F319232

General Info

Members Datasets Scaffolds Average Seq Length
209 140 209 130

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000387|Ga0307511_1000038732
Length 150
Sequence LVILAVPTGCNIHRINHQKCNIMDTNSNSLNWFELPATDIARAKNFYEAIFSVQMVDLGEMMGMKMVGFPSVPGNGKASGGLAQSQMHTPSQSGTIVYLNANPSIQEVLDRIEPAGGKVVMPRTEISPEIGVMAFFVDTEGNRVGLHAQQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0.96
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2472133 2162886011 Unclassified 892
2 rootH1_10335956 3300003323 Bacteria 2050
3 Ga0065714_10125804 3300005288 Bacteria 1297
4 Ga0065714_10284903 3300005288 Unclassified 717
5 Ga0065712_10085896 3300005290 Bacteria 2667
6 Ga0070658_10095147 3300005327 Bacteria 2458
7 Ga0070683_100096440 3300005329 Bacteria 2781
8 Ga0070677_10165296 3300005333 Bacteria 1041
9 Ga0068869_100005255 3300005334 Bacteria 8132
10 Ga0070666_10000043 3300005335 Bacteria 111402
11 Ga0070680_100009892 3300005336 Bacteria 7340
12 Ga0070680_100136300 3300005336 Bacteria 2056
13 Ga0070682_100551154 3300005337 Bacteria 902
14 Ga0070660_100201220 3300005339 Bacteria 1615
15 Ga0070689_100344950 3300005340 Unclassified 1248
16 Ga0070691_10030628 3300005341 Bacteria 2520
17 Ga0070675_101310475 3300005354 Unclassified 667
18 Ga0070659_100128665 3300005366 Bacteria 2055
19 Ga0070667_100003552 3300005367 Bacteria 13290
20 Ga0070711_101149523 3300005439 Unclassified 670
21 Ga0070681_10207990 3300005458 Bacteria 1873
22 Ga0070681_10312626 3300005458 Unclassified 1480
23 Ga0070685_10449429 3300005466 Bacteria 902
24 Ga0070679_100043995 3300005530 Unclassified 4447
25 Ga0070679_100176942 3300005530 Unclassified 2106
26 Ga0070684_100030159 3300005535 Bacteria 4605
27 Ga0068853_100048105 3300005539 Unclassified 3662
28 Ga0068853_101014081 3300005539 Bacteria 799
29 Ga0068853_101593338 3300005539 Bacteria 633
30 Ga0068855_100052672 3300005563 Bacteria 4790
31 Ga0068855_100930788 3300005563 Bacteria 917
32 Ga0068857_100971886 3300005577 Bacteria 816
33 Ga0068852_100052387 3300005616 Unclassified 3507
34 Ga0068852_101629201 3300005616 Bacteria 668
35 Ga0068859_100000012 3300005617 Bacteria 300376
36 Ga0068859_101137905 3300005617 Unclassified 859
37 Ga0068864_100070311 3300005618 Unclassified 3045
38 Ga0068864_102300718 3300005618 Bacteria 545
39 Ga0068863_100008374 3300005841 Bacteria 10098
40 Ga0068860_100004050 3300005843 Bacteria 15046
41 Ga0068860_100021944 3300005843 Bacteria 6178
42 Ga0070712_100343013 3300006175 Bacteria 1220
43 Ga0097621_100671431 3300006237 Bacteria 952
44 Ga0068871_100302285 3300006358 Bacteria 1405
45 Ga0068871_101054885 3300006358 Bacteria 759
46 Ga0068871_101776561 3300006358 Bacteria 585
47 Ga0075430_100592036 3300006846 Bacteria 915
48 Ga0068865_100345973 3300006881 Bacteria 1203
49 Ga0097620_100000012 3300006931 Bacteria 300376
50 Ga0097620_101137779 3300006931 Unclassified 859
51 Ga0105240_10062764 3300009093 Bacteria 4625
52 Ga0105240_10080384 3300009093 Bacteria 4009
53 Ga0105245_10070341 3300009098 Bacteria 3175
54 Ga0105245_10964152 3300009098 Unclassified 896
55 Ga0105247_10025782 3300009101 Bacteria 3548
56 Ga0105241_10001105 3300009174 Bacteria 20534
57 Ga0105241_10002395 3300009174 Bacteria 14083
58 Ga0105237_10000725 3300009545 Bacteria 45577
59 Ga0105237_10315913 3300009545 Bacteria 1565
60 Ga0105237_11287691 3300009545 Unclassified 737
61 Ga0105249_10012219 3300009553 Bacteria 7563
62 Ga0105249_10514979 3300009553 Bacteria 1243
63 Ga0105239_10124083 3300010375 Bacteria 2869
64 Ga0105239_10159857 3300010375 Bacteria 2516
65 Ga0105239_10247165 3300010375 Bacteria 2003
66 Ga0105246_10034789 3300011119 Bacteria 3361
67 Ga0105246_10100608 3300011119 Unclassified 2103
68 Ga0157373_10212908 3300013100 Bacteria 1363
69 Ga0157371_10669286 3300013102 Bacteria 776
70 Ga0157370_10018336 3300013104 Bacteria 7041
71 Ga0157370_10020286 3300013104 Bacteria 6638
72 Ga0157369_10790522 3300013105 Bacteria 975
73 Ga0157369_10998248 3300013105 Bacteria 857
74 Ga0157374_10037992 3300013296 Unclassified 4423
75 Ga0157374_10285070 3300013296 Bacteria 1631
76 Ga0157378_10379689 3300013297 Bacteria 1387
77 Ga0157378_12084511 3300013297 Bacteria 618
78 Ga0163162_10000279 3300013306 Bacteria 46872
79 Ga0163162_10013425 3300013306 Bacteria 7997
80 Ga0157372_11149169 3300013307 Bacteria 898
81 Ga0157372_12440752 3300013307 Bacteria 600
82 Ga0157375_10093458 3300013308 Unclassified 3073
83 Ga0157375_10231501 3300013308 Bacteria 2007
84 Ga0157375_11465621 3300013308 Bacteria 805
85 Ga0163163_10372365 3300014325 Unclassified 1485
86 Ga0157380_10305666 3300014326 Bacteria 1467
87 Ga0157380_10592205 3300014326 Bacteria 1095
88 Ga0157379_10034367 3300014968 Bacteria 4521
89 Ga0157376_10120505 3300014969 Bacteria 2324
90 Ga0157376_10224075 3300014969 Bacteria 1743
91 Ga0206352_10772333 3300020078 Bacteria 668
92 Ga0207680_10000362 3300025903 Bacteria 21818
93 Ga0207647_10293878 3300025904 Bacteria 926
94 Ga0207645_10843024 3300025907 Bacteria 623
95 Ga0207705_10131667 3300025909 Bacteria 1862
96 Ga0207654_10002914 3300025911 Bacteria 8672
97 Ga0207707_10001992 3300025912 Bacteria 18554
98 Ga0207707_10483012 3300025912 Bacteria 1058
99 Ga0207695_10000241 3300025913 Bacteria 142030
100 Ga0207695_10169182 3300025913 Unclassified 2112
101 Ga0207671_10000438 3300025914 Bacteria 57265
102 Ga0207671_10004439 3300025914 Bacteria 13417
103 Ga0207671_10200517 3300025914 Bacteria 1558
104 Ga0207660_10028761 3300025917 Bacteria 3805
105 Ga0207660_10161763 3300025917 Bacteria 1728
106 Ga0207657_10074795 3300025919 Bacteria 2860
107 Ga0207652_10057163 3300025921 Unclassified 3359
108 Ga0207652_10349005 3300025921 Unclassified 1335
109 Ga0207681_10506549 3300025923 Bacteria 989
110 Ga0207659_11093942 3300025926 Unclassified 686
111 Ga0207687_10191376 3300025927 Bacteria 1593
112 Ga0207690_10230028 3300025932 Bacteria 1423
113 Ga0207686_10018402 3300025934 Bacteria 3956
114 Ga0207670_10147350 3300025936 Unclassified 1742
115 Ga0207704_10032899 3300025938 Bacteria 2942
116 Ga0207689_10000329 3300025942 Bacteria 44014
117 Ga0207661_10003609 3300025944 Bacteria 10767
118 Ga0207667_10095714 3300025949 Bacteria 3065
119 Ga0207651_10362253 3300025960 Bacteria 1224
120 Ga0207712_10009000 3300025961 Bacteria 6315
121 Ga0207712_10091109 3300025961 Unclassified 2245
122 Ga0207668_10764040 3300025972 Bacteria 853
123 Ga0207703_10001495 3300026035 Bacteria 21327
124 Ga0207639_10075741 3300026041 Unclassified 2647
125 Ga0207639_11264813 3300026041 Bacteria 692
126 Ga0207639_11457408 3300026041 Unclassified 642
127 Ga0207678_10161112 3300026067 Bacteria 1916
128 Ga0207641_10000152 3300026088 Bacteria 98311
129 Ga0207674_10371836 3300026116 Bacteria 1381
130 Ga0207675_100549853 3300026118 Bacteria 1153
131 Ga0207698_10003540 3300026142 Bacteria 9417
132 Ga0268264_10001955 3300028381 Bacteria 18514
133 Ga0268264_10002744 3300028381 Bacteria 15376
134 Ga0265337_1000058 3300028556 Bacteria 50152
135 Ga0265337_1012222 3300028556 Unclassified 2926
136 Ga0265326_10006210 3300028558 Bacteria 3723
137 Ga0265326_10007245 3300028558 Bacteria 3410
138 Ga0265319_1000036 3300028563 Bacteria 115781
139 Ga0265319_1001335 3300028563 Bacteria 14877
140 Ga0265319_1074648 3300028563 Bacteria 1083
141 Ga0265319_1110016 3300028563 Bacteria 862
142 Ga0265334_10009799 3300028573 Bacteria 4050
143 Ga0265318_10001331 3300028577 Bacteria 14799
144 Ga0265318_10012422 3300028577 Bacteria 3627
145 Ga0265323_10008893 3300028653 Bacteria 4124
146 Ga0265336_10000041 3300028666 Bacteria 136990
147 Ga0307517_10121109 3300028786 Bacteria 1933
148 Ga0265338_10000056 3300028800 Bacteria 200914
149 Ga0265338_10000432 3300028800 Bacteria 75203
150 Ga0265338_10001235 3300028800 Bacteria 42204
151 Ga0265338_10003585 3300028800 Bacteria 21679
152 Ga0265324_10000468 3300029957 Bacteria 28382
153 Ga0265324_10001493 3300029957 Bacteria 13263
154 Ga0265324_10007858 3300029957 Bacteria 4281
155 Ga0265324_10075197 3300029957 Bacteria 1150
156 Ga0307511_10000387 3300030521 Bacteria 47111
157 Ga0265330_10004096 3300031235 Bacteria 7473
158 Ga0265332_10000291 3300031238 Bacteria 39487
159 Ga0265328_10000524 3300031239 Bacteria 17867
160 Ga0265320_10002425 3300031240 Bacteria 12994
161 Ga0265320_10003963 3300031240 Bacteria 9766
162 Ga0265320_10168133 3300031240 Bacteria 986
163 Ga0265325_10001533 3300031241 Bacteria 16160
164 Ga0265325_10138758 3300031241 Unclassified 1158
165 Ga0265329_10000331 3300031242 Bacteria 25099
166 Ga0265340_10002965 3300031247 Bacteria 9663
167 Ga0265339_10000497 3300031249 Bacteria 30642
168 Ga0265339_10084587 3300031249 Bacteria 1672
169 Ga0265331_10000519 3300031250 Bacteria 35699
170 Ga0265327_10059659 3300031251 Bacteria 1953
171 Ga0265316_10007717 3300031344 Bacteria 10084
172 Ga0265316_10015679 3300031344 Bacteria 6612
173 Ga0265316_10131645 3300031344 Unclassified 1884
174 Ga0307509_10301838 3300031507 Bacteria 1349
175 Ga0265313_10014499 3300031595 Bacteria 4651
176 Ga0265313_10019092 3300031595 Bacteria 3831
177 Ga0265314_10000782 3300031711 Bacteria 37770
178 Ga0265314_10047526 3300031711 Bacteria 3019
179 Ga0265342_10001519 3300031712 Bacteria 21471
180 Ga0265342_10356802 3300031712 Bacteria 761
181 Ga0373927_0007722 3300035695 Bacteria 7278
182 Ga0395901_0101161 3300038443 Bacteria 3024
183 Ga0436365_1523612 3300039437 Unclassified 854
184 Ga0451800_0599828 3300041459 Bacteria 601
185 Ga0451851_0210247 3300041507 Bacteria 509
186 Ga0439433_0184680 3300041999 Unclassified 547
187 Ga0439449_0001776 3300042007 Bacteria 8478
188 Ga0439457_014338 3300042014 Bacteria 1775
189 Ga0439462_0032550 3300042015 Unclassified 1382
190 Ga0451577_0000227 3300042876 Bacteria 114840
191 Ga0451577_0975538 3300042876 Unclassified 762
192 Ga0453684_0000033 3300044712 Bacteria 734012
193 Ga0453684_0020165 3300044712 Bacteria 10085
194 Ga0453684_0200277 3300044712 Bacteria 2328
195 Ga0453684_1453972 3300044712 Bacteria 709
196 Ga0451576_1459443 3300045051 Bacteria 711
197 Ga0495605_0393717 3300046474 Bacteria 577
198 Ga0495611_0051480 3300046648 Bacteria 1856
199 Ga0495661_0000527 3300046665 Bacteria 39504
200 Ga0495661_0037181 3300046665 Bacteria 3041
201 Ga0496114_0001010 3300048917 Bacteria 21107
202 Ga0496125_0018158 3300048928 Bacteria 6684
203 Ga0496126_0129786 3300048929 Bacteria 2179
204 Ga0501033_0702343 3300049570 Bacteria 688
205 Ga0501257_203020 3300049686 Unclassified 571
206 Ga0501035_0464089 3300049822 Bacteria 1046
207 nmdc:mga0qj67_841687_c1 3300050509 Bacteria 725
208 Ga0500655_022339 3300053133 Bacteria 1190
209 Ga0500637_0233823 3300053178 Bacteria 1034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10315913 Ga0105237_103159134 118
2 3300010375 Ga0105239_10124083 Ga0105239_101240835 118
3 3300013105 Ga0157369_10998248 Ga0157369_109982482 118
4 3300014326 Ga0157380_10592205 Ga0157380_105922052 118
5 3300025914 Ga0207671_10000438 Ga0207671_100004386 118
6 3300044712 Ga0453684_1453972 Ga0453684_1453972_40_411 118
7 3300006846 Ga0075430_100592036 Ga0075430_1005920362 119
8 3300013308 Ga0157375_11465621 Ga0157375_114656211 119
9 3300048928 Ga0496125_0018158 Ga0496125_0018158_2750_3124 119
10 3300048929 Ga0496126_0129786 Ga0496126_0129786_1597_1971 119
11 3300003323 rootH1_10335956 rootH1_103359563 120
12 3300005288 Ga0065714_10125804 Ga0065714_101258042 120
13 3300005288 Ga0065714_10284903 Ga0065714_102849032 120
14 3300005327 Ga0070658_10095147 Ga0070658_100951474 120
15 3300005329 Ga0070683_100096440 Ga0070683_1000964406 120
16 3300005333 Ga0070677_10165296 Ga0070677_101652961 120
17 3300005334 Ga0068869_100005255 Ga0068869_1000052556 120
18 3300005335 Ga0070666_10000043 Ga0070666_1000004328 120
19 3300005336 Ga0070680_100009892 Ga0070680_1000098924 120
20 3300005336 Ga0070680_100136300 Ga0070680_1001363002 120
21 3300005337 Ga0070682_100551154 Ga0070682_1005511542 120
22 3300005339 Ga0070660_100201220 Ga0070660_1002012201 120
23 3300005341 Ga0070691_10030628 Ga0070691_100306285 120
24 3300005354 Ga0070675_101310475 Ga0070675_1013104751 120
25 3300005366 Ga0070659_100128665 Ga0070659_1001286651 120
26 3300005367 Ga0070667_100003552 Ga0070667_1000035529 120
27 3300005458 Ga0070681_10207990 Ga0070681_102079902 120
28 3300005458 Ga0070681_10312626 Ga0070681_103126262 120
29 3300005466 Ga0070685_10449429 Ga0070685_104494292 120
30 3300005530 Ga0070679_100043995 Ga0070679_1000439955 120
31 3300005530 Ga0070679_100176942 Ga0070679_1001769423 120
32 3300005535 Ga0070684_100030159 Ga0070684_1000301593 120
33 3300005539 Ga0068853_100048105 Ga0068853_1000481051 120
34 3300005539 Ga0068853_101014081 Ga0068853_1010140812 120
35 3300005539 Ga0068853_101593338 Ga0068853_1015933381 120
36 3300005563 Ga0068855_100052672 Ga0068855_1000526727 120
37 3300005563 Ga0068855_100930788 Ga0068855_1009307883 120
38 3300005577 Ga0068857_100971886 Ga0068857_1009718862 120
39 3300005616 Ga0068852_100052387 Ga0068852_1000523874 120
40 3300005616 Ga0068852_101629201 Ga0068852_1016292012 120
41 3300005617 Ga0068859_100000012 Ga0068859_100000012154 120
42 3300005617 Ga0068859_101137905 Ga0068859_1011379051 120
43 3300005618 Ga0068864_100070311 Ga0068864_1000703112 120
44 3300005618 Ga0068864_102300718 Ga0068864_1023007181 120
45 3300005841 Ga0068863_100008374 Ga0068863_1000083746 120
46 3300005843 Ga0068860_100004050 Ga0068860_1000040507 120
47 3300005843 Ga0068860_100021944 Ga0068860_1000219441 120
48 3300006175 Ga0070712_100343013 Ga0070712_1003430132 120
49 3300006237 Ga0097621_100671431 Ga0097621_1006714312 120
50 3300006358 Ga0068871_100302285 Ga0068871_1003022853 120
51 3300006358 Ga0068871_101054885 Ga0068871_1010548852 120
52 3300006358 Ga0068871_101776561 Ga0068871_1017765611 120
53 3300006881 Ga0068865_100345973 Ga0068865_1003459731 120
54 3300006931 Ga0097620_100000012 Ga0097620_100000012154 120
55 3300006931 Ga0097620_101137779 Ga0097620_1011377791 120
56 3300009093 Ga0105240_10062764 Ga0105240_100627645 120
57 3300009093 Ga0105240_10080384 Ga0105240_100803843 120
58 3300009098 Ga0105245_10070341 Ga0105245_100703412 120
59 3300009098 Ga0105245_10964152 Ga0105245_109641522 120
60 3300009101 Ga0105247_10025782 Ga0105247_100257823 120
61 3300009174 Ga0105241_10001105 Ga0105241_100011054 120
62 3300009174 Ga0105241_10002395 Ga0105241_100023956 120
63 3300009545 Ga0105237_10000725 Ga0105237_1000072537 120
64 3300009545 Ga0105237_11287691 Ga0105237_112876911 120
65 3300009553 Ga0105249_10012219 Ga0105249_100122194 120
66 3300009553 Ga0105249_10514979 Ga0105249_105149793 120
67 3300010375 Ga0105239_10159857 Ga0105239_101598573 120
68 3300010375 Ga0105239_10247165 Ga0105239_102471653 120
69 3300011119 Ga0105246_10034789 Ga0105246_100347893 120
70 3300011119 Ga0105246_10100608 Ga0105246_101006083 120
71 3300013100 Ga0157373_10212908 Ga0157373_102129083 120
72 3300013102 Ga0157371_10669286 Ga0157371_106692862 120
73 3300013104 Ga0157370_10018336 Ga0157370_100183363 120
74 3300013104 Ga0157370_10020286 Ga0157370_100202863 120
75 3300013105 Ga0157369_10790522 Ga0157369_107905221 120
76 3300013296 Ga0157374_10037992 Ga0157374_100379924 120
77 3300013296 Ga0157374_10285070 Ga0157374_102850701 120
78 3300013297 Ga0157378_10379689 Ga0157378_103796892 120
79 3300013297 Ga0157378_12084511 Ga0157378_120845111 120
80 3300013306 Ga0163162_10000279 Ga0163162_100002796 120
81 3300013306 Ga0163162_10013425 Ga0163162_100134256 120
82 3300013307 Ga0157372_11149169 Ga0157372_111491692 120
83 3300013307 Ga0157372_12440752 Ga0157372_124407521 120
84 3300013308 Ga0157375_10093458 Ga0157375_100934583 120
85 3300013308 Ga0157375_10231501 Ga0157375_102315011 120
86 3300014325 Ga0163163_10372365 Ga0163163_103723652 120
87 3300014326 Ga0157380_10305666 Ga0157380_103056663 120
88 3300014968 Ga0157379_10034367 Ga0157379_100343674 120
89 3300014969 Ga0157376_10120505 Ga0157376_101205052 120
90 3300014969 Ga0157376_10224075 Ga0157376_102240752 120
91 3300020078 Ga0206352_10772333 Ga0206352_107723331 120
92 3300025903 Ga0207680_10000362 Ga0207680_100003628 120
93 3300025904 Ga0207647_10293878 Ga0207647_102938782 120
94 3300025907 Ga0207645_10843024 Ga0207645_108430241 120
95 3300025909 Ga0207705_10131667 Ga0207705_101316674 120
96 3300025911 Ga0207654_10002914 Ga0207654_100029147 120
97 3300025912 Ga0207707_10001992 Ga0207707_1000199217 120
98 3300025912 Ga0207707_10483012 Ga0207707_104830122 120
99 3300025913 Ga0207695_10000241 Ga0207695_100002415 120
100 3300025913 Ga0207695_10169182 Ga0207695_101691823 120
101 3300025914 Ga0207671_10004439 Ga0207671_100044395 120
102 3300025914 Ga0207671_10200517 Ga0207671_102005172 120
103 3300025917 Ga0207660_10028761 Ga0207660_100287612 120
104 3300025917 Ga0207660_10161763 Ga0207660_101617631 120
105 3300025919 Ga0207657_10074795 Ga0207657_100747953 120
106 3300025921 Ga0207652_10057163 Ga0207652_100571633 120
107 3300025921 Ga0207652_10349005 Ga0207652_103490053 120
108 3300025923 Ga0207681_10506549 Ga0207681_105065492 120
109 3300025926 Ga0207659_11093942 Ga0207659_110939421 120
110 3300025927 Ga0207687_10191376 Ga0207687_101913763 120
111 3300025932 Ga0207690_10230028 Ga0207690_102300282 120
112 3300025934 Ga0207686_10018402 Ga0207686_100184025 120
113 3300025938 Ga0207704_10032899 Ga0207704_100328992 120
114 3300025942 Ga0207689_10000329 Ga0207689_100003296 120
115 3300025944 Ga0207661_10003609 Ga0207661_1000360913 120
116 3300025949 Ga0207667_10095714 Ga0207667_100957142 120
117 3300025960 Ga0207651_10362253 Ga0207651_103622532 120
118 3300025961 Ga0207712_10009000 Ga0207712_100090005 120
119 3300025961 Ga0207712_10091109 Ga0207712_100911094 120
120 3300025972 Ga0207668_10764040 Ga0207668_107640402 120
121 3300026035 Ga0207703_10001495 Ga0207703_100014956 120
122 3300026041 Ga0207639_10075741 Ga0207639_100757412 120
123 3300026041 Ga0207639_11264813 Ga0207639_112648131 120
124 3300026041 Ga0207639_11457408 Ga0207639_114574082 120
125 3300026067 Ga0207678_10161112 Ga0207678_101611123 120
126 3300026088 Ga0207641_10000152 Ga0207641_1000015279 120
127 3300026116 Ga0207674_10371836 Ga0207674_103718362 120
128 3300026118 Ga0207675_100549853 Ga0207675_1005498532 120
129 3300026142 Ga0207698_10003540 Ga0207698_100035402 120
130 3300028381 Ga0268264_10001955 Ga0268264_1000195512 120
131 3300028381 Ga0268264_10002744 Ga0268264_100027447 120
132 3300028556 Ga0265337_1000058 Ga0265337_100005824 120
133 3300028556 Ga0265337_1012222 Ga0265337_10122222 120
134 3300028558 Ga0265326_10006210 Ga0265326_100062102 120
135 3300028558 Ga0265326_10007245 Ga0265326_100072452 120
136 3300028563 Ga0265319_1000036 Ga0265319_100003623 120
137 3300028563 Ga0265319_1001335 Ga0265319_10013355 120
138 3300028563 Ga0265319_1074648 Ga0265319_10746482 120
139 3300028563 Ga0265319_1110016 Ga0265319_11100162 120
140 3300028573 Ga0265334_10009799 Ga0265334_100097993 120
141 3300028577 Ga0265318_10001331 Ga0265318_100013314 120
142 3300028577 Ga0265318_10012422 Ga0265318_100124222 120
143 3300028653 Ga0265323_10008893 Ga0265323_100088933 120
144 3300028666 Ga0265336_10000041 Ga0265336_1000004147 120
145 3300028786 Ga0307517_10121109 Ga0307517_101211092 120
146 3300028800 Ga0265338_10000056 Ga0265338_10000056145 120
147 3300028800 Ga0265338_10000432 Ga0265338_1000043211 120
148 3300028800 Ga0265338_10001235 Ga0265338_1000123512 120
149 3300028800 Ga0265338_10003585 Ga0265338_1000358510 120
150 3300029957 Ga0265324_10000468 Ga0265324_1000046813 120
151 3300029957 Ga0265324_10001493 Ga0265324_100014935 120
152 3300029957 Ga0265324_10007858 Ga0265324_100078582 120
153 3300029957 Ga0265324_10075197 Ga0265324_100751973 120
154 3300030521 Ga0307511_10000387 Ga0307511_1000038732 120
155 3300031235 Ga0265330_10004096 Ga0265330_100040966 120
156 3300031238 Ga0265332_10000291 Ga0265332_1000029113 120
157 3300031239 Ga0265328_10000524 Ga0265328_1000052415 120
158 3300031240 Ga0265320_10002425 Ga0265320_1000242511 120
159 3300031240 Ga0265320_10003963 Ga0265320_100039635 120
160 3300031240 Ga0265320_10168133 Ga0265320_101681331 120
161 3300031241 Ga0265325_10001533 Ga0265325_100015332 120
162 3300031241 Ga0265325_10138758 Ga0265325_101387581 120
163 3300031242 Ga0265329_10000331 Ga0265329_100003316 120
164 3300031247 Ga0265340_10002965 Ga0265340_100029656 120
165 3300031249 Ga0265339_10000497 Ga0265339_1000049713 120
166 3300031249 Ga0265339_10084587 Ga0265339_100845871 120
167 3300031250 Ga0265331_10000519 Ga0265331_1000051930 120
168 3300031251 Ga0265327_10059659 Ga0265327_100596592 120
169 3300031344 Ga0265316_10007717 Ga0265316_100077172 120
170 3300031344 Ga0265316_10015679 Ga0265316_100156791 120
171 3300031344 Ga0265316_10131645 Ga0265316_101316452 120
172 3300031507 Ga0307509_10301838 Ga0307509_103018382 120
173 3300031595 Ga0265313_10014499 Ga0265313_100144992 120
174 3300031595 Ga0265313_10019092 Ga0265313_100190923 120
175 3300031711 Ga0265314_10000782 Ga0265314_1000078223 120
176 3300031711 Ga0265314_10047526 Ga0265314_100475263 120
177 3300031712 Ga0265342_10001519 Ga0265342_1000151922 120
178 3300031712 Ga0265342_10356802 Ga0265342_103568021 120
179 3300035695 Ga0373927_0007722 Ga0373927_0007722_6664_7098 120
180 3300038443 Ga0395901_0101161 Ga0395901_0101161_1448_1834 120
181 3300039437 Ga0436365_1523612 Ga0436365_1523612_90_476 120
182 3300041459 Ga0451800_0599828 Ga0451800_0599828_124_507 120
183 3300041507 Ga0451851_0210247 Ga0451851_0210247_100_483 120
184 3300041999 Ga0439433_0184680 Ga0439433_0184680_115_501 120
185 3300042007 Ga0439449_0001776 Ga0439449_0001776_6135_6521 120
186 3300042014 Ga0439457_014338 Ga0439457_014338_654_1040 120
187 3300042015 Ga0439462_0032550 Ga0439462_0032550_660_1046 120
188 3300042876 Ga0451577_0000227 Ga0451577_0000227_44265_44648 120
189 3300042876 Ga0451577_0975538 Ga0451577_0975538_59_442 120
190 3300044712 Ga0453684_0000033 Ga0453684_0000033_498963_499346 120
191 3300044712 Ga0453684_0020165 Ga0453684_0020165_309_701 120
192 3300044712 Ga0453684_0200277 Ga0453684_0200277_520_903 120
193 3300045051 Ga0451576_1459443 Ga0451576_1459443_232_657 120
194 3300046474 Ga0495605_0393717 Ga0495605_0393717_62_448 120
195 3300046648 Ga0495611_0051480 Ga0495611_0051480_1392_1775 120
196 3300046665 Ga0495661_0000527 Ga0495661_0000527_32184_32570 120
197 3300046665 Ga0495661_0037181 Ga0495661_0037181_1960_2346 120
198 3300048917 Ga0496114_0001010 Ga0496114_0001010_11113_11511 120
199 3300049570 Ga0501033_0702343 Ga0501033_0702343_39_425 120
200 3300049686 Ga0501257_203020 Ga0501257_203020_25_411 120
201 3300049822 Ga0501035_0464089 Ga0501035_0464089_257_643 120
202 3300050509 nmdc:mga0qj67_841687_c1 nmdc:mga0qj67_841687_c1_117_521 120
203 3300053133 Ga0500655_022339 Ga0500655_022339_621_1007 120
204 3300053178 Ga0500637_0233823 Ga0500637_0233823_331_717 120
205 2162886011 MRS1b_contig_2472133 MRS1b_0232.00001940 121
206 3300005290 Ga0065712_10085896 Ga0065712_100858962 121
207 3300005340 Ga0070689_100344950 Ga0070689_1003449502 121
208 3300005439 Ga0070711_101149523 Ga0070711_1011495231 121
209 3300025936 Ga0207670_10147350 Ga0207670_101473502 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

146

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7644 6 118
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.7569 4 121
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7407 4 119
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7386 3 119
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7366 1 119
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8758 66 121 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8149 68 117 3.30.720.110
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7635 8 119 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7569 4 121 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7448 8 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D6EPX2-F1-model_v4 VOC family protein 0.9761 58 121
AF-A0A523J2K1-F1-model_v4 VOC family protein 0.9563 18 121
AF-A0A1T4T679-F1-model_v4 VOC domain-containing protein 0.9541 4 121
AF-A0A2E0L2C7-F1-model_v4 Glyoxalase 0.9503 5 121
AF-A0A1A6C1B2-F1-model_v4 Glyoxalase 0.9502 4 121

Feature Viewer

pLDDT pTM Quality
93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map