F318752

General Info

Members Datasets Scaffolds Average Seq Length
209 152 192 374

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100015987|Ga0070675_1000159876
Length 421
Sequence MQSRCRAPTSRLTASSDDASGVLACAAGSAVRSLAIPQSVKFVRNRVLLVLIVAGLLAGSGLAFLTAAPNRLVTGTGIRLDACLGGWRASLLLPAAALMLGVFLTAMRRTHVVMAIAATVLLTGFVWLAGDEARRLAQAGSPLSRTSFGGGFWLLVFVSWLAAADSIQRLRLRVPAMIAANVAVIAPSIALLLAGELAQLSVLKEYANRQGIFYTAFFRHLQIVVFTLLPTLLLGVPLGIASFRRERWRAPVFAVLNVIQTVPSIALFGLLLAPLAFLALHVPALSRLGIGGIGIAPAVIALTLYSLLPVVRSTVAGLTQVPAPAIEAAAGMGMTRGQILRRVQIPLALPVFLSGLRVATVQTVGLAVVAALIGAGGMGALVFQGLSSSAIDLVLLGVVPVVALAVAFDATFRLIAGALTP

Samples

Sample ID Description Type Environment
1 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
2 2643221733 Bosea sp. Root381 Isolate Unclassified
3 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2821118458 Enterobacter asburiae 609 Isolate Unclassified
6 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
7 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
8 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
9 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
10 2952252522 Salinicola sp. DM10 Isolate Unclassified
11 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
12 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
147 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
148 8018221730 Enterobacter sp. CM29 Isolate Unclassified
149 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
150 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
151 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
152 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.87
Metatranscriptomes 0
Isolates 8.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 3.35
Rhizoplane 1.44
Rhizosphere 61.72
Stem 0
Stem Tuber 0
Unclassified 21.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000021 3300002737 Bacteria 248155
2 JGI25152J39213_1002093 3300002773 Bacteria 7844
3 JGI25165J46597_1000049 3300003214 Bacteria 248154
4 JGI25153J46596_10000769 3300003215 Bacteria 19653
5 rootH2_10008161 3300003320 Bacteria 23559
6 Ga0055538_1000023 3300003751 Bacteria 248154
7 Ga0055539_1000030 3300003752 Bacteria 248154
8 Ga0055533_1000039 3300003756 Bacteria 248154
9 Ga0055525_1000048 3300003759 Bacteria 248154
10 Ga0055526_1009844 3300003771 Bacteria 4535
11 Ga0055541_1000021 3300003841 Bacteria 248154
12 Ga0065704_10001647 3300005289 Bacteria 12195
13 Ga0065704_10005200 3300005289 Bacteria 3313
14 Ga0065704_10006951 3300005289 Bacteria 4128
15 Ga0070670_100125747 3300005331 Bacteria 2213
16 Ga0070669_100068939 3300005353 Bacteria 2611
17 Ga0070675_100015987 3300005354 Bacteria 5946
18 Ga0070667_100259316 3300005367 Bacteria 1556
19 Ga0070709_10097974 3300005434 Bacteria 1948
20 Ga0070709_10170720 3300005434 Bacteria 1519
21 Ga0070713_100083270 3300005436 Bacteria 2734
22 Ga0070711_100012746 3300005439 Bacteria 5263
23 Ga0070708_100311551 3300005445 Unclassified 1482
24 Ga0070706_100243969 3300005467 Bacteria 1677
25 Ga0070698_100012536 3300005471 Bacteria 8975
26 Ga0070699_100038405 3300005518 Bacteria 4146
27 Ga0068853_100168607 3300005539 Bacteria 1980
28 Ga0070672_100115170 3300005543 Bacteria 2195
29 Ga0068863_100061220 3300005841 Bacteria 3558
30 Ga0068863_100100666 3300005841 Bacteria 2747
31 Ga0068860_100317452 3300005843 Unclassified 1529
32 Ga0068862_100041608 3300005844 Bacteria 3910
33 Ga0070717_10002097 3300006028 Bacteria 13974
34 Ga0075364_10011889 3300006051 Bacteria 5303
35 Ga0070716_100073492 3300006173 Bacteria 2017
36 Ga0075366_10095643 3300006195 Bacteria 1781
37 Ga0079104_1000857 3300006946 Bacteria 25267
38 Ga0079104_1001260 3300006946 Bacteria 17571
39 Ga0079104_1001342 3300006946 Bacteria 16847
40 Ga0105251_10000045 3300009011 Bacteria 113579
41 Ga0105244_10000238 3300009036 Bacteria 56566
42 Ga0105244_10005717 3300009036 Bacteria 8206
43 Ga0105244_10006505 3300009036 Bacteria 7541
44 Ga0105244_10033868 3300009036 Bacteria 2692
45 Ga0105250_10012346 3300009092 Bacteria 3527
46 Ga0111539_10147313 3300009094 Bacteria 2756
47 Ga0105243_10068275 3300009148 Bacteria 2865
48 Ga0099796_10003804 3300010159 Bacteria 3558
49 Ga0099796_10046450 3300010159 Bacteria 1491
50 Ga0157372_10128967 3300013307 Bacteria 2909
51 Ga0182008_10025438 3300014497 Bacteria 3006
52 Ga0182006_1000018 3300015261 Bacteria 299376
53 Ga0182006_1051661 3300015261 Bacteria 1581
54 Ga0182007_10002787 3300015262 Bacteria 8518
55 Ga0182007_10017698 3300015262 Bacteria 2596
56 Ga0182005_1002854 3300015265 Bacteria 6011
57 Ga0163161_10100153 3300017792 Bacteria 2156
58 Ga0213873_10013709 3300021358 Bacteria 1783
59 Ga0213872_10000540 3300021361 Bacteria 29434
60 Ga0213872_10102561 3300021361 Bacteria 1275
61 Ga0213876_10000023 3300021384 Bacteria 255370
62 Ga0213875_10000132 3300021388 Bacteria 82929
63 Ga0209784_100004 3300025224 Bacteria 1378156
64 Ga0209566_100004 3300025225 Bacteria 1531866
65 Ga0209674_100006 3300025226 Bacteria 1531866
66 Ga0209563_100009 3300025230 Bacteria 1378156
67 Ga0209437_100004 3300025233 Bacteria 1378156
68 Ga0209677_100005 3300025253 Bacteria 1378156
69 Ga0209129_1000169 3300025258 Bacteria 96253
70 Ga0209233_1000005 3300025261 Bacteria 1531866
71 Ga0209564_1000057 3300025295 Bacteria 340400
72 Ga0209758_1000174 3300025297 Bacteria 147347
73 Ga0209256_1010890 3300025299 Bacteria 3732
74 Ga0207696_1002615 3300025711 Bacteria 8731
75 Ga0207655_1000023 3300025728 Bacteria 467070
76 Ga0207655_1000036 3300025728 Bacteria 356747
77 Ga0207655_1000241 3300025728 Bacteria 90061
78 Ga0207655_1002164 3300025728 Bacteria 16372
79 Ga0207713_1000047 3300025735 Bacteria 229463
80 Ga0207713_1004691 3300025735 Bacteria 8809
81 Ga0207713_1005334 3300025735 Bacteria 8074
82 Ga0207693_10015322 3300025915 Bacteria 6153
83 Ga0207693_10075336 3300025915 Bacteria 2642
84 Ga0207659_10009868 3300025926 Bacteria 5977
85 Ga0207664_10107566 3300025929 Bacteria 2314
86 Ga0207709_10036189 3300025935 Bacteria 2924
87 Ga0207665_10074383 3300025939 Bacteria 2325
88 Ga0207665_10116688 3300025939 Bacteria 1882
89 Ga0207691_10130320 3300025940 Bacteria 2222
90 Ga0207702_10014306 3300026078 Bacteria 6588
91 Ga0207648_10152439 3300026089 Bacteria 2040
92 Ga0207675_100290111 3300026118 Bacteria 1591
93 Ga0209281_1000004 3300027111 Bacteria 1253949
94 Ga0209281_1000006 3300027111 Bacteria 1170244
95 Ga0209281_1000379 3300027111 Bacteria 70495
96 Ga0209281_1001895 3300027111 Bacteria 10028
97 Ga0268265_10037685 3300028380 Bacteria 3551
98 Ga0268264_10293754 3300028381 Bacteria 1527
99 Ga0265338_10001414 3300028800 Bacteria 39085
100 Ga0265313_10028924 3300031595 Bacteria 2873
101 Ga0373934_0062051 3300035086 Bacteria 1489
102 Ga0373953_0012211 3300035117 Bacteria 3037
103 Ga0373956_0079179 3300035119 Bacteria 1506
104 Ga0373931_0067748 3300035691 Bacteria 1941
105 Ga0373937_0002666 3300036401 Bacteria 14879
106 Ga0436364_0717863 3300037853 Bacteria 145182
107 Ga0436364_0893133 3300037853 Bacteria 5060
108 Ga0436365_0965775 3300039437 Bacteria 470291
109 Ga0436360_0648959 3300039438 Bacteria 3727
110 Ga0436361_0075611 3300039447 Bacteria 1685
111 Ga0436361_0246911 3300039447 Bacteria 1926
112 Ga0436361_0314477 3300039447 Bacteria 31154
113 Ga0436363_0757131 3300039450 Bacteria 1976
114 Ga0436363_1523004 3300039450 Bacteria 1831
115 Ga0436362_1017215 3300039453 Bacteria 1722
116 Ga0436362_1275728 3300039453 Bacteria 3280
117 Ga0439438_002006 3300041405 Bacteria 8886
118 Ga0439452_000002 3300042010 Bacteria 1377577
119 Ga0439452_000188 3300042010 Bacteria 45681
120 Ga0439452_003890 3300042010 Bacteria 5118
121 Ga0450900_000249 3300042136 Bacteria 3723
122 Ga0466969_0002935 3300044656 Bacteria 9100
123 Ga0466965_0012438 3300044683 Bacteria 4003
124 Ga0466966_0010257 3300044684 Bacteria 6216
125 Ga0466961_0000289 3300044693 Bacteria 33371
126 Ga0466959_0005784 3300045049 Bacteria 8517
127 Ga0466959_0150113 3300045049 Bacteria 1643
128 Ga0495627_023565 3300046453 Bacteria 2015
129 Ga0495592_0034094 3300046454 Bacteria 3839
130 Ga0495591_000050 3300046458 Bacteria 137772
131 Ga0495591_004388 3300046458 Bacteria 6928
132 Ga0495638_0002141 3300046460 Bacteria 16586
133 Ga0495651_0001469 3300046462 Bacteria 18227
134 Ga0495651_0091379 3300046462 Bacteria 2282
135 Ga0495653_0105077 3300046463 Bacteria 2039
136 Ga0495608_0044822 3300046511 Bacteria 2950
137 Ga0495618_0110451 3300046514 Bacteria 1760
138 Ga0495620_0071719 3300046515 Bacteria 1415
139 Ga0495628_0000750 3300046516 Bacteria 29958
140 Ga0495628_0018907 3300046516 Bacteria 5701
141 Ga0495628_0083689 3300046516 Bacteria 2477
142 Ga0495652_0025368 3300046529 Bacteria 5245
143 Ga0495652_0163826 3300046529 Bacteria 1723
144 Ga0495654_0014307 3300046530 Bacteria 4225
145 Ga0495645_0066585 3300046543 Bacteria 2603
146 Ga0495645_0154032 3300046543 Bacteria 1594
147 Ga0495667_0033469 3300046559 Bacteria 3440
148 Ga0495635_0017469 3300046663 Bacteria 5010
149 Ga0495623_0022003 3300046679 Bacteria 4118
150 Ga0495646_0000288 3300046680 Bacteria 25753
151 Ga0495624_0021114 3300046690 Bacteria 4323
152 Ga0495649_0000771 3300046694 Bacteria 25741
153 Ga0495649_0002331 3300046694 Bacteria 13443
154 Ga0495600_0000297 3300046809 Bacteria 26522
155 Ga0495604_0011452 3300047317 Bacteria 7042
156 Ga0495679_002939 3300047446 Bacteria 8418
157 Ga0495673_0000114 3300047469 Bacteria 159048
158 Ga0496104_0000385 3300048907 Bacteria 38635
159 Ga0496105_0171999 3300048908 Bacteria 1775
160 Ga0496116_0000818 3300048919 Bacteria 39415
161 Ga0496116_0012241 3300048919 Bacteria 7015
162 Ga0496116_0055170 3300048919 Bacteria 2611
163 Ga0496116_0072626 3300048919 Bacteria 2173
164 Ga0496117_0000639 3300048920 Bacteria 56383
165 Ga0496119_0011595 3300048922 Bacteria 7273
166 Ga0496119_0016761 3300048922 Bacteria 5551
167 Ga0496119_0044640 3300048922 Bacteria 2787
168 Ga0496120_0000193 3300048923 Bacteria 104145
169 Ga0496120_0024264 3300048923 Bacteria 3784
170 Ga0496121_0003759 3300048924 Bacteria 21251
171 Ga0496121_0011509 3300048924 Bacteria 9806
172 Ga0496121_0018775 3300048924 Bacteria 6949
173 Ga0496121_0046185 3300048924 Bacteria 3730
174 Ga0496122_0000003 3300048925 Bacteria 645810
175 Ga0496122_0000088 3300048925 Bacteria 207600
176 Ga0496122_0021485 3300048925 Bacteria 5776
177 Ga0496122_0135966 3300048925 Bacteria 1549
178 Ga0496123_0000012 3300048926 Bacteria 458760
179 Ga0496123_0072522 3300048926 Bacteria 2142
180 Ga0496124_0000611 3300048927 Bacteria 60081
181 Ga0496124_0001009 3300048927 Bacteria 44577
182 Ga0496124_0045707 3300048927 Bacteria 3753
183 Ga0496125_0010032 3300048928 Bacteria 9620
184 Ga0496125_0010332 3300048928 Bacteria 9448
185 Ga0496126_0012885 3300048929 Bacteria 8540
186 Ga0496126_0053498 3300048929 Bacteria 3663
187 Ga0496126_0085882 3300048929 Bacteria 2773
188 Ga0496126_0257102 3300048929 Bacteria 1453
189 nmdc:mga00v17_1510_c1 3300050491 Bacteria 12146
190 Ga0495595_0005428 3300053084 Bacteria 5163
191 Ga0500595_000752 3300053119 Bacteria 19054
192 Ga0500574_000271 3300053141 Bacteria 6320

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046458 Ga0495591_004388 Ga0495591_004388_3642_4799 291
2 3300046694 Ga0495649_0002331 Ga0495649_0002331_1758_2915 291
3 3300031595 Ga0265313_10028924 Ga0265313_100289243 297
4 3300042010 Ga0439452_000002 Ga0439452_000002_374003_375160 298
5 3300039450 Ga0436363_0757131 Ga0436363_0757131_412_1668 299
6 3300014497 Ga0182008_10025438 Ga0182008_100254382 301
7 3300006946 Ga0079104_1000857 Ga0079104_10008579 303
8 3300027111 Ga0209281_1000006 Ga0209281_1000006103 303
9 3300039453 Ga0436362_1017215 Ga0436362_1017215_359_1516 304
10 3300039437 Ga0436365_0965775 Ga0436365_0965775_227177_228307 306
11 3300048922 Ga0496119_0044640 Ga0496119_0044640_1557_2615 306
12 3300039450 Ga0436363_1523004 Ga0436363_1523004_18_1181 308
13 3300048919 Ga0496116_0072626 Ga0496116_0072626_393_1505 309
14 3300006946 Ga0079104_1001342 Ga0079104_10013423 312
15 3300037853 Ga0436364_0893133 Ga0436364_0893133_1964_3127 313
16 3300021384 Ga0213876_10000023 Ga0213876_10000023198 314
17 3300046460 Ga0495638_0002141 Ga0495638_0002141_15274_16431 314
18 3300010159 Ga0099796_10046450 Ga0099796_100464502 315
19 3300042010 Ga0439452_003890 Ga0439452_003890_1457_2590 315
20 3300042010 Ga0439452_000188 Ga0439452_000188_20450_21607 317
21 3300005467 Ga0070706_100243969 Ga0070706_1002439692 318
22 3300044656 Ga0466969_0002935 Ga0466969_0002935_4543_5691 318
23 3300044684 Ga0466966_0010257 Ga0466966_0010257_3609_4757 318
24 3300044693 Ga0466961_0000289 Ga0466961_0000289_19022_20170 318
25 3300045049 Ga0466959_0150113 Ga0466959_0150113_33_1181 318
26 3300025915 Ga0207693_10015322 Ga0207693_100153226 319
27 3300046515 Ga0495620_0071719 Ga0495620_0071719_72_1229 319
28 3300046694 Ga0495649_0000771 Ga0495649_0000771_1758_2915 319
29 3300009036 Ga0105244_10006505 Ga0105244_100065052 320
30 3300025915 Ga0207693_10075336 Ga0207693_100753362 320
31 3300046453 Ga0495627_023565 Ga0495627_023565_795_1928 320
32 3300048925 Ga0496122_0000088 Ga0496122_0000088_114399_115529 320
33 3300048929 Ga0496126_0085882 Ga0496126_0085882_86_1207 321
34 3300005434 Ga0070709_10170720 Ga0070709_101707201 322
35 3300025939 Ga0207665_10074383 Ga0207665_100743832 322
36 3300025735 Ga0207713_1005334 Ga0207713_10053349 324
37 3300048907 Ga0496104_0000385 Ga0496104_0000385_25545_26702 324
38 3300048908 Ga0496105_0171999 Ga0496105_0171999_467_1624 324
39 3300048919 Ga0496116_0055170 Ga0496116_0055170_882_2039 324
40 3300048922 Ga0496119_0016761 Ga0496119_0016761_3429_4586 324
41 3300048924 Ga0496121_0018775 Ga0496121_0018775_3297_4454 324
42 3300048924 Ga0496121_0046185 Ga0496121_0046185_2055_3212 324
43 3300048928 Ga0496125_0010032 Ga0496125_0010032_678_1835 324
44 3300021361 Ga0213872_10102561 Ga0213872_101025611 325
45 3300026078 Ga0207702_10014306 Ga0207702_100143064 325
46 3300039447 Ga0436361_0246911 Ga0436361_0246911_77_1225 325
47 3300009092 Ga0105250_10012346 Ga0105250_100123463 326
48 3300025728 Ga0207655_1000023 Ga0207655_100002398 326
49 3300039438 Ga0436360_0648959 Ga0436360_0648959_934_2148 326
50 3300044683 Ga0466965_0012438 Ga0466965_0012438_1020_2168 326
51 3300045049 Ga0466959_0005784 Ga0466959_0005784_204_1352 326
52 3300047446 Ga0495679_002939 Ga0495679_002939_3652_4776 326
53 3300006173 Ga0070716_100073492 Ga0070716_1000734922 327
54 3300025939 Ga0207665_10116688 Ga0207665_101166882 327
55 3300046530 Ga0495654_0014307 Ga0495654_0014307_763_1920 327
56 3300047469 Ga0495673_0000114 Ga0495673_0000114_103380_104537 327
57 3300025728 Ga0207655_1002164 Ga0207655_10021647 328
58 3300005434 Ga0070709_10097974 Ga0070709_100979741 329
59 3300005436 Ga0070713_100083270 Ga0070713_1000832703 329
60 3300028800 Ga0265338_10001414 Ga0265338_1000141420 329
61 3300048929 Ga0496126_0053498 Ga0496126_0053498_194_1345 329
62 3300009036 Ga0105244_10000238 Ga0105244_1000023845 330
63 3300015261 Ga0182006_1000018 Ga0182006_1000018173 330
64 3300025728 Ga0207655_1000241 Ga0207655_100024145 330
65 3300048927 Ga0496124_0001009 Ga0496124_0001009_5799_6956 330
66 3300009036 Ga0105244_10005717 Ga0105244_100057175 331
67 3300013307 Ga0157372_10128967 Ga0157372_101289672 331
68 3300048925 Ga0496122_0021485 Ga0496122_0021485_2055_3188 331
69 3300048927 Ga0496124_0000611 Ga0496124_0000611_56345_57478 331
70 3300048928 Ga0496125_0010332 Ga0496125_0010332_5839_6972 331
71 3300005439 Ga0070711_100012746 Ga0070711_1000127465 332
72 3300041405 Ga0439438_002006 Ga0439438_002006_2327_3484 332
73 3300042136 Ga0450900_000249 Ga0450900_000249_246_1403 332
74 3300048927 Ga0496124_0045707 Ga0496124_0045707_2272_3429 332
75 3300027111 Ga0209281_1000379 Ga0209281_10003799 334
76 3300021361 Ga0213872_10000540 Ga0213872_1000054014 335
77 3300039447 Ga0436361_0314477 Ga0436361_0314477_12367_13509 335
78 iso_pu_bacteria 2547132416 2548648213 335
79 iso_pu_bacteria 2643221733 2644732798 335
80 iso_pu_bacteria 2775506706 2775541416 335
81 iso_pu_bacteria 2821118458 2821120931 335
82 iso_pu_bacteria 2844425489 2844428257 335
83 iso_pu_bacteria 2939568625 2939569925 335
84 iso_pu_bacteria 2939607340 2939608790 335
85 iso_pu_bacteria 2939642701 2939643056 335
86 iso_pu_bacteria 8018221730 8018224140 335
87 iso_pu_bacteria 8055087960 8055092049 335
88 iso_pu_bacteria 8055092621 8055095385 335
89 iso_pu_bacteria 8055097453 8055100082 335
90 iso_pu_bacteria 8057304971 8057306890 335
91 3300005367 Ga0070667_100259316 Ga0070667_1002593162 336
92 3300005843 Ga0068860_100317452 Ga0068860_1003174522 336
93 3300025940 Ga0207691_10130320 Ga0207691_101303202 336
94 3300026089 Ga0207648_10152439 Ga0207648_101524392 336
95 3300028380 Ga0268265_10037685 Ga0268265_100376852 336
96 iso_pu_bacteria 3000376612 3000378506 336
97 3300005471 Ga0070698_100012536 Ga0070698_1000125365 337
98 3300006028 Ga0070717_10002097 Ga0070717_1000209713 337
99 3300006195 Ga0075366_10095643 Ga0075366_100956432 337
100 3300010159 Ga0099796_10003804 Ga0099796_100038042 337
101 3300025929 Ga0207664_10107566 Ga0207664_101075662 337
102 3300035691 Ga0373931_0067748 Ga0373931_0067748_706_1848 337
103 iso_pu_bacteria 3003665799 3003668974 338
104 3300003320 rootH2_10008161 rootH2_100081612 339
105 3300005289 Ga0065704_10001647 Ga0065704_100016476 339
106 3300005289 Ga0065704_10005200 Ga0065704_100052002 339
107 3300005331 Ga0070670_100125747 Ga0070670_1001257472 339
108 3300005353 Ga0070669_100068939 Ga0070669_1000689392 339
109 3300005841 Ga0068863_100061220 Ga0068863_1000612204 339
110 3300005844 Ga0068862_100041608 Ga0068862_1000416084 339
111 3300006051 Ga0075364_10011889 Ga0075364_100118894 339
112 3300006946 Ga0079104_1001260 Ga0079104_10012604 339
113 3300009036 Ga0105244_10033868 Ga0105244_100338682 339
114 3300025728 Ga0207655_1000036 Ga0207655_1000036234 339
115 3300025735 Ga0207713_1000047 Ga0207713_100004788 339
116 3300025735 Ga0207713_1004691 Ga0207713_10046918 339
117 3300025935 Ga0207709_10036189 Ga0207709_100361892 339
118 3300027111 Ga0209281_1000004 Ga0209281_1000004328 339
119 3300028381 Ga0268264_10293754 Ga0268264_102937542 339
120 3300039447 Ga0436361_0075611 Ga0436361_0075611_18_1175 339
121 3300046458 Ga0495591_000050 Ga0495591_000050_27443_28600 339
122 3300048919 Ga0496116_0012241 Ga0496116_0012241_441_1598 339
123 3300048923 Ga0496120_0024264 Ga0496120_0024264_1332_2489 339
124 3300048924 Ga0496121_0003759 Ga0496121_0003759_5635_6792 339
125 3300048925 Ga0496122_0000003 Ga0496122_0000003_360603_361760 339
126 3300048926 Ga0496123_0000012 Ga0496123_0000012_115786_116943 339
127 3300048929 Ga0496126_0257102 Ga0496126_0257102_53_1210 339
128 3300050491 nmdc:mga00v17_1510_c1 nmdc:mga00v17_1510_c1_5796_6953 339
129 3300005289 Ga0065704_10006951 Ga0065704_100069513 340
130 3300005841 Ga0068863_100100666 Ga0068863_1001006663 340
131 3300009011 Ga0105251_10000045 Ga0105251_1000004529 340
132 3300009148 Ga0105243_10068275 Ga0105243_100682753 340
133 3300025711 Ga0207696_1002615 Ga0207696_10026154 340
134 3300027111 Ga0209281_1001895 Ga0209281_100189510 340
135 3300048920 Ga0496117_0000639 Ga0496117_0000639_21030_22190 340
136 3300048924 Ga0496121_0011509 Ga0496121_0011509_7130_8290 340
137 3300048925 Ga0496122_0135966 Ga0496122_0135966_121_1281 340
138 3300048926 Ga0496123_0072522 Ga0496123_0072522_713_1873 340
139 3300048929 Ga0496126_0012885 Ga0496126_0012885_1578_2738 340
140 3300048919 Ga0496116_0000818 Ga0496116_0000818_11564_12730 341
141 3300048922 Ga0496119_0011595 Ga0496119_0011595_3081_4247 341
142 3300048923 Ga0496120_0000193 Ga0496120_0000193_49951_51117 341
143 3300005445 Ga0070708_100311551 Ga0070708_1003115512 342
144 3300005518 Ga0070699_100038405 Ga0070699_1000384054 342
145 3300035119 Ga0373956_0079179 Ga0373956_0079179_101_1306 342
146 3300002773 JGI25152J39213_1002093 JGI25152J39213_10020932 343
147 3300003215 JGI25153J46596_10000769 JGI25153J46596_100007698 343
148 3300003771 Ga0055526_1009844 Ga0055526_10098441 343
149 3300005543 Ga0070672_100115170 Ga0070672_1001151702 343
150 3300009094 Ga0111539_10147313 Ga0111539_101473132 343
151 3300025258 Ga0209129_1000169 Ga0209129_100016965 343
152 3300025295 Ga0209564_1000057 Ga0209564_1000057184 343
153 3300025297 Ga0209758_1000174 Ga0209758_100017494 343
154 3300025299 Ga0209256_1010890 Ga0209256_10108903 343
155 3300025926 Ga0207659_10009868 Ga0207659_100098686 343
156 3300026118 Ga0207675_100290111 Ga0207675_1002901112 343
157 iso_pu_bacteria 2952252522 2952255804 343
158 3300046511 Ga0495608_0044822 Ga0495608_0044822_582_1742 345
159 3300046462 Ga0495651_0001469 Ga0495651_0001469_4696_5859 346
160 3300046516 Ga0495628_0000750 Ga0495628_0000750_7436_8599 346
161 3300046529 Ga0495652_0025368 Ga0495652_0025368_2392_3555 346
162 3300046679 Ga0495623_0022003 Ga0495623_0022003_2417_3580 346
163 3300046543 Ga0495645_0154032 Ga0495645_0154032_18_1187 348
164 3300017792 Ga0163161_10100153 Ga0163161_101001532 350
165 3300035086 Ga0373934_0062051 Ga0373934_0062051_102_1307 352
166 3300035117 Ga0373953_0012211 Ga0373953_0012211_173_1378 352
167 3300036401 Ga0373937_0002666 Ga0373937_0002666_9778_10983 352
168 3300046559 Ga0495667_0033469 Ga0495667_0033469_1709_2914 352
169 3300053084 Ga0495595_0005428 Ga0495595_0005428_1765_2970 352
170 3300005539 Ga0068853_100168607 Ga0068853_1001686072 353
171 3300021388 Ga0213875_10000132 Ga0213875_1000013231 353
172 3300037853 Ga0436364_0717863 Ga0436364_0717863_93612_94820 353
173 3300021358 Ga0213873_10013709 Ga0213873_100137092 354
174 3300039453 Ga0436362_1275728 Ga0436362_1275728_407_1618 354
175 3300005354 Ga0070675_100015987 Ga0070675_1000159876 355
176 iso_pu_bacteria 2818991436 2819541738 356
177 3300015262 Ga0182007_10002787 Ga0182007_100027876 357
178 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021107 360
179 3300003214 JGI25165J46597_1000049 JGI25165J46597_1000049117 360
180 3300003751 Ga0055538_1000023 Ga0055538_1000023107 360
181 3300003752 Ga0055539_1000030 Ga0055539_1000030107 360
182 3300003756 Ga0055533_1000039 Ga0055533_1000039107 360
183 3300003759 Ga0055525_1000048 Ga0055525_1000048117 360
184 3300003841 Ga0055541_1000021 Ga0055541_1000021117 360
185 3300015261 Ga0182006_1051661 Ga0182006_10516612 360
186 3300015262 Ga0182007_10017698 Ga0182007_100176982 360
187 3300015265 Ga0182005_1002854 Ga0182005_10028545 360
188 3300025224 Ga0209784_100004 Ga0209784_1000041148 360
189 3300025225 Ga0209566_100004 Ga0209566_1000041305 360
190 3300025226 Ga0209674_100006 Ga0209674_1000061305 360
191 3300025230 Ga0209563_100009 Ga0209563_1000091148 360
192 3300025233 Ga0209437_100004 Ga0209437_1000041148 360
193 3300025253 Ga0209677_100005 Ga0209677_1000051148 360
194 3300025261 Ga0209233_1000005 Ga0209233_10000051305 360
195 3300046454 Ga0495592_0034094 Ga0495592_0034094_1285_2490 360
196 3300046462 Ga0495651_0091379 Ga0495651_0091379_480_1685 360
197 3300046463 Ga0495653_0105077 Ga0495653_0105077_664_1869 360
198 3300046514 Ga0495618_0110451 Ga0495618_0110451_413_1618 360
199 3300046516 Ga0495628_0018907 Ga0495628_0018907_681_1886 360
200 3300046516 Ga0495628_0083689 Ga0495628_0083689_274_1500 360
201 3300046529 Ga0495652_0163826 Ga0495652_0163826_378_1604 360
202 3300046543 Ga0495645_0066585 Ga0495645_0066585_834_2060 360
203 3300046663 Ga0495635_0017469 Ga0495635_0017469_2175_3380 360
204 3300046680 Ga0495646_0000288 Ga0495646_0000288_9090_10316 360
205 3300046690 Ga0495624_0021114 Ga0495624_0021114_1772_2977 360
206 3300046809 Ga0495600_0000297 Ga0495600_0000297_12611_13816 360
207 3300047317 Ga0495604_0011452 Ga0495604_0011452_3217_4422 360
208 3300053119 Ga0500595_000752 Ga0500595_000752_12162_13367 360
209 3300053141 Ga0500574_000271 Ga0500574_000271_745_1950 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

231

421

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8621 140 354
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8491 127 348
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8336 140 354
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.8247 157 345
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.8209 151 345
ID Description Score Start End Superfamily
af_P33361_169_379_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9854 148 353 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9609 151 351 1.10.3720.10
af_P33361_169_379_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9578 148 353 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9278 151 351 1.10.3720.10
af_P33359_41_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.927 151 354 1.10.3720.10
ID Description Score Start End GO Terms
AF-C0GFN2-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9786 140 359 GO:0005886
GO:0031460
GO:0055085
AF-A0A8B0U8B4-F1-model_v4 deleted 0.9751 140 351
AF-A0A5M4ALH3-F1-model_v4 Glycine/betaine ABC transporter substrate-binding protein 0.9701 140 354 GO:0022857
GO:0031460
GO:0043190
AF-A0A2W4NI70-F1-model_v4 deleted 0.9687 237 359
AF-A0A7T9I0W5-F1-model_v4 deleted 0.9574 155 357

Feature Viewer

pLDDT pTM Quality
82.75 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map