F318752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 152 | 192 | 374 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100015987|Ga0070675_1000159876 |
| Length | 421 |
| Sequence | MQSRCRAPTSRLTASSDDASGVLACAAGSAVRSLAIPQSVKFVRNRVLLVLIVAGLLAGSGLAFLTAAPNRLVTGTGIRLDACLGGWRASLLLPAAALMLGVFLTAMRRTHVVMAIAATVLLTGFVWLAGDEARRLAQAGSPLSRTSFGGGFWLLVFVSWLAAADSIQRLRLRVPAMIAANVAVIAPSIALLLAGELAQLSVLKEYANRQGIFYTAFFRHLQIVVFTLLPTLLLGVPLGIASFRRERWRAPVFAVLNVIQTVPSIALFGLLLAPLAFLALHVPALSRLGIGGIGIAPAVIALTLYSLLPVVRSTVAGLTQVPAPAIEAAAGMGMTRGQILRRVQIPLALPVFLSGLRVATVQTVGLAVVAALIGAGGMGALVFQGLSSSAIDLVLLGVVPVVALAVAFDATFRLIAGALTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 2 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 3 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 4 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 5 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 6 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 7 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 8 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 9 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 10 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 11 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 12 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 13 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 90 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 91 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 92 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 96 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 97 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 100 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 101 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 102 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 103 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 104 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 105 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 135 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 136 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 137 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 145 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 147 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 148 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 149 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 150 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 151 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 152 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.87 |
| Metatranscriptomes | 0 |
| Isolates | 8.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.44 |
| Nodule | 3.35 |
| Rhizoplane | 1.44 |
| Rhizosphere | 61.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000021 | 3300002737 | Bacteria | 248155 |
| 2 | JGI25152J39213_1002093 | 3300002773 | Bacteria | 7844 |
| 3 | JGI25165J46597_1000049 | 3300003214 | Bacteria | 248154 |
| 4 | JGI25153J46596_10000769 | 3300003215 | Bacteria | 19653 |
| 5 | rootH2_10008161 | 3300003320 | Bacteria | 23559 |
| 6 | Ga0055538_1000023 | 3300003751 | Bacteria | 248154 |
| 7 | Ga0055539_1000030 | 3300003752 | Bacteria | 248154 |
| 8 | Ga0055533_1000039 | 3300003756 | Bacteria | 248154 |
| 9 | Ga0055525_1000048 | 3300003759 | Bacteria | 248154 |
| 10 | Ga0055526_1009844 | 3300003771 | Bacteria | 4535 |
| 11 | Ga0055541_1000021 | 3300003841 | Bacteria | 248154 |
| 12 | Ga0065704_10001647 | 3300005289 | Bacteria | 12195 |
| 13 | Ga0065704_10005200 | 3300005289 | Bacteria | 3313 |
| 14 | Ga0065704_10006951 | 3300005289 | Bacteria | 4128 |
| 15 | Ga0070670_100125747 | 3300005331 | Bacteria | 2213 |
| 16 | Ga0070669_100068939 | 3300005353 | Bacteria | 2611 |
| 17 | Ga0070675_100015987 | 3300005354 | Bacteria | 5946 |
| 18 | Ga0070667_100259316 | 3300005367 | Bacteria | 1556 |
| 19 | Ga0070709_10097974 | 3300005434 | Bacteria | 1948 |
| 20 | Ga0070709_10170720 | 3300005434 | Bacteria | 1519 |
| 21 | Ga0070713_100083270 | 3300005436 | Bacteria | 2734 |
| 22 | Ga0070711_100012746 | 3300005439 | Bacteria | 5263 |
| 23 | Ga0070708_100311551 | 3300005445 | Unclassified | 1482 |
| 24 | Ga0070706_100243969 | 3300005467 | Bacteria | 1677 |
| 25 | Ga0070698_100012536 | 3300005471 | Bacteria | 8975 |
| 26 | Ga0070699_100038405 | 3300005518 | Bacteria | 4146 |
| 27 | Ga0068853_100168607 | 3300005539 | Bacteria | 1980 |
| 28 | Ga0070672_100115170 | 3300005543 | Bacteria | 2195 |
| 29 | Ga0068863_100061220 | 3300005841 | Bacteria | 3558 |
| 30 | Ga0068863_100100666 | 3300005841 | Bacteria | 2747 |
| 31 | Ga0068860_100317452 | 3300005843 | Unclassified | 1529 |
| 32 | Ga0068862_100041608 | 3300005844 | Bacteria | 3910 |
| 33 | Ga0070717_10002097 | 3300006028 | Bacteria | 13974 |
| 34 | Ga0075364_10011889 | 3300006051 | Bacteria | 5303 |
| 35 | Ga0070716_100073492 | 3300006173 | Bacteria | 2017 |
| 36 | Ga0075366_10095643 | 3300006195 | Bacteria | 1781 |
| 37 | Ga0079104_1000857 | 3300006946 | Bacteria | 25267 |
| 38 | Ga0079104_1001260 | 3300006946 | Bacteria | 17571 |
| 39 | Ga0079104_1001342 | 3300006946 | Bacteria | 16847 |
| 40 | Ga0105251_10000045 | 3300009011 | Bacteria | 113579 |
| 41 | Ga0105244_10000238 | 3300009036 | Bacteria | 56566 |
| 42 | Ga0105244_10005717 | 3300009036 | Bacteria | 8206 |
| 43 | Ga0105244_10006505 | 3300009036 | Bacteria | 7541 |
| 44 | Ga0105244_10033868 | 3300009036 | Bacteria | 2692 |
| 45 | Ga0105250_10012346 | 3300009092 | Bacteria | 3527 |
| 46 | Ga0111539_10147313 | 3300009094 | Bacteria | 2756 |
| 47 | Ga0105243_10068275 | 3300009148 | Bacteria | 2865 |
| 48 | Ga0099796_10003804 | 3300010159 | Bacteria | 3558 |
| 49 | Ga0099796_10046450 | 3300010159 | Bacteria | 1491 |
| 50 | Ga0157372_10128967 | 3300013307 | Bacteria | 2909 |
| 51 | Ga0182008_10025438 | 3300014497 | Bacteria | 3006 |
| 52 | Ga0182006_1000018 | 3300015261 | Bacteria | 299376 |
| 53 | Ga0182006_1051661 | 3300015261 | Bacteria | 1581 |
| 54 | Ga0182007_10002787 | 3300015262 | Bacteria | 8518 |
| 55 | Ga0182007_10017698 | 3300015262 | Bacteria | 2596 |
| 56 | Ga0182005_1002854 | 3300015265 | Bacteria | 6011 |
| 57 | Ga0163161_10100153 | 3300017792 | Bacteria | 2156 |
| 58 | Ga0213873_10013709 | 3300021358 | Bacteria | 1783 |
| 59 | Ga0213872_10000540 | 3300021361 | Bacteria | 29434 |
| 60 | Ga0213872_10102561 | 3300021361 | Bacteria | 1275 |
| 61 | Ga0213876_10000023 | 3300021384 | Bacteria | 255370 |
| 62 | Ga0213875_10000132 | 3300021388 | Bacteria | 82929 |
| 63 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 64 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 65 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 66 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 67 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 68 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 69 | Ga0209129_1000169 | 3300025258 | Bacteria | 96253 |
| 70 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 71 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 72 | Ga0209758_1000174 | 3300025297 | Bacteria | 147347 |
| 73 | Ga0209256_1010890 | 3300025299 | Bacteria | 3732 |
| 74 | Ga0207696_1002615 | 3300025711 | Bacteria | 8731 |
| 75 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 76 | Ga0207655_1000036 | 3300025728 | Bacteria | 356747 |
| 77 | Ga0207655_1000241 | 3300025728 | Bacteria | 90061 |
| 78 | Ga0207655_1002164 | 3300025728 | Bacteria | 16372 |
| 79 | Ga0207713_1000047 | 3300025735 | Bacteria | 229463 |
| 80 | Ga0207713_1004691 | 3300025735 | Bacteria | 8809 |
| 81 | Ga0207713_1005334 | 3300025735 | Bacteria | 8074 |
| 82 | Ga0207693_10015322 | 3300025915 | Bacteria | 6153 |
| 83 | Ga0207693_10075336 | 3300025915 | Bacteria | 2642 |
| 84 | Ga0207659_10009868 | 3300025926 | Bacteria | 5977 |
| 85 | Ga0207664_10107566 | 3300025929 | Bacteria | 2314 |
| 86 | Ga0207709_10036189 | 3300025935 | Bacteria | 2924 |
| 87 | Ga0207665_10074383 | 3300025939 | Bacteria | 2325 |
| 88 | Ga0207665_10116688 | 3300025939 | Bacteria | 1882 |
| 89 | Ga0207691_10130320 | 3300025940 | Bacteria | 2222 |
| 90 | Ga0207702_10014306 | 3300026078 | Bacteria | 6588 |
| 91 | Ga0207648_10152439 | 3300026089 | Bacteria | 2040 |
| 92 | Ga0207675_100290111 | 3300026118 | Bacteria | 1591 |
| 93 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 94 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 95 | Ga0209281_1000379 | 3300027111 | Bacteria | 70495 |
| 96 | Ga0209281_1001895 | 3300027111 | Bacteria | 10028 |
| 97 | Ga0268265_10037685 | 3300028380 | Bacteria | 3551 |
| 98 | Ga0268264_10293754 | 3300028381 | Bacteria | 1527 |
| 99 | Ga0265338_10001414 | 3300028800 | Bacteria | 39085 |
| 100 | Ga0265313_10028924 | 3300031595 | Bacteria | 2873 |
| 101 | Ga0373934_0062051 | 3300035086 | Bacteria | 1489 |
| 102 | Ga0373953_0012211 | 3300035117 | Bacteria | 3037 |
| 103 | Ga0373956_0079179 | 3300035119 | Bacteria | 1506 |
| 104 | Ga0373931_0067748 | 3300035691 | Bacteria | 1941 |
| 105 | Ga0373937_0002666 | 3300036401 | Bacteria | 14879 |
| 106 | Ga0436364_0717863 | 3300037853 | Bacteria | 145182 |
| 107 | Ga0436364_0893133 | 3300037853 | Bacteria | 5060 |
| 108 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 109 | Ga0436360_0648959 | 3300039438 | Bacteria | 3727 |
| 110 | Ga0436361_0075611 | 3300039447 | Bacteria | 1685 |
| 111 | Ga0436361_0246911 | 3300039447 | Bacteria | 1926 |
| 112 | Ga0436361_0314477 | 3300039447 | Bacteria | 31154 |
| 113 | Ga0436363_0757131 | 3300039450 | Bacteria | 1976 |
| 114 | Ga0436363_1523004 | 3300039450 | Bacteria | 1831 |
| 115 | Ga0436362_1017215 | 3300039453 | Bacteria | 1722 |
| 116 | Ga0436362_1275728 | 3300039453 | Bacteria | 3280 |
| 117 | Ga0439438_002006 | 3300041405 | Bacteria | 8886 |
| 118 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 119 | Ga0439452_000188 | 3300042010 | Bacteria | 45681 |
| 120 | Ga0439452_003890 | 3300042010 | Bacteria | 5118 |
| 121 | Ga0450900_000249 | 3300042136 | Bacteria | 3723 |
| 122 | Ga0466969_0002935 | 3300044656 | Bacteria | 9100 |
| 123 | Ga0466965_0012438 | 3300044683 | Bacteria | 4003 |
| 124 | Ga0466966_0010257 | 3300044684 | Bacteria | 6216 |
| 125 | Ga0466961_0000289 | 3300044693 | Bacteria | 33371 |
| 126 | Ga0466959_0005784 | 3300045049 | Bacteria | 8517 |
| 127 | Ga0466959_0150113 | 3300045049 | Bacteria | 1643 |
| 128 | Ga0495627_023565 | 3300046453 | Bacteria | 2015 |
| 129 | Ga0495592_0034094 | 3300046454 | Bacteria | 3839 |
| 130 | Ga0495591_000050 | 3300046458 | Bacteria | 137772 |
| 131 | Ga0495591_004388 | 3300046458 | Bacteria | 6928 |
| 132 | Ga0495638_0002141 | 3300046460 | Bacteria | 16586 |
| 133 | Ga0495651_0001469 | 3300046462 | Bacteria | 18227 |
| 134 | Ga0495651_0091379 | 3300046462 | Bacteria | 2282 |
| 135 | Ga0495653_0105077 | 3300046463 | Bacteria | 2039 |
| 136 | Ga0495608_0044822 | 3300046511 | Bacteria | 2950 |
| 137 | Ga0495618_0110451 | 3300046514 | Bacteria | 1760 |
| 138 | Ga0495620_0071719 | 3300046515 | Bacteria | 1415 |
| 139 | Ga0495628_0000750 | 3300046516 | Bacteria | 29958 |
| 140 | Ga0495628_0018907 | 3300046516 | Bacteria | 5701 |
| 141 | Ga0495628_0083689 | 3300046516 | Bacteria | 2477 |
| 142 | Ga0495652_0025368 | 3300046529 | Bacteria | 5245 |
| 143 | Ga0495652_0163826 | 3300046529 | Bacteria | 1723 |
| 144 | Ga0495654_0014307 | 3300046530 | Bacteria | 4225 |
| 145 | Ga0495645_0066585 | 3300046543 | Bacteria | 2603 |
| 146 | Ga0495645_0154032 | 3300046543 | Bacteria | 1594 |
| 147 | Ga0495667_0033469 | 3300046559 | Bacteria | 3440 |
| 148 | Ga0495635_0017469 | 3300046663 | Bacteria | 5010 |
| 149 | Ga0495623_0022003 | 3300046679 | Bacteria | 4118 |
| 150 | Ga0495646_0000288 | 3300046680 | Bacteria | 25753 |
| 151 | Ga0495624_0021114 | 3300046690 | Bacteria | 4323 |
| 152 | Ga0495649_0000771 | 3300046694 | Bacteria | 25741 |
| 153 | Ga0495649_0002331 | 3300046694 | Bacteria | 13443 |
| 154 | Ga0495600_0000297 | 3300046809 | Bacteria | 26522 |
| 155 | Ga0495604_0011452 | 3300047317 | Bacteria | 7042 |
| 156 | Ga0495679_002939 | 3300047446 | Bacteria | 8418 |
| 157 | Ga0495673_0000114 | 3300047469 | Bacteria | 159048 |
| 158 | Ga0496104_0000385 | 3300048907 | Bacteria | 38635 |
| 159 | Ga0496105_0171999 | 3300048908 | Bacteria | 1775 |
| 160 | Ga0496116_0000818 | 3300048919 | Bacteria | 39415 |
| 161 | Ga0496116_0012241 | 3300048919 | Bacteria | 7015 |
| 162 | Ga0496116_0055170 | 3300048919 | Bacteria | 2611 |
| 163 | Ga0496116_0072626 | 3300048919 | Bacteria | 2173 |
| 164 | Ga0496117_0000639 | 3300048920 | Bacteria | 56383 |
| 165 | Ga0496119_0011595 | 3300048922 | Bacteria | 7273 |
| 166 | Ga0496119_0016761 | 3300048922 | Bacteria | 5551 |
| 167 | Ga0496119_0044640 | 3300048922 | Bacteria | 2787 |
| 168 | Ga0496120_0000193 | 3300048923 | Bacteria | 104145 |
| 169 | Ga0496120_0024264 | 3300048923 | Bacteria | 3784 |
| 170 | Ga0496121_0003759 | 3300048924 | Bacteria | 21251 |
| 171 | Ga0496121_0011509 | 3300048924 | Bacteria | 9806 |
| 172 | Ga0496121_0018775 | 3300048924 | Bacteria | 6949 |
| 173 | Ga0496121_0046185 | 3300048924 | Bacteria | 3730 |
| 174 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 175 | Ga0496122_0000088 | 3300048925 | Bacteria | 207600 |
| 176 | Ga0496122_0021485 | 3300048925 | Bacteria | 5776 |
| 177 | Ga0496122_0135966 | 3300048925 | Bacteria | 1549 |
| 178 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 179 | Ga0496123_0072522 | 3300048926 | Bacteria | 2142 |
| 180 | Ga0496124_0000611 | 3300048927 | Bacteria | 60081 |
| 181 | Ga0496124_0001009 | 3300048927 | Bacteria | 44577 |
| 182 | Ga0496124_0045707 | 3300048927 | Bacteria | 3753 |
| 183 | Ga0496125_0010032 | 3300048928 | Bacteria | 9620 |
| 184 | Ga0496125_0010332 | 3300048928 | Bacteria | 9448 |
| 185 | Ga0496126_0012885 | 3300048929 | Bacteria | 8540 |
| 186 | Ga0496126_0053498 | 3300048929 | Bacteria | 3663 |
| 187 | Ga0496126_0085882 | 3300048929 | Bacteria | 2773 |
| 188 | Ga0496126_0257102 | 3300048929 | Bacteria | 1453 |
| 189 | nmdc:mga00v17_1510_c1 | 3300050491 | Bacteria | 12146 |
| 190 | Ga0495595_0005428 | 3300053084 | Bacteria | 5163 |
| 191 | Ga0500595_000752 | 3300053119 | Bacteria | 19054 |
| 192 | Ga0500574_000271 | 3300053141 | Bacteria | 6320 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046458 | Ga0495591_004388 | Ga0495591_004388_3642_4799 | 291 |
| 2 | 3300046694 | Ga0495649_0002331 | Ga0495649_0002331_1758_2915 | 291 |
| 3 | 3300031595 | Ga0265313_10028924 | Ga0265313_100289243 | 297 |
| 4 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_374003_375160 | 298 |
| 5 | 3300039450 | Ga0436363_0757131 | Ga0436363_0757131_412_1668 | 299 |
| 6 | 3300014497 | Ga0182008_10025438 | Ga0182008_100254382 | 301 |
| 7 | 3300006946 | Ga0079104_1000857 | Ga0079104_10008579 | 303 |
| 8 | 3300027111 | Ga0209281_1000006 | Ga0209281_1000006103 | 303 |
| 9 | 3300039453 | Ga0436362_1017215 | Ga0436362_1017215_359_1516 | 304 |
| 10 | 3300039437 | Ga0436365_0965775 | Ga0436365_0965775_227177_228307 | 306 |
| 11 | 3300048922 | Ga0496119_0044640 | Ga0496119_0044640_1557_2615 | 306 |
| 12 | 3300039450 | Ga0436363_1523004 | Ga0436363_1523004_18_1181 | 308 |
| 13 | 3300048919 | Ga0496116_0072626 | Ga0496116_0072626_393_1505 | 309 |
| 14 | 3300006946 | Ga0079104_1001342 | Ga0079104_10013423 | 312 |
| 15 | 3300037853 | Ga0436364_0893133 | Ga0436364_0893133_1964_3127 | 313 |
| 16 | 3300021384 | Ga0213876_10000023 | Ga0213876_10000023198 | 314 |
| 17 | 3300046460 | Ga0495638_0002141 | Ga0495638_0002141_15274_16431 | 314 |
| 18 | 3300010159 | Ga0099796_10046450 | Ga0099796_100464502 | 315 |
| 19 | 3300042010 | Ga0439452_003890 | Ga0439452_003890_1457_2590 | 315 |
| 20 | 3300042010 | Ga0439452_000188 | Ga0439452_000188_20450_21607 | 317 |
| 21 | 3300005467 | Ga0070706_100243969 | Ga0070706_1002439692 | 318 |
| 22 | 3300044656 | Ga0466969_0002935 | Ga0466969_0002935_4543_5691 | 318 |
| 23 | 3300044684 | Ga0466966_0010257 | Ga0466966_0010257_3609_4757 | 318 |
| 24 | 3300044693 | Ga0466961_0000289 | Ga0466961_0000289_19022_20170 | 318 |
| 25 | 3300045049 | Ga0466959_0150113 | Ga0466959_0150113_33_1181 | 318 |
| 26 | 3300025915 | Ga0207693_10015322 | Ga0207693_100153226 | 319 |
| 27 | 3300046515 | Ga0495620_0071719 | Ga0495620_0071719_72_1229 | 319 |
| 28 | 3300046694 | Ga0495649_0000771 | Ga0495649_0000771_1758_2915 | 319 |
| 29 | 3300009036 | Ga0105244_10006505 | Ga0105244_100065052 | 320 |
| 30 | 3300025915 | Ga0207693_10075336 | Ga0207693_100753362 | 320 |
| 31 | 3300046453 | Ga0495627_023565 | Ga0495627_023565_795_1928 | 320 |
| 32 | 3300048925 | Ga0496122_0000088 | Ga0496122_0000088_114399_115529 | 320 |
| 33 | 3300048929 | Ga0496126_0085882 | Ga0496126_0085882_86_1207 | 321 |
| 34 | 3300005434 | Ga0070709_10170720 | Ga0070709_101707201 | 322 |
| 35 | 3300025939 | Ga0207665_10074383 | Ga0207665_100743832 | 322 |
| 36 | 3300025735 | Ga0207713_1005334 | Ga0207713_10053349 | 324 |
| 37 | 3300048907 | Ga0496104_0000385 | Ga0496104_0000385_25545_26702 | 324 |
| 38 | 3300048908 | Ga0496105_0171999 | Ga0496105_0171999_467_1624 | 324 |
| 39 | 3300048919 | Ga0496116_0055170 | Ga0496116_0055170_882_2039 | 324 |
| 40 | 3300048922 | Ga0496119_0016761 | Ga0496119_0016761_3429_4586 | 324 |
| 41 | 3300048924 | Ga0496121_0018775 | Ga0496121_0018775_3297_4454 | 324 |
| 42 | 3300048924 | Ga0496121_0046185 | Ga0496121_0046185_2055_3212 | 324 |
| 43 | 3300048928 | Ga0496125_0010032 | Ga0496125_0010032_678_1835 | 324 |
| 44 | 3300021361 | Ga0213872_10102561 | Ga0213872_101025611 | 325 |
| 45 | 3300026078 | Ga0207702_10014306 | Ga0207702_100143064 | 325 |
| 46 | 3300039447 | Ga0436361_0246911 | Ga0436361_0246911_77_1225 | 325 |
| 47 | 3300009092 | Ga0105250_10012346 | Ga0105250_100123463 | 326 |
| 48 | 3300025728 | Ga0207655_1000023 | Ga0207655_100002398 | 326 |
| 49 | 3300039438 | Ga0436360_0648959 | Ga0436360_0648959_934_2148 | 326 |
| 50 | 3300044683 | Ga0466965_0012438 | Ga0466965_0012438_1020_2168 | 326 |
| 51 | 3300045049 | Ga0466959_0005784 | Ga0466959_0005784_204_1352 | 326 |
| 52 | 3300047446 | Ga0495679_002939 | Ga0495679_002939_3652_4776 | 326 |
| 53 | 3300006173 | Ga0070716_100073492 | Ga0070716_1000734922 | 327 |
| 54 | 3300025939 | Ga0207665_10116688 | Ga0207665_101166882 | 327 |
| 55 | 3300046530 | Ga0495654_0014307 | Ga0495654_0014307_763_1920 | 327 |
| 56 | 3300047469 | Ga0495673_0000114 | Ga0495673_0000114_103380_104537 | 327 |
| 57 | 3300025728 | Ga0207655_1002164 | Ga0207655_10021647 | 328 |
| 58 | 3300005434 | Ga0070709_10097974 | Ga0070709_100979741 | 329 |
| 59 | 3300005436 | Ga0070713_100083270 | Ga0070713_1000832703 | 329 |
| 60 | 3300028800 | Ga0265338_10001414 | Ga0265338_1000141420 | 329 |
| 61 | 3300048929 | Ga0496126_0053498 | Ga0496126_0053498_194_1345 | 329 |
| 62 | 3300009036 | Ga0105244_10000238 | Ga0105244_1000023845 | 330 |
| 63 | 3300015261 | Ga0182006_1000018 | Ga0182006_1000018173 | 330 |
| 64 | 3300025728 | Ga0207655_1000241 | Ga0207655_100024145 | 330 |
| 65 | 3300048927 | Ga0496124_0001009 | Ga0496124_0001009_5799_6956 | 330 |
| 66 | 3300009036 | Ga0105244_10005717 | Ga0105244_100057175 | 331 |
| 67 | 3300013307 | Ga0157372_10128967 | Ga0157372_101289672 | 331 |
| 68 | 3300048925 | Ga0496122_0021485 | Ga0496122_0021485_2055_3188 | 331 |
| 69 | 3300048927 | Ga0496124_0000611 | Ga0496124_0000611_56345_57478 | 331 |
| 70 | 3300048928 | Ga0496125_0010332 | Ga0496125_0010332_5839_6972 | 331 |
| 71 | 3300005439 | Ga0070711_100012746 | Ga0070711_1000127465 | 332 |
| 72 | 3300041405 | Ga0439438_002006 | Ga0439438_002006_2327_3484 | 332 |
| 73 | 3300042136 | Ga0450900_000249 | Ga0450900_000249_246_1403 | 332 |
| 74 | 3300048927 | Ga0496124_0045707 | Ga0496124_0045707_2272_3429 | 332 |
| 75 | 3300027111 | Ga0209281_1000379 | Ga0209281_10003799 | 334 |
| 76 | 3300021361 | Ga0213872_10000540 | Ga0213872_1000054014 | 335 |
| 77 | 3300039447 | Ga0436361_0314477 | Ga0436361_0314477_12367_13509 | 335 |
| 78 | iso_pu_bacteria | 2547132416 | 2548648213 | 335 |
| 79 | iso_pu_bacteria | 2643221733 | 2644732798 | 335 |
| 80 | iso_pu_bacteria | 2775506706 | 2775541416 | 335 |
| 81 | iso_pu_bacteria | 2821118458 | 2821120931 | 335 |
| 82 | iso_pu_bacteria | 2844425489 | 2844428257 | 335 |
| 83 | iso_pu_bacteria | 2939568625 | 2939569925 | 335 |
| 84 | iso_pu_bacteria | 2939607340 | 2939608790 | 335 |
| 85 | iso_pu_bacteria | 2939642701 | 2939643056 | 335 |
| 86 | iso_pu_bacteria | 8018221730 | 8018224140 | 335 |
| 87 | iso_pu_bacteria | 8055087960 | 8055092049 | 335 |
| 88 | iso_pu_bacteria | 8055092621 | 8055095385 | 335 |
| 89 | iso_pu_bacteria | 8055097453 | 8055100082 | 335 |
| 90 | iso_pu_bacteria | 8057304971 | 8057306890 | 335 |
| 91 | 3300005367 | Ga0070667_100259316 | Ga0070667_1002593162 | 336 |
| 92 | 3300005843 | Ga0068860_100317452 | Ga0068860_1003174522 | 336 |
| 93 | 3300025940 | Ga0207691_10130320 | Ga0207691_101303202 | 336 |
| 94 | 3300026089 | Ga0207648_10152439 | Ga0207648_101524392 | 336 |
| 95 | 3300028380 | Ga0268265_10037685 | Ga0268265_100376852 | 336 |
| 96 | iso_pu_bacteria | 3000376612 | 3000378506 | 336 |
| 97 | 3300005471 | Ga0070698_100012536 | Ga0070698_1000125365 | 337 |
| 98 | 3300006028 | Ga0070717_10002097 | Ga0070717_1000209713 | 337 |
| 99 | 3300006195 | Ga0075366_10095643 | Ga0075366_100956432 | 337 |
| 100 | 3300010159 | Ga0099796_10003804 | Ga0099796_100038042 | 337 |
| 101 | 3300025929 | Ga0207664_10107566 | Ga0207664_101075662 | 337 |
| 102 | 3300035691 | Ga0373931_0067748 | Ga0373931_0067748_706_1848 | 337 |
| 103 | iso_pu_bacteria | 3003665799 | 3003668974 | 338 |
| 104 | 3300003320 | rootH2_10008161 | rootH2_100081612 | 339 |
| 105 | 3300005289 | Ga0065704_10001647 | Ga0065704_100016476 | 339 |
| 106 | 3300005289 | Ga0065704_10005200 | Ga0065704_100052002 | 339 |
| 107 | 3300005331 | Ga0070670_100125747 | Ga0070670_1001257472 | 339 |
| 108 | 3300005353 | Ga0070669_100068939 | Ga0070669_1000689392 | 339 |
| 109 | 3300005841 | Ga0068863_100061220 | Ga0068863_1000612204 | 339 |
| 110 | 3300005844 | Ga0068862_100041608 | Ga0068862_1000416084 | 339 |
| 111 | 3300006051 | Ga0075364_10011889 | Ga0075364_100118894 | 339 |
| 112 | 3300006946 | Ga0079104_1001260 | Ga0079104_10012604 | 339 |
| 113 | 3300009036 | Ga0105244_10033868 | Ga0105244_100338682 | 339 |
| 114 | 3300025728 | Ga0207655_1000036 | Ga0207655_1000036234 | 339 |
| 115 | 3300025735 | Ga0207713_1000047 | Ga0207713_100004788 | 339 |
| 116 | 3300025735 | Ga0207713_1004691 | Ga0207713_10046918 | 339 |
| 117 | 3300025935 | Ga0207709_10036189 | Ga0207709_100361892 | 339 |
| 118 | 3300027111 | Ga0209281_1000004 | Ga0209281_1000004328 | 339 |
| 119 | 3300028381 | Ga0268264_10293754 | Ga0268264_102937542 | 339 |
| 120 | 3300039447 | Ga0436361_0075611 | Ga0436361_0075611_18_1175 | 339 |
| 121 | 3300046458 | Ga0495591_000050 | Ga0495591_000050_27443_28600 | 339 |
| 122 | 3300048919 | Ga0496116_0012241 | Ga0496116_0012241_441_1598 | 339 |
| 123 | 3300048923 | Ga0496120_0024264 | Ga0496120_0024264_1332_2489 | 339 |
| 124 | 3300048924 | Ga0496121_0003759 | Ga0496121_0003759_5635_6792 | 339 |
| 125 | 3300048925 | Ga0496122_0000003 | Ga0496122_0000003_360603_361760 | 339 |
| 126 | 3300048926 | Ga0496123_0000012 | Ga0496123_0000012_115786_116943 | 339 |
| 127 | 3300048929 | Ga0496126_0257102 | Ga0496126_0257102_53_1210 | 339 |
| 128 | 3300050491 | nmdc:mga00v17_1510_c1 | nmdc:mga00v17_1510_c1_5796_6953 | 339 |
| 129 | 3300005289 | Ga0065704_10006951 | Ga0065704_100069513 | 340 |
| 130 | 3300005841 | Ga0068863_100100666 | Ga0068863_1001006663 | 340 |
| 131 | 3300009011 | Ga0105251_10000045 | Ga0105251_1000004529 | 340 |
| 132 | 3300009148 | Ga0105243_10068275 | Ga0105243_100682753 | 340 |
| 133 | 3300025711 | Ga0207696_1002615 | Ga0207696_10026154 | 340 |
| 134 | 3300027111 | Ga0209281_1001895 | Ga0209281_100189510 | 340 |
| 135 | 3300048920 | Ga0496117_0000639 | Ga0496117_0000639_21030_22190 | 340 |
| 136 | 3300048924 | Ga0496121_0011509 | Ga0496121_0011509_7130_8290 | 340 |
| 137 | 3300048925 | Ga0496122_0135966 | Ga0496122_0135966_121_1281 | 340 |
| 138 | 3300048926 | Ga0496123_0072522 | Ga0496123_0072522_713_1873 | 340 |
| 139 | 3300048929 | Ga0496126_0012885 | Ga0496126_0012885_1578_2738 | 340 |
| 140 | 3300048919 | Ga0496116_0000818 | Ga0496116_0000818_11564_12730 | 341 |
| 141 | 3300048922 | Ga0496119_0011595 | Ga0496119_0011595_3081_4247 | 341 |
| 142 | 3300048923 | Ga0496120_0000193 | Ga0496120_0000193_49951_51117 | 341 |
| 143 | 3300005445 | Ga0070708_100311551 | Ga0070708_1003115512 | 342 |
| 144 | 3300005518 | Ga0070699_100038405 | Ga0070699_1000384054 | 342 |
| 145 | 3300035119 | Ga0373956_0079179 | Ga0373956_0079179_101_1306 | 342 |
| 146 | 3300002773 | JGI25152J39213_1002093 | JGI25152J39213_10020932 | 343 |
| 147 | 3300003215 | JGI25153J46596_10000769 | JGI25153J46596_100007698 | 343 |
| 148 | 3300003771 | Ga0055526_1009844 | Ga0055526_10098441 | 343 |
| 149 | 3300005543 | Ga0070672_100115170 | Ga0070672_1001151702 | 343 |
| 150 | 3300009094 | Ga0111539_10147313 | Ga0111539_101473132 | 343 |
| 151 | 3300025258 | Ga0209129_1000169 | Ga0209129_100016965 | 343 |
| 152 | 3300025295 | Ga0209564_1000057 | Ga0209564_1000057184 | 343 |
| 153 | 3300025297 | Ga0209758_1000174 | Ga0209758_100017494 | 343 |
| 154 | 3300025299 | Ga0209256_1010890 | Ga0209256_10108903 | 343 |
| 155 | 3300025926 | Ga0207659_10009868 | Ga0207659_100098686 | 343 |
| 156 | 3300026118 | Ga0207675_100290111 | Ga0207675_1002901112 | 343 |
| 157 | iso_pu_bacteria | 2952252522 | 2952255804 | 343 |
| 158 | 3300046511 | Ga0495608_0044822 | Ga0495608_0044822_582_1742 | 345 |
| 159 | 3300046462 | Ga0495651_0001469 | Ga0495651_0001469_4696_5859 | 346 |
| 160 | 3300046516 | Ga0495628_0000750 | Ga0495628_0000750_7436_8599 | 346 |
| 161 | 3300046529 | Ga0495652_0025368 | Ga0495652_0025368_2392_3555 | 346 |
| 162 | 3300046679 | Ga0495623_0022003 | Ga0495623_0022003_2417_3580 | 346 |
| 163 | 3300046543 | Ga0495645_0154032 | Ga0495645_0154032_18_1187 | 348 |
| 164 | 3300017792 | Ga0163161_10100153 | Ga0163161_101001532 | 350 |
| 165 | 3300035086 | Ga0373934_0062051 | Ga0373934_0062051_102_1307 | 352 |
| 166 | 3300035117 | Ga0373953_0012211 | Ga0373953_0012211_173_1378 | 352 |
| 167 | 3300036401 | Ga0373937_0002666 | Ga0373937_0002666_9778_10983 | 352 |
| 168 | 3300046559 | Ga0495667_0033469 | Ga0495667_0033469_1709_2914 | 352 |
| 169 | 3300053084 | Ga0495595_0005428 | Ga0495595_0005428_1765_2970 | 352 |
| 170 | 3300005539 | Ga0068853_100168607 | Ga0068853_1001686072 | 353 |
| 171 | 3300021388 | Ga0213875_10000132 | Ga0213875_1000013231 | 353 |
| 172 | 3300037853 | Ga0436364_0717863 | Ga0436364_0717863_93612_94820 | 353 |
| 173 | 3300021358 | Ga0213873_10013709 | Ga0213873_100137092 | 354 |
| 174 | 3300039453 | Ga0436362_1275728 | Ga0436362_1275728_407_1618 | 354 |
| 175 | 3300005354 | Ga0070675_100015987 | Ga0070675_1000159876 | 355 |
| 176 | iso_pu_bacteria | 2818991436 | 2819541738 | 356 |
| 177 | 3300015262 | Ga0182007_10002787 | Ga0182007_100027876 | 357 |
| 178 | 3300002737 | JGI25162J39368_1000021 | JGI25162J39368_1000021107 | 360 |
| 179 | 3300003214 | JGI25165J46597_1000049 | JGI25165J46597_1000049117 | 360 |
| 180 | 3300003751 | Ga0055538_1000023 | Ga0055538_1000023107 | 360 |
| 181 | 3300003752 | Ga0055539_1000030 | Ga0055539_1000030107 | 360 |
| 182 | 3300003756 | Ga0055533_1000039 | Ga0055533_1000039107 | 360 |
| 183 | 3300003759 | Ga0055525_1000048 | Ga0055525_1000048117 | 360 |
| 184 | 3300003841 | Ga0055541_1000021 | Ga0055541_1000021117 | 360 |
| 185 | 3300015261 | Ga0182006_1051661 | Ga0182006_10516612 | 360 |
| 186 | 3300015262 | Ga0182007_10017698 | Ga0182007_100176982 | 360 |
| 187 | 3300015265 | Ga0182005_1002854 | Ga0182005_10028545 | 360 |
| 188 | 3300025224 | Ga0209784_100004 | Ga0209784_1000041148 | 360 |
| 189 | 3300025225 | Ga0209566_100004 | Ga0209566_1000041305 | 360 |
| 190 | 3300025226 | Ga0209674_100006 | Ga0209674_1000061305 | 360 |
| 191 | 3300025230 | Ga0209563_100009 | Ga0209563_1000091148 | 360 |
| 192 | 3300025233 | Ga0209437_100004 | Ga0209437_1000041148 | 360 |
| 193 | 3300025253 | Ga0209677_100005 | Ga0209677_1000051148 | 360 |
| 194 | 3300025261 | Ga0209233_1000005 | Ga0209233_10000051305 | 360 |
| 195 | 3300046454 | Ga0495592_0034094 | Ga0495592_0034094_1285_2490 | 360 |
| 196 | 3300046462 | Ga0495651_0091379 | Ga0495651_0091379_480_1685 | 360 |
| 197 | 3300046463 | Ga0495653_0105077 | Ga0495653_0105077_664_1869 | 360 |
| 198 | 3300046514 | Ga0495618_0110451 | Ga0495618_0110451_413_1618 | 360 |
| 199 | 3300046516 | Ga0495628_0018907 | Ga0495628_0018907_681_1886 | 360 |
| 200 | 3300046516 | Ga0495628_0083689 | Ga0495628_0083689_274_1500 | 360 |
| 201 | 3300046529 | Ga0495652_0163826 | Ga0495652_0163826_378_1604 | 360 |
| 202 | 3300046543 | Ga0495645_0066585 | Ga0495645_0066585_834_2060 | 360 |
| 203 | 3300046663 | Ga0495635_0017469 | Ga0495635_0017469_2175_3380 | 360 |
| 204 | 3300046680 | Ga0495646_0000288 | Ga0495646_0000288_9090_10316 | 360 |
| 205 | 3300046690 | Ga0495624_0021114 | Ga0495624_0021114_1772_2977 | 360 |
| 206 | 3300046809 | Ga0495600_0000297 | Ga0495600_0000297_12611_13816 | 360 |
| 207 | 3300047317 | Ga0495604_0011452 | Ga0495604_0011452_3217_4422 | 360 |
| 208 | 3300053119 | Ga0500595_000752 | Ga0500595_000752_12162_13367 | 360 |
| 209 | 3300053141 | Ga0500574_000271 | Ga0500574_000271_745_1950 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
231
421
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.8621 | 140 | 354 |
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.8491 | 127 | 348 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.8336 | 140 | 354 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.8247 | 157 | 345 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.8209 | 151 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33361_169_379_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9854 | 148 | 353 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9609 | 151 | 351 | 1.10.3720.10 |
| af_P33361_169_379_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9578 | 148 | 353 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9278 | 151 | 351 | 1.10.3720.10 |
| af_P33359_41_239_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.927 | 151 | 354 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C0GFN2-F1-model_v4 | Binding-protein-dependent transport systems inner membrane component | 0.9786 | 140 | 359 |
GO:0005886
GO:0031460 GO:0055085 |
| AF-A0A8B0U8B4-F1-model_v4 | deleted | 0.9751 | 140 | 351 |
|
| AF-A0A5M4ALH3-F1-model_v4 | Glycine/betaine ABC transporter substrate-binding protein | 0.9701 | 140 | 354 |
GO:0022857
GO:0031460 GO:0043190 |
| AF-A0A2W4NI70-F1-model_v4 | deleted | 0.9687 | 237 | 359 |
|
| AF-A0A7T9I0W5-F1-model_v4 | deleted | 0.9574 | 155 | 357 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar