 2838748541 298
51 iso_pu_bacteria 2841851746 2841854299 298
52 iso_pu_bacteria 2841851746 2841858842 298
53 iso_pu_bacteria 2842146304 2842146803 298
54 iso_pu_bacteria 2842146304 2842148340 298
55 iso_pu_bacteria 2842229732 2842232809 298
56 iso_pu_bacteria 2842243621 2842246948 298
57 iso_pu_bacteria 2842243621 2842248247 298
58 iso_pu_bacteria 2842243621 2842250498 298
59 iso_pu_bacteria 2842250916 2842250967 298
60 iso_pu_bacteria 2842250916 2842253406 298
61 iso_pu_bacteria 2842257432 2842259366 298
62 iso_pu_bacteria 2842271015 2842272216 298
63 iso_pu_bacteria 2842271015 2842276552 298
64 iso_pu_bacteria 2842285085 2842289292 298
65 iso_pu_bacteria 2842304105 2842310792 298
66 iso_pu_bacteria 2842402390 2842407498 298
67 iso_pu_bacteria 2842409023 2842413253 298
68 iso_pu_bacteria 2842415677 2842419896 298
69 iso_pu_bacteria 2842447887 2842450189 298
70 iso_pu_bacteria 2842495871 2842499028 298
71 iso_pu_bacteria 2844454524 2844455988 298
72 iso_pu_bacteria 2844454524 2844460747 298
73 iso_pu_bacteria 2844454524 2844461160 298
74 iso_pu_bacteria 2933570622 2933577286 298
75 iso_pu_bacteria 2936367885 2936374095 298
76 iso_pu_bacteria 2936375103 2936375387 298
77 iso_pu_bacteria 8005376324 8005380090 298
78 iso_pu_bacteria 8024479707 8024484738 298
79 iso_pu_bacteria 2852387548 2852390294 299
80 iso_pu_bacteria 2989776772 2989781497 299
81 3300009766 Ga0123342_1031914 Ga0123342_10319144 300
82 3300025299 Ga0209256_1041390 Ga0209256_10413901 300
83 3300046460 Ga0495638_0000175 Ga0495638_0000175_80068_80985 301
84 3300048929 Ga0496126_0254630 Ga0496126_0254630_495_1409 301
85 3300053105 Ga0500557_000395 Ga0500557_000395_3182_4099 301
86 3300053139 Ga0500568_0000092 Ga0500568_0000092_12360_13277 301
87 3300053153 Ga0500616_0112116 Ga0500616_0112116_78_995 301
88 iso_pu_bacteria 2585427634 2586003715 301
89 3300003187 JGI25151J46595_10056348 JGI25151J46595_100563481 302
90 3300003215 JGI25153J46596_10002963 JGI25153J46596_100029632 302
91 3300003354 JGI25160J50197_1001659 JGI25160J50197_10016598 302
92 3300003354 JGI25160J50197_1024063 JGI25160J50197_10240632 302
93 3300003775 Ga0055524_1004921 Ga0055524_10049211 302
94 3300004625 Ga0055543_1000625 Ga0055543_10006252 302
95 3300005262 Ga0065165_1004851 Ga0065165_10048512 302
96 3300006177 Ga0075362_10048319 Ga0075362_100483192 302
97 3300006353 Ga0075370_10051325 Ga0075370_100513252 302
98 3300025258 Ga0209129_1004336 Ga0209129_10043365 302
99 3300025294 Ga0209025_1000260 Ga0209025_1000260122 302
100 3300025297 Ga0209758_1001982 Ga0209758_10019823 302
101 3300025297 Ga0209758_1005092 Ga0209758_10050923 302
102 3300025297 Ga0209758_1049124 Ga0209758_10491242 302
103 3300025299 Ga0209256_1006484 Ga0209256_10064842 302
104 3300025299 Ga0209256_1013010 Ga0209256_10130103 302
105 3300025302 Ga0207426_1000298 Ga0207426_100029885 302
106 3300025303 Ga0209051_1009268 Ga0209051_10092683 302
107 3300041491 Ga0451833_0865740 Ga0451833_0865740_360_1304 302
108 3300041501 Ga0451845_0499825 Ga0451845_0499825_243_1187 302
109 3300041512 Ga0451853_1034206 Ga0451853_1034206_453_1397 302
110 3300041907 Ga0452268_35953 Ga0452268_35953_21_965 302
111 3300046507 Ga0495606_0042867 Ga0495606_0042867_1119_2042 302
112 3300046515 Ga0495620_0028111 Ga0495620_0028111_812_1735 302
113 3300046522 Ga0495643_0020313 Ga0495643_0020313_822_1730 302
114 3300046522 Ga0495643_0028074 Ga0495643_0028074_1107_2030 302
115 3300046542 Ga0495597_0103573 Ga0495597_0103573_81_1004 302
116 3300046810 Ga0495660_0072116 Ga0495660_0072116_594_1502 302
117 3300048927 Ga0496124_0026531 Ga0496124_0026531_831_1751 302
118 3300050489 nmdc:mga03683_121443_c1 nmdc:mga03683_121443_c1_225_1133 302
119 3300050493 nmdc:mga0k408_49983_c1 nmdc:mga0k408_49983_c1_432_1376 302
120 3300050496 nmdc:mga07m45_82503_c1 nmdc:mga07m45_82503_c1_478_1422 302
121 3300053086 Ga0500578_0026058 Ga0500578_0026058_1543_2487 302
122 3300053086 Ga0500578_0052486 Ga0500578_0052486_596_1519 302
123 3300053134 Ga0500658_0000065 Ga0500658_0000065_45736_46644 302
124 3300053134 Ga0500658_0000629 Ga0500658_0000629_3608_4516 302
125 3300053153 Ga0500616_0015937 Ga0500616_0015937_1535_2443 302
126 3300053153 Ga0500616_0048256 Ga0500616_0048256_1050_1994 302
127 3300053153 Ga0500616_0050136 Ga0500616_0050136_455_1378 302
128 3300053153 Ga0500616_0077490 Ga0500616_0077490_405_1349 302
129 iso_pu_bacteria 2509276033 2509448525 302
130 3300006051 Ga0075364_10185243 Ga0075364_101852432 303
131 3300025303 Ga0209051_1018758 Ga0209051_10187582 303
132 3300041491 Ga0451833_0090118 Ga0451833_0090118_105_1100 303
133 3300041492 Ga0451835_0381003 Ga0451835_0381003_987_1982 303
134 3300041494 Ga0451837_0677695 Ga0451837_0677695_792_1787 303
135 3300041496 Ga0451839_0105420 Ga0451839_0105420_898_1893 303
136 3300041498 Ga0451841_0236386 Ga0451841_0236386_1372_2472 303
137 3300041507 Ga0451851_0389277 Ga0451851_0389277_745_1740 303
138 3300041907 Ga0452268_15625 Ga0452268_15625_569_1564 303
139 3300046512 Ga0495610_0011616 Ga0495610_0011616_1212_2123 303
140 3300046515 Ga0495620_0027206 Ga0495620_0027206_359_1270 303
141 3300046522 Ga0495643_0005332 Ga0495643_0005332_1713_2624 303
142 3300046530 Ga0495654_0000140 Ga0495654_0000140_63806_64732 303
143 3300046810 Ga0495660_0059566 Ga0495660_0059566_1002_1913 303
144 3300047472 Ga0495686_0103734 Ga0495686_0103734_356_1267 303
145 3300048924 Ga0496121_0000235 Ga0496121_0000235_53064_53975 303
146 3300048925 Ga0496122_0000870 Ga0496122_0000870_43100_44011 303
147 3300048926 Ga0496123_0000664 Ga0496123_0000664_43100_44011 303
148 3300048928 Ga0496125_0000417 Ga0496125_0000417_671_1582 303
149 3300048928 Ga0496125_0192443 Ga0496125_0192443_163_1098 303
150 3300048929 Ga0496126_0117181 Ga0496126_0117181_734_1768 303
151 3300050491 nmdc:mga00v17_47789_c1 nmdc:mga00v17_47789_c1_186_1097 303
152 3300053086 Ga0500578_0018598 Ga0500578_0018598_190_1101 303
153 3300053109 Ga0500569_039446 Ga0500569_039446_182_1093 303
154 3300053134 Ga0500658_0000534 Ga0500658_0000534_1469_2380 303
155 3300053153 Ga0500616_0001138 Ga0500616_0001138_21089_22000 303
156 3300053156 Ga0500622_0138230 Ga0500622_0138230_227_1138 303
157 iso_pu_bacteria 2519899620 2520377797 303
158 iso_pu_bacteria 2765235942 2766066561 303
159 iso_pu_bacteria 2842180545 2842183098 303
160 iso_pu_bacteria 2842304105 2842309628 303
161 iso_pu_bacteria 2933570622 2933576072 303
162 iso_pu_bacteria 8057874678 8057876051 303
163 iso_pu_bacteria 2802429633 2806043241 304
164 iso_pu_bacteria 2802429634 2806054957 304
165 iso_pu_bacteria 2802429635 2806062141 304
166 iso_pu_bacteria 2838022645 2838028172 304
167 iso_pu_bacteria 2842192696 2842193814 304
168 iso_pu_bacteria 2842198810 2842205165 304
169 iso_pu_bacteria 8005301065 8005301557 304
170 iso_pu_bacteria 8005563573 8005565221 304
171 iso_pu_bacteria 2585427634 2586003940 305
172 3300006038 Ga0075365_10007081 Ga0075365_100070814 307
173 3300041501 Ga0451845_0431471 Ga0451845_0431471_11726_12661 307
174 3300050492 nmdc:mga0yw44_1339_c1 nmdc:mga0yw44_1339_c1_3429_4361 307
175 3300003771 Ga0055526_1006886 Ga0055526_10068862 308
176 3300003790 Ga0055528_1016917 Ga0055528_10169171 308
177 3300009765 Ga0123341_1002262 Ga0123341_10022628 308
178 3300025245 Ga0207425_1002013 Ga0207425_10020132 308
179 3300025258 Ga0209129_1005748 Ga0209129_10057482 308
180 3300025273 Ga0209673_1000967 Ga0209673_10009672 308
181 3300025273 Ga0209673_1001681 Ga0209673_10016814 308
182 3300025273 Ga0209673_1019779 Ga0209673_10197792 308
183 3300025295 Ga0209564_1003630 Ga0209564_10036304 308
184 3300025297 Ga0209758_1000076 Ga0209758_1000076237 308
185 3300025297 Ga0209758_1002450 Ga0209758_100245013 308
186 3300025299 Ga0209256_1015308 Ga0209256_10153082 308
187 3300025303 Ga0209051_1015378 Ga0209051_10153782 308
188 3300041512 Ga0451853_2098215 Ga0451853_2098215_78_1040 308
189 3300048921 Ga0496118_0004743 Ga0496118_0004743_8490_9416 308
190 3300050493 nmdc:mga0k408_19439_c1 nmdc:mga0k408_19439_c1_2521_3447 308
191 3300053109 Ga0500569_002468 Ga0500569_002468_890_1852 308
192 3300025295 Ga0209564_1007614 Ga0209564_10076142 309
193 3300025299 Ga0209256_1015150 Ga0209256_10151502 309
194 3300046460 Ga0495638_0000634 Ga0495638_0000634_35356_36285 309
195 3300053153 Ga0500616_0001531 Ga0500616_0001531_10930_11859 309
196 iso_pu_bacteria 2509276021 2509385914 309
197 iso_pu_bacteria 2513237085 2513580208 309
198 iso_pu_bacteria 2933570622 2933573567 309
199 iso_pu_bacteria 639633055 639646650 309
200 iso_pu_bacteria 8023680758 8023684215 309
201 3300025206 Ga0209435_100054 Ga0209435_10005441 311
202 3300025246 Ga0209646_1000170 Ga0209646_100017041 311
203 3300025250 Ga0209026_1000193 Ga0209026_100019341 311
204 3300025256 Ga0209759_1000222 Ga0209759_100022241 311
205 3300002704 JGI25155J39150_1000044 JGI25155J39150_100004439 312
206 3300002705 JGI25156J39149_1000058 JGI25156J39149_100005853 312
207 3300002738 JGI25154J39366_1000174 JGI25154J39366_100017439 312
208 3300002741 JGI25157J39369_1000078 JGI25157J39369_100007853 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05168

HEPN

HEPN domain

217

341

0.84

PF01909

NTP_transf_2

Nucleotidyltransferase domain

83

188

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.7008 153 300
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.6831 153 300
5a7d-assembly4.cif.gz_N tetrameric assembly of lgn with inscuteable 0.5946 139 304
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5934 30 119
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5758 155 306
ID Description Score Start End Superfamily
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7679 164 296 1.20.120.330
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7411 164 296 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7044 153 300 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6861 153 300 1.20.120.330
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.5708 153 312 1.20.120.80
ID Description Score Start End GO Terms
AF-W6RB65-F1-model_v4 Putative nucleotidyltransferase protein 0.9258 109 219 GO:0016740
AF-A0A7W9Z1K7-F1-model_v4 Putative nucleotidyltransferase 0.9172 1 142 GO:0016779
AF-A0A844A3V1-F1-model_v4 Nucleotidyltransferase 0.9101 2 139 GO:0016740
AF-W6RB65-F1-model_v4 Putative nucleotidyltransferase protein 0.9094 109 219 GO:0016740
AF-A0A3D4M4K6-F1-model_v4 deleted 0.9059 2 164

Feature Viewer

pLDDT pTM Quality
78.07 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map